Basic Information | |
---|---|
Family ID | F043256 |
Family Type | Metagenome |
Number of Sequences | 156 |
Average Sequence Length | 47 residues |
Representative Sequence | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELAGWR |
Number of Associated Samples | 79 |
Number of Associated Scaffolds | 156 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 82.89 % |
% of genes near scaffold ends (potentially truncated) | 83.97 % |
% of genes from short scaffolds (< 2000 bps) | 97.44 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (85.256 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (87.180 % of family members) |
Environment Ontology (ENVO) | Unclassified (87.821 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (87.821 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 156 Family Scaffolds |
---|---|---|
PF04195 | Transposase_28 | 2.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 85.26 % |
All Organisms | root | All Organisms | 14.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005338|Ga0068868_101098829 | Not Available | 731 | Open in IMG/M |
3300005364|Ga0070673_102340019 | Not Available | 508 | Open in IMG/M |
3300005456|Ga0070678_101562708 | Not Available | 619 | Open in IMG/M |
3300005459|Ga0068867_101186257 | Not Available | 700 | Open in IMG/M |
3300005718|Ga0068866_11282873 | Not Available | 531 | Open in IMG/M |
3300006881|Ga0068865_101342654 | Not Available | 637 | Open in IMG/M |
3300009098|Ga0105245_12591921 | Not Available | 560 | Open in IMG/M |
3300009148|Ga0105243_11416062 | Not Available | 716 | Open in IMG/M |
3300011119|Ga0105246_11629342 | Not Available | 611 | Open in IMG/M |
3300013296|Ga0157374_11599461 | Not Available | 676 | Open in IMG/M |
3300013296|Ga0157374_12786128 | Not Available | 516 | Open in IMG/M |
3300013297|Ga0157378_12206460 | Not Available | 602 | Open in IMG/M |
3300013297|Ga0157378_12929487 | Not Available | 529 | Open in IMG/M |
3300014745|Ga0157377_10362385 | Not Available | 976 | Open in IMG/M |
3300014969|Ga0157376_10911630 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 897 | Open in IMG/M |
3300014969|Ga0157376_13104709 | Not Available | 503 | Open in IMG/M |
3300015268|Ga0182154_1073840 | Not Available | 502 | Open in IMG/M |
3300015268|Ga0182154_1074086 | Not Available | 501 | Open in IMG/M |
3300015269|Ga0182113_1046853 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 628 | Open in IMG/M |
3300015269|Ga0182113_1072313 | Not Available | 552 | Open in IMG/M |
3300015269|Ga0182113_1086978 | Not Available | 521 | Open in IMG/M |
3300015269|Ga0182113_1088928 | Not Available | 517 | Open in IMG/M |
3300015269|Ga0182113_1095178 | Not Available | 506 | Open in IMG/M |
3300015274|Ga0182188_1051795 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 529 | Open in IMG/M |
3300015274|Ga0182188_1054872 | Not Available | 521 | Open in IMG/M |
3300015275|Ga0182172_1041665 | Not Available | 602 | Open in IMG/M |
3300015275|Ga0182172_1059294 | Not Available | 544 | Open in IMG/M |
3300015277|Ga0182128_1030714 | Not Available | 660 | Open in IMG/M |
3300015277|Ga0182128_1032267 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 652 | Open in IMG/M |
3300015277|Ga0182128_1045844 | Not Available | 591 | Open in IMG/M |
3300015277|Ga0182128_1065957 | Not Available | 532 | Open in IMG/M |
3300015279|Ga0182174_1018698 | Not Available | 775 | Open in IMG/M |
3300015279|Ga0182174_1027729 | Not Available | 697 | Open in IMG/M |
3300015279|Ga0182174_1063713 | Not Available | 551 | Open in IMG/M |
3300015281|Ga0182160_1029620 | Not Available | 676 | Open in IMG/M |
3300015281|Ga0182160_1068951 | Not Available | 533 | Open in IMG/M |
3300015283|Ga0182156_1054003 | Not Available | 583 | Open in IMG/M |
3300015283|Ga0182156_1061623 | Not Available | 560 | Open in IMG/M |
3300015283|Ga0182156_1064338 | Not Available | 553 | Open in IMG/M |
3300015283|Ga0182156_1071319 | Not Available | 536 | Open in IMG/M |
3300015285|Ga0182186_1006953 | Not Available | 1019 | Open in IMG/M |
3300015285|Ga0182186_1071912 | Not Available | 525 | Open in IMG/M |
3300015287|Ga0182171_1062217 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 559 | Open in IMG/M |
3300015287|Ga0182171_1067499 | Not Available | 546 | Open in IMG/M |
3300015288|Ga0182173_1053345 | Not Available | 580 | Open in IMG/M |
3300015288|Ga0182173_1075319 | Not Available | 524 | Open in IMG/M |
3300015289|Ga0182138_1033792 | Not Available | 666 | Open in IMG/M |
3300015289|Ga0182138_1063610 | Not Available | 557 | Open in IMG/M |
3300015289|Ga0182138_1082672 | Not Available | 515 | Open in IMG/M |
3300015289|Ga0182138_1087859 | Not Available | 505 | Open in IMG/M |
3300015291|Ga0182125_1077920 | Not Available | 534 | Open in IMG/M |
3300015292|Ga0182141_1040888 | Not Available | 643 | Open in IMG/M |
3300015292|Ga0182141_1044906 | Not Available | 626 | Open in IMG/M |
3300015292|Ga0182141_1091542 | Not Available | 507 | Open in IMG/M |
3300015294|Ga0182126_1030999 | Not Available | 700 | Open in IMG/M |
3300015295|Ga0182175_1053140 | Not Available | 606 | Open in IMG/M |
3300015295|Ga0182175_1063571 | Not Available | 575 | Open in IMG/M |
3300015296|Ga0182157_1029735 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 725 | Open in IMG/M |
3300015296|Ga0182157_1094975 | Not Available | 516 | Open in IMG/M |
3300015298|Ga0182106_1027752 | Not Available | 742 | Open in IMG/M |
3300015298|Ga0182106_1087262 | Not Available | 529 | Open in IMG/M |
3300015299|Ga0182107_1053105 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 619 | Open in IMG/M |
3300015299|Ga0182107_1097241 | Not Available | 514 | Open in IMG/M |
3300015300|Ga0182108_1065296 | Not Available | 586 | Open in IMG/M |
3300015302|Ga0182143_1072447 | Not Available | 563 | Open in IMG/M |
3300015303|Ga0182123_1043939 | Not Available | 636 | Open in IMG/M |
3300015303|Ga0182123_1055310 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 596 | Open in IMG/M |
3300015303|Ga0182123_1071772 | Not Available | 553 | Open in IMG/M |
3300015304|Ga0182112_1050765 | Not Available | 628 | Open in IMG/M |
3300015307|Ga0182144_1012728 | Not Available | 937 | Open in IMG/M |
3300015308|Ga0182142_1071066 | Not Available | 585 | Open in IMG/M |
3300015308|Ga0182142_1074660 | Not Available | 576 | Open in IMG/M |
3300015308|Ga0182142_1085620 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 552 | Open in IMG/M |
3300015308|Ga0182142_1116684 | Not Available | 500 | Open in IMG/M |
3300015314|Ga0182140_1012695 | Not Available | 957 | Open in IMG/M |
3300015314|Ga0182140_1061088 | Not Available | 614 | Open in IMG/M |
3300015321|Ga0182127_1096406 | Not Available | 547 | Open in IMG/M |
3300015321|Ga0182127_1099912 | Not Available | 540 | Open in IMG/M |
3300015322|Ga0182110_1045338 | Not Available | 686 | Open in IMG/M |
3300015322|Ga0182110_1076772 | Not Available | 586 | Open in IMG/M |
3300015322|Ga0182110_1104916 | Not Available | 531 | Open in IMG/M |
3300015323|Ga0182129_1039616 | Not Available | 694 | Open in IMG/M |
3300015323|Ga0182129_1101955 | Not Available | 524 | Open in IMG/M |
3300015341|Ga0182187_1091942 | Not Available | 664 | Open in IMG/M |
3300015341|Ga0182187_1139680 | Not Available | 574 | Open in IMG/M |
3300015342|Ga0182109_1179247 | Not Available | 547 | Open in IMG/M |
3300015342|Ga0182109_1188279 | Not Available | 537 | Open in IMG/M |
3300015342|Ga0182109_1201224 | Not Available | 523 | Open in IMG/M |
3300015343|Ga0182155_1169529 | Not Available | 559 | Open in IMG/M |
3300015343|Ga0182155_1188995 | Not Available | 537 | Open in IMG/M |
3300015344|Ga0182189_1133923 | Not Available | 617 | Open in IMG/M |
3300015344|Ga0182189_1170172 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 564 | Open in IMG/M |
3300015345|Ga0182111_1030076 | Not Available | 1084 | Open in IMG/M |
3300015346|Ga0182139_1044331 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 950 | Open in IMG/M |
3300015346|Ga0182139_1235139 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 511 | Open in IMG/M |
3300015347|Ga0182177_1117290 | Not Available | 671 | Open in IMG/M |
3300015347|Ga0182177_1127698 | Not Available | 650 | Open in IMG/M |
3300015347|Ga0182177_1134273 | Not Available | 637 | Open in IMG/M |
3300015347|Ga0182177_1161812 | Not Available | 594 | Open in IMG/M |
3300015347|Ga0182177_1187701 | Not Available | 561 | Open in IMG/M |
3300015347|Ga0182177_1240331 | Not Available | 509 | Open in IMG/M |
3300015351|Ga0182161_1158381 | Not Available | 620 | Open in IMG/M |
3300015351|Ga0182161_1203756 | Not Available | 561 | Open in IMG/M |
3300015351|Ga0182161_1250689 | Not Available | 516 | Open in IMG/M |
3300015355|Ga0182159_1186764 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 662 | Open in IMG/M |
3300015355|Ga0182159_1304588 | Not Available | 535 | Open in IMG/M |
3300015361|Ga0182145_1148402 | Not Available | 551 | Open in IMG/M |
3300017404|Ga0182203_1021332 | Not Available | 949 | Open in IMG/M |
3300017404|Ga0182203_1103523 | Not Available | 585 | Open in IMG/M |
3300017407|Ga0182220_1015101 | Not Available | 858 | Open in IMG/M |
3300017409|Ga0182204_1060155 | Not Available | 621 | Open in IMG/M |
3300017409|Ga0182204_1095774 | Not Available | 539 | Open in IMG/M |
3300017410|Ga0182207_1023081 | Not Available | 968 | Open in IMG/M |
3300017410|Ga0182207_1035504 | Not Available | 849 | Open in IMG/M |
3300017410|Ga0182207_1047125 | Not Available | 777 | Open in IMG/M |
3300017410|Ga0182207_1101626 | Not Available | 607 | Open in IMG/M |
3300017411|Ga0182208_1118547 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 517 | Open in IMG/M |
3300017413|Ga0182222_1037891 | Not Available | 661 | Open in IMG/M |
3300017415|Ga0182202_1073820 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 617 | Open in IMG/M |
3300017415|Ga0182202_1093872 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 572 | Open in IMG/M |
3300017415|Ga0182202_1126994 | Not Available | 518 | Open in IMG/M |
3300017417|Ga0182230_1094816 | Not Available | 548 | Open in IMG/M |
3300017417|Ga0182230_1107930 | Not Available | 518 | Open in IMG/M |
3300017420|Ga0182228_1038295 | Not Available | 793 | Open in IMG/M |
3300017420|Ga0182228_1105681 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 541 | Open in IMG/M |
3300017424|Ga0182219_1015186 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 1014 | Open in IMG/M |
3300017425|Ga0182224_1107409 | Not Available | 579 | Open in IMG/M |
3300017427|Ga0182190_1084120 | Not Available | 634 | Open in IMG/M |
3300017430|Ga0182192_1114560 | Not Available | 581 | Open in IMG/M |
3300017430|Ga0182192_1114588 | Not Available | 581 | Open in IMG/M |
3300017430|Ga0182192_1138297 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 544 | Open in IMG/M |
3300017430|Ga0182192_1166979 | Not Available | 509 | Open in IMG/M |
3300017436|Ga0182209_1032838 | Not Available | 849 | Open in IMG/M |
3300017438|Ga0182191_1101059 | Not Available | 614 | Open in IMG/M |
3300017442|Ga0182221_1116297 | Not Available | 567 | Open in IMG/M |
3300017442|Ga0182221_1158616 | Not Available | 514 | Open in IMG/M |
3300017443|Ga0182193_1121923 | Not Available | 595 | Open in IMG/M |
3300017443|Ga0182193_1150887 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 553 | Open in IMG/M |
3300017443|Ga0182193_1185085 | Not Available | 513 | Open in IMG/M |
3300017443|Ga0182193_1193743 | Not Available | 505 | Open in IMG/M |
3300017680|Ga0182233_1114438 | Not Available | 505 | Open in IMG/M |
3300017681|Ga0182226_1088585 | Not Available | 579 | Open in IMG/M |
3300017683|Ga0182218_1145299 | Not Available | 511 | Open in IMG/M |
3300017685|Ga0182227_1097358 | Not Available | 570 | Open in IMG/M |
3300017685|Ga0182227_1131405 | Not Available | 509 | Open in IMG/M |
3300017686|Ga0182205_1066099 | Not Available | 692 | Open in IMG/M |
3300017686|Ga0182205_1149906 | Not Available | 526 | Open in IMG/M |
3300017690|Ga0182223_1065391 | Not Available | 602 | Open in IMG/M |
3300021060|Ga0182232_1081910 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 524 | Open in IMG/M |
3300025938|Ga0207704_11338982 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 613 | Open in IMG/M |
3300025942|Ga0207689_10879460 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 756 | Open in IMG/M |
3300026089|Ga0207648_10910907 | Not Available | 822 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 87.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.64% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.64% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068868_1010988291 | 3300005338 | Miscanthus Rhizosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKAL |
Ga0070673_1023400191 | 3300005364 | Switchgrass Rhizosphere | MAKNDAQKKAGVMAKEWWKSKSNEQTIEDLITMGVLHNKELIGW |
Ga0070678_1015627081 | 3300005456 | Miscanthus Rhizosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAG |
Ga0068867_1011862571 | 3300005459 | Miscanthus Rhizosphere | MAKKNAQKKAGVMAKEWWKSRSNDQTIEDLVTMGVLHNKALVGWRA |
Ga0068866_112828731 | 3300005718 | Miscanthus Rhizosphere | MAKSDTQKKAKVMAKEWWKSRSNEQTIEDLVIMGVLHNKELA |
Ga0068865_1013426541 | 3300006881 | Miscanthus Rhizosphere | MARRDAQKKGGIMAKEWWKPRSNEQTIEDLVAMGVLHNK |
Ga0105245_125919211 | 3300009098 | Miscanthus Rhizosphere | MAKRDAPKKGGIMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWR |
Ga0105243_114160621 | 3300009148 | Miscanthus Rhizosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGILHNKELAG* |
Ga0105246_116293422 | 3300011119 | Miscanthus Rhizosphere | MVKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALVGWRAPEGESF |
Ga0157374_115994611 | 3300013296 | Miscanthus Rhizosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRAPEGE |
Ga0157374_127861281 | 3300013296 | Miscanthus Rhizosphere | MAKSDAQKKAGVMAKEWWKSKSNEQTIEDLVTMGVLHNKEL |
Ga0157378_122064601 | 3300013297 | Miscanthus Rhizosphere | MAKSDAQKKTGVMAKEWWKSRSNEQTIEDLVIMGVLHNKELAGW |
Ga0157378_129294871 | 3300013297 | Miscanthus Rhizosphere | MAKRDTQKKGGVMAKEWWKLRSNEQTIEDLITMGVLHNKALAGWHAPEGESFPDPQPGE |
Ga0157377_103623852 | 3300014745 | Miscanthus Rhizosphere | MAKGDAQKKSRVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWR |
Ga0157376_109116302 | 3300014969 | Miscanthus Rhizosphere | MAKSDAQKKAGVMAKEWWKSKSNELTIEDLVTMGVLHNMELAG* |
Ga0157376_131047091 | 3300014969 | Miscanthus Rhizosphere | MANRDAQKKGGVMAKEWWKSRSNEQTIEDLIAMGVLHNKALAGWRAPEG |
Ga0182154_10738401 | 3300015268 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVAMGVLHNKEFTGW |
Ga0182154_10740861 | 3300015268 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHN |
Ga0182113_10468531 | 3300015269 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVIVGVLHNKELVGWRALEGEGYPDP* |
Ga0182113_10723131 | 3300015269 | Miscanthus Phyllosphere | MAKKDAQKKGRVMVKEWWKSRSNEQTIEDLVAMGVLHNKAL |
Ga0182113_10869781 | 3300015269 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVIMGVLHNKELAGWHAPEGEGYPDP |
Ga0182113_10889281 | 3300015269 | Miscanthus Phyllosphere | MAKSDAQKKVGVMAKEWWKSRINEQTIEDLITMGVLHNKELTGWHVPEGEG |
Ga0182113_10951781 | 3300015269 | Miscanthus Phyllosphere | MAKRDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKALA |
Ga0182188_10517951 | 3300015274 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKSKSNEHTIEDLVTMGVLHNKELTGWRAPEGEGYLDPQ |
Ga0182188_10548721 | 3300015274 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVL |
Ga0182172_10416651 | 3300015275 | Miscanthus Phyllosphere | MAKSDAQKKKRAMAKEWWKSKSNEQTEEDLITMGILDNKELTGWHALEG |
Ga0182172_10592941 | 3300015275 | Miscanthus Phyllosphere | MAKRAAQKKGGVMEKEWWKSRSNEQTIEDLVAMGVLHNKA |
Ga0182128_10307141 | 3300015277 | Miscanthus Phyllosphere | MAKSDAQKRIGVMAKEWWKSKSNEQTIEDLITMGV |
Ga0182128_10322671 | 3300015277 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELVGWRAPEGEGHPDPQPGEIVVF |
Ga0182128_10458443 | 3300015277 | Miscanthus Phyllosphere | MAKRDAQKKSRVMAKEWWKSRSNEQTIEDLVAMGVLH |
Ga0182128_10659572 | 3300015277 | Miscanthus Phyllosphere | MAKRDAQKKAGVMAKEWWKSRSNEQTIEDLVAMGVLH |
Ga0182174_10186982 | 3300015279 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRAPEG |
Ga0182174_10277293 | 3300015279 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSKSNEQTIEDLITMGVLH |
Ga0182174_10637131 | 3300015279 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLIAMGVLHNKALAGWRAPEGES |
Ga0182160_10296201 | 3300015281 | Miscanthus Phyllosphere | MAKRNAQKKGGVMAKEWWKSRSNEQTIKDLVAMGVLHN |
Ga0182160_10689511 | 3300015281 | Miscanthus Phyllosphere | MAKSDAQKKIGVMAKEWWKSKSNEQTIEDLVTMGVLHDKKLAGWRASEGAGYPDP* |
Ga0182156_10540031 | 3300015283 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRAPEGESFPNP |
Ga0182156_10616231 | 3300015283 | Miscanthus Phyllosphere | MAKRDAQKKTRVMAKEWWKSRSNEQTIEDLVTMGVLHNKALA |
Ga0182156_10643381 | 3300015283 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSQSNEQTIEDLVAMGVLHNKALAG |
Ga0182156_10713191 | 3300015283 | Miscanthus Phyllosphere | MAKSDAQRKAGVMAKEWWKSKSNEQTIEDLITMRVLHNKELAGWHAPEG |
Ga0182186_10069533 | 3300015285 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRA |
Ga0182186_10719121 | 3300015285 | Miscanthus Phyllosphere | MVKSDAQNKTGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELTRWRAPEGEGYPDPHPG* |
Ga0182171_10622171 | 3300015287 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELVGWRAPEGERYPDP* |
Ga0182171_10674991 | 3300015287 | Miscanthus Phyllosphere | MAKSNTQKKAGVMAKEWWKSRSNEQTIEDLVAMGVLHNKELIGWRAPGAKGTPINN* |
Ga0182171_10742641 | 3300015287 | Miscanthus Phyllosphere | MAKSDTQKKAGVMAKEWWKPRSNEQTIEDLVIMGVLHDKELAGWRVPEGEGYPDPQPSEI |
Ga0182173_10533452 | 3300015288 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLH |
Ga0182173_10753191 | 3300015288 | Miscanthus Phyllosphere | MAKSDAQKKAGVMVKEWWKSRSNEQTIEDLIIMGVLHNKALAGWHT |
Ga0182138_10337921 | 3300015289 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSGSNEQTIEDLIIMGVL |
Ga0182138_10636101 | 3300015289 | Miscanthus Phyllosphere | MAKRDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKALAGWRAPEGES |
Ga0182138_10826721 | 3300015289 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKLKSNEQTIEDLVTMGVLHDKEL |
Ga0182138_10878591 | 3300015289 | Miscanthus Phyllosphere | MARRDAQKKGGIMAKEWWKSQSNEQTIEDLVAMGVLHNKALAGWRAPE |
Ga0182125_10779201 | 3300015291 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKSKSNELTIEDLVTMGVLHNKELIGWRTPEGE |
Ga0182141_10408881 | 3300015292 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSSEQTIEELVTMGVLHNKEL |
Ga0182141_10449061 | 3300015292 | Miscanthus Phyllosphere | MAKRDAQKKSRVMAKEWWKSRSNEQTIEDLVAMGV |
Ga0182141_10915421 | 3300015292 | Miscanthus Phyllosphere | MARRDAQKKGGIMAKEWWKSRSNEQTIEDLVAMGVLHNKALAG |
Ga0182126_10309991 | 3300015294 | Miscanthus Phyllosphere | MAKSDAQKKAGVMSKEWWKSRSNEQTIEDLIIMGVLHNKELVG* |
Ga0182175_10531401 | 3300015295 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELAGWR |
Ga0182175_10635711 | 3300015295 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGV |
Ga0182157_10297351 | 3300015296 | Miscanthus Phyllosphere | MVKSDAQKKAGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELVGWRAPKGEGYPDPQP |
Ga0182157_10949753 | 3300015296 | Miscanthus Phyllosphere | MAKRDTQKKGGVMAKEWWKLRSNEQTIEDLITMGVLH |
Ga0182106_10277521 | 3300015298 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWESKSNEQTIEDLVTMGVLHNKEIIGWRA |
Ga0182106_10872621 | 3300015298 | Miscanthus Phyllosphere | MVKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELVGWRAPEG |
Ga0182107_10531052 | 3300015299 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELAGWRAPEGERYPDP* |
Ga0182107_10972411 | 3300015299 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKLRSNEQTIEDLIAMGVLHNKELVGWRAPEGEG* |
Ga0182108_10652961 | 3300015300 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELAGWRVPEG |
Ga0182143_10724471 | 3300015302 | Miscanthus Phyllosphere | MAKKNAQKKAGVMAKEWWRSRSNDQTIEDLVTMGVLHNKALVGW |
Ga0182123_10439391 | 3300015303 | Miscanthus Phyllosphere | MANRDAQKKSGVMAKEWWKSRSNEQTIEDLITMGVLHNKALVGWRAPKGES |
Ga0182123_10553101 | 3300015303 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLITMGVLHNKELVGWRAPEGEGYPDPQP |
Ga0182123_10717721 | 3300015303 | Miscanthus Phyllosphere | MVKSDVQKKIGVMAKEWWKLKSNEQTIEDFVTMGVLHNKELA |
Ga0182112_10507651 | 3300015304 | Miscanthus Phyllosphere | MAKSDAQKKIGVMAKEWWKLKSNEQTIEDLITMGVHHNKELAGWCAPEGKR |
Ga0182144_10127281 | 3300015307 | Miscanthus Phyllosphere | MAKRDTQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRAPEGES |
Ga0182142_10710661 | 3300015308 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELTGWRAPEG |
Ga0182142_10746601 | 3300015308 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELAGWRVPEGKRYPNPQPG |
Ga0182142_10856201 | 3300015308 | Miscanthus Phyllosphere | MAKRDTQKKGRVMAKEWWKSRSNEQTNEDLVAMGVLHNKALTG* |
Ga0182142_11166841 | 3300015308 | Miscanthus Phyllosphere | MVKRDAQKKGRVMAKEWWKSRSNEQTIEDLVTMGVLHNKAL |
Ga0182140_10126952 | 3300015314 | Miscanthus Phyllosphere | MAKGDAQKKSRVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRAPVGESFPDP |
Ga0182140_10610881 | 3300015314 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKLRSNEQTIEDLIIMGV |
Ga0182127_10964061 | 3300015321 | Miscanthus Phyllosphere | MVKRDTQKKGGIMAKEWWKSRSNEQTIEDLIAMGVLYSKALAGWRAPEGESFPD |
Ga0182127_10999121 | 3300015321 | Miscanthus Phyllosphere | MAKRDTQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRGSEGESFPDPQTGE |
Ga0182110_10453383 | 3300015322 | Miscanthus Phyllosphere | MAKRDAQKKGGVMVKEWWKSRSNEQTIEDLVAMGVLHNKA |
Ga0182110_10767721 | 3300015322 | Miscanthus Phyllosphere | MAKSDAQKKVGVMAKEWWKSRSNEQTIEDLVIMGVLHNK |
Ga0182110_11049161 | 3300015322 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELTGWR |
Ga0182129_10396161 | 3300015323 | Miscanthus Phyllosphere | MAKRDAQKKTRVMAKEWWKSRSNEQTIEDLVIMGVLHNKAL |
Ga0182129_11019551 | 3300015323 | Miscanthus Phyllosphere | MAKRDAKKKGGVMAKEWWKSRSNEQTIEDLVTMGVLHNKALAGW |
Ga0182187_10919421 | 3300015341 | Miscanthus Phyllosphere | MVKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELVG |
Ga0182187_11396801 | 3300015341 | Miscanthus Phyllosphere | MAKSDAQKKTGVTTKEWWKSKSNEQTIEDLVTMGVLHNKEL |
Ga0182109_11792471 | 3300015342 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELAGWRAPEG |
Ga0182109_11882791 | 3300015342 | Miscanthus Phyllosphere | MAKRDTQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKAL |
Ga0182109_12012241 | 3300015342 | Miscanthus Phyllosphere | MVKSDAQKKAGVMTKEWWKLRSNEQTIEDLVTMGVLHNK |
Ga0182155_11695291 | 3300015343 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIKDLVAMGVLHNKAL |
Ga0182155_11889951 | 3300015343 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELAGWHALEGEGYPNPQ |
Ga0182189_11339231 | 3300015344 | Miscanthus Phyllosphere | MVKSNAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELVGWHAPEVDGYPDP* |
Ga0182189_11701722 | 3300015344 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSKSNEQTIEDLLTMGVLHNKELTGWRAPEGERYPDP* |
Ga0182111_10300762 | 3300015345 | Miscanthus Phyllosphere | MAKSDAQKKVGVMAKEWWKSRSNEETIEDLVTMGVLHNKELAGWHAPE |
Ga0182111_10565472 | 3300015345 | Miscanthus Phyllosphere | MAKRNAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRAPEGESFPDPQ |
Ga0182139_10443312 | 3300015346 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELVGWRAPKGTA* |
Ga0182139_12351391 | 3300015346 | Miscanthus Phyllosphere | MAKSDAQKKAEVVAKEWWKSRSNEQTIEDLITMGVLHNKELVGWRAPEGEGYPDP* |
Ga0182177_11172901 | 3300015347 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELAGW |
Ga0182177_11276981 | 3300015347 | Miscanthus Phyllosphere | MAKKNAQKKAGVMAKEWWRSRSNDQTIEDLVTMGVLHNKALVGWRAPEGESYPD |
Ga0182177_11342731 | 3300015347 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVTMGVLHNKALAGWRAPEGE |
Ga0182177_11618121 | 3300015347 | Miscanthus Phyllosphere | MAKRDAQKKAGVMAKEWWKSRSNEQTIEDLIIMGVLHNKALA* |
Ga0182177_11877011 | 3300015347 | Miscanthus Phyllosphere | MAKRDAQKKTGVMAKEWWKSRSNEQTIEDLVAMGVLH |
Ga0182177_12403311 | 3300015347 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSWSNEQTIEDLVAMGVLHNKALAGWRA |
Ga0182161_11583811 | 3300015351 | Miscanthus Phyllosphere | MAKSDAQKKAGIMVKEWWKSRSNEQTIEDLVTMGVLHNKELAGWHA |
Ga0182161_12037563 | 3300015351 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSKGNEQTIEDLVTMGVLHNKELIGWHAPEGERYPDP* |
Ga0182161_12506891 | 3300015351 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKLRSNEQTIEDLIIMGVLHNKEL |
Ga0182159_11867641 | 3300015355 | Miscanthus Phyllosphere | MAKKNAQKKAGVMAKEWWKSRSNDQTIEGLVTMGVLHNKALVGWRAPEGESYPDPQPGEIVV |
Ga0182159_13045881 | 3300015355 | Miscanthus Phyllosphere | MAKRDAQKKGEVMAKEWWKSRSNEQTIEDLVAMGVLHNKALVGWRAPEGES |
Ga0182145_11484021 | 3300015361 | Miscanthus Phyllosphere | MVKRDTQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALVGWCAPEGESFPDPQLG |
Ga0182203_10213321 | 3300017404 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELVGWRAPEGKGYPDPQPG |
Ga0182203_11035231 | 3300017404 | Miscanthus Phyllosphere | MAKKNAQKKVGVMAKEWWKSRSNDQTIKDLVTMGVLHNKALVGWRAPEGESYPD |
Ga0182203_11267071 | 3300017404 | Miscanthus Phyllosphere | MAKSEAKKKAEMMAKEWWKSKSNEQTVEDLVAMGVIHNQELSGWRI |
Ga0182220_10151011 | 3300017407 | Miscanthus Phyllosphere | MARRDVQKKGGIMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRA |
Ga0182204_10601551 | 3300017409 | Miscanthus Phyllosphere | MAKRNAQKKGRVMAKEWWKSRSNEETIEDLVAMGVLHNKALAGWRAPKGESF |
Ga0182204_10957742 | 3300017409 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIKDLVIMGVLHNKELLED |
Ga0182207_10230811 | 3300017410 | Miscanthus Phyllosphere | MARRDAQKKSGIIAKEWWKSRSNEQTIEDLVAMGVLHNKALAGW |
Ga0182207_10355041 | 3300017410 | Miscanthus Phyllosphere | MAKRDAQKKGGIMAKEWWKSQSNEQTIEDLVAMGVL |
Ga0182207_10471251 | 3300017410 | Miscanthus Phyllosphere | MARRDAQKKGGIMAKEWWKSRSNEQTIEDLVAMGVLHNKA |
Ga0182207_11016261 | 3300017410 | Miscanthus Phyllosphere | MVKSDAQKKTGVVAREWWKSRSNEQTIEDLVIMGVLHNKALAGW |
Ga0182208_11185471 | 3300017411 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELAGWRALEGEGYPNPQPGEI |
Ga0182222_10378911 | 3300017413 | Miscanthus Phyllosphere | MVKSDTQKKAGVMAKEWWKLRSNEQTIKDLVTMGVLHNKELVGWRAPEGE |
Ga0182202_10738201 | 3300017415 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLITMGVLHNKELAGWRALEGEGYPDPQP |
Ga0182202_10938721 | 3300017415 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKLRSNEQTIEDLVTMGVLHNKELAGWRALEGEGYPDPQPGEI |
Ga0182202_11269942 | 3300017415 | Miscanthus Phyllosphere | MTKSDAQKTTGVMAKEWWKSKSNEQTIEDLITMGVLHNKELVGWHAPKGESYPDP |
Ga0182230_10948161 | 3300017417 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSKSNEQTIEDLVTMRVLHNKELVGWHAPEGEGYLDPQ |
Ga0182230_11079301 | 3300017417 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSKSNEQTIEDLITMGVLHNKELVGWRAPEGEGY |
Ga0182228_10382951 | 3300017420 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGV |
Ga0182228_11056811 | 3300017420 | Miscanthus Phyllosphere | MAKKNAQKKAGVMAKEWWKSRSNDQTIEDLVTMGVLHNKALVG |
Ga0182219_10151862 | 3300017424 | Miscanthus Phyllosphere | MARRDAQKKGGIMAKEWWKSRSNEQTIEDLVAMGVLHN |
Ga0182224_11074091 | 3300017425 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKLKSNEQTIEDLVTMGVLHN |
Ga0182190_10841201 | 3300017427 | Miscanthus Phyllosphere | MARRDAQKKGRIMAKEWWKSRSNEQTIEDLVAMGVLHNKA |
Ga0182190_10918601 | 3300017427 | Miscanthus Phyllosphere | MAKSDAQKKEGVMAKEWWKSISNEQTIKDLVIMGVLHNKELTGWRAAEGKGYPDPQP |
Ga0182192_11145601 | 3300017430 | Miscanthus Phyllosphere | MAKSDAQKKTEVMAKEWWKSKSNELTIEDLVTMGVLHNKELAGWRAPEG |
Ga0182192_11145881 | 3300017430 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSWSNEQTIEDLVVMGVLHNKSLAGWR |
Ga0182192_11382972 | 3300017430 | Miscanthus Phyllosphere | AKSDAQKKAGVMANEWWKSRSNEQAIEDLVIMGVLHNKELAGWRAPEGEGYPDP |
Ga0182192_11669792 | 3300017430 | Miscanthus Phyllosphere | MAKSDAQKKTGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELVGWHASEGEGYPNPQ |
Ga0182209_10328381 | 3300017436 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSRSNEQTIEDLITMGVLHNKELVGWH |
Ga0182191_11010591 | 3300017438 | Miscanthus Phyllosphere | MAKRDAQKKGRVMAKEWWKSQSNDQTIEDLIAMGVLHNKA |
Ga0182221_11162971 | 3300017442 | Miscanthus Phyllosphere | MAKRDTQKKGRVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRAPEGESFPDPQPG |
Ga0182221_11586161 | 3300017442 | Miscanthus Phyllosphere | MVKSDAQKKTGVMAKEWWKSKSNEQTIEDLVTMGVLHNKELAGWHAPEGERYPDPHP |
Ga0182193_11219232 | 3300017443 | Miscanthus Phyllosphere | MAKSDAQKKAGVMAKEWWKSKSNEQTIEDLITMGVLHNKELAGWRA |
Ga0182193_11508872 | 3300017443 | Miscanthus Phyllosphere | MAKRDAQKKGGIMAKEWWKSWSNEQTIEDLVAMGVLHNKALAGWRAPEGESFPDPQPGEIVVF |
Ga0182193_11850851 | 3300017443 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNKQTIEDLVAMGVLHNKALAGWRAPEGES |
Ga0182193_11937431 | 3300017443 | Miscanthus Phyllosphere | MAKRDTQKKGGVMAKEWWKSRRNEQTIKDLVAMGVLHNKALTG |
Ga0182233_11144381 | 3300017680 | Miscanthus Phyllosphere | MAKSDAQKKARVMAKEWWKSRSNEQTIEDLVIMGVLHNKELVG |
Ga0182226_10885851 | 3300017681 | Miscanthus Phyllosphere | MAKRDTQKKGGVMAKEWWKLRSNEQTIEDLITMGVLHNKAL |
Ga0182218_11452991 | 3300017683 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLIAMGVLHNKALAGWHAPEGESFPDPQPG |
Ga0182227_10973581 | 3300017685 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEELVAMGVLHNKALTGWR |
Ga0182227_11314051 | 3300017685 | Miscanthus Phyllosphere | MAKRDAQKKGGVMAKEWWKSWSNEQTIEDLVAMGVLHNKALAGWRAPEGES |
Ga0182205_10660992 | 3300017686 | Miscanthus Phyllosphere | MVKSDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKELVGWHASEGE |
Ga0182205_11499061 | 3300017686 | Miscanthus Phyllosphere | MAKRDAKKKARVMAKEWWKSRSNEQTIEDLITMGVLHNK |
Ga0182223_10653911 | 3300017690 | Miscanthus Phyllosphere | MAKRDAQKRGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWR |
Ga0182232_10819101 | 3300021060 | Phyllosphere | MARRDAQKKGGIMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRAPEGESFPDPQPGEI |
Ga0207704_113389821 | 3300025938 | Miscanthus Rhizosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALTGWHAPEGESFPDPQLGEI |
Ga0207689_108794601 | 3300025942 | Miscanthus Rhizosphere | MAKRDAQKKAGVMAKEWWKSRSNEQTIEDLVTMGVLHNKALAGWRAPEGESYPDP |
Ga0207648_109109072 | 3300026089 | Miscanthus Rhizosphere | MAKRDAQKKGGVMAKEWWKSRSNEQTIEDLVAMGVLHNKALAGWRAPEGESF |
⦗Top⦘ |