Metagenome / Metatranscriptome Family F042985

Basic Information
Family ID	F042985
Family Type	Metagenome / Metatranscriptome
Number of Sequences	157
Average Sequence Length	36 residues
Representative Sequence	MRRVLRKSIPFVQAALIGTLAAAALAGVAMLISHS
Number of Associated Samples	119
Number of Associated Scaffolds	157

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	78.34 %
% of genes near scaffold ends (potentially truncated)	17.83 %
% of genes from short scaffolds (< 2000 bps)	73.25 %
Associated GOLD sequencing projects	115
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.52

Most Common Taxonomy
Group	Bacteria (72.611 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (14.013 % of family members)
Environment Ontology (ENVO)	Unclassified (42.675 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (52.866 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 157 Family Scaffolds
PF13419	HAD_2	21.02
PF00892	EamA	16.56
PF04116	FA_hydroxylase	7.01
PF05656	DUF805	1.91
PF00696	AA_kinase	1.91
PF14805	THDPS_N_2	1.27
PF01757	Acyl_transf_3	1.27
PF01416	PseudoU_synth_1	0.64
PF01926	MMR_HSR1	0.64
PF01546	Peptidase_M20	0.64
PF13000	Acatn	0.64
PF11295	DUF3096	0.64
PF00474	SSF	0.64
PF05199	GMC_oxred_C	0.64
PF02911	Formyl_trans_C	0.64
PF07813	LTXXQ	0.64
PF00535	Glycos_transf_2	0.64
PF01593	Amino_oxidase	0.64

COG ID	Name	Functional Category	% Frequency in 157 Family Scaffolds
COG3000	Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily	Lipid transport and metabolism [I]	7.01
COG3678	Periplasmic chaperone Spy, Spy/CpxP family	Posttranslational modification, protein turnover, chaperones [O]	2.55
COG3152	Uncharacterized membrane protein YhaH, DUF805 family	Function unknown [S]	1.91
COG0101	tRNA U38,U39,U40 pseudouridine synthase TruA	Translation, ribosomal structure and biogenesis [J]	0.64
COG0223	Methionyl-tRNA formyltransferase	Translation, ribosomal structure and biogenesis [J]	0.64
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.64

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.61 %
Unclassified	root	N/A	27.39 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.61 %
Unclassified	root	N/A	27.39 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	72.61 %
Unclassified	root	N/A	27.39 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	71.34 %
Unclassified	root	N/A	27.39 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	65.61 %
Unclassified	root	N/A	27.39 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.39 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	24.20 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	22.93 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.39 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	23.57 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	5.73 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.91 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3	0.64 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.64 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.39 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	23.57 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	5.10 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.91 %
Methylocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa	0.64 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	0.64 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.39 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	23.57 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	4.46 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.91 %
unclassified Methylocapsa	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa	0.64 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	0.64 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.39 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	23.57 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	4.46 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.91 %
Methylocapsa sp. S129	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129	0.64 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.64 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3	0.64 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459004\|F62QY1Z01CFAD0	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	513	Open in IMG/M
3300001356\|JGI12269J14319_10030464	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3600	Open in IMG/M
3300001356\|JGI12269J14319_10244796	Not Available	672	Open in IMG/M
3300002245\|JGIcombinedJ26739_100329691	All Organisms → cellular organisms → Bacteria → Proteobacteria	1408	Open in IMG/M
3300005534\|Ga0070735_10109990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1729	Open in IMG/M
3300005534\|Ga0070735_10215002	All Organisms → cellular organisms → Bacteria → Proteobacteria	1173	Open in IMG/M
3300005541\|Ga0070733_10016525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	4618	Open in IMG/M
3300005541\|Ga0070733_10751468	Not Available	655	Open in IMG/M
3300005548\|Ga0070665_100443300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1308	Open in IMG/M
3300005602\|Ga0070762_10200004	All Organisms → cellular organisms → Bacteria → Proteobacteria	1222	Open in IMG/M
3300005602\|Ga0070762_10922766	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300005764\|Ga0066903_101199923	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1409	Open in IMG/M
3300005764\|Ga0066903_101326569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1346	Open in IMG/M
3300005764\|Ga0066903_102615497	Not Available	978	Open in IMG/M
3300005764\|Ga0066903_104474992	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	746	Open in IMG/M
3300006050\|Ga0075028_100382828	Not Available	801	Open in IMG/M
3300006176\|Ga0070765_101097347	Not Available	752	Open in IMG/M
3300006893\|Ga0073928_10189506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1620	Open in IMG/M
3300006953\|Ga0074063_13515592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1421	Open in IMG/M
3300009518\|Ga0116128_1199188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	563	Open in IMG/M
3300009525\|Ga0116220_10501665	Not Available	551	Open in IMG/M
3300009632\|Ga0116102_1163022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	609	Open in IMG/M
3300009637\|Ga0116118_1124757	Not Available	848	Open in IMG/M
3300009639\|Ga0116122_1199327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	627	Open in IMG/M
3300009640\|Ga0116126_1055155	Not Available	1541	Open in IMG/M
3300009643\|Ga0116110_1045280	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1594	Open in IMG/M
3300009645\|Ga0116106_1228890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	591	Open in IMG/M
3300009764\|Ga0116134_1018503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2864	Open in IMG/M
3300009764\|Ga0116134_1174045	Not Available	754	Open in IMG/M
3300009824\|Ga0116219_10417035	Not Available	748	Open in IMG/M
3300010048\|Ga0126373_10466615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1300	Open in IMG/M
3300010339\|Ga0074046_10396331	Not Available	834	Open in IMG/M
3300010343\|Ga0074044_10640672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	693	Open in IMG/M
3300010373\|Ga0134128_12556302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	563	Open in IMG/M
3300010376\|Ga0126381_101800488	Not Available	884	Open in IMG/M
3300010379\|Ga0136449_100039442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11047	Open in IMG/M
3300010379\|Ga0136449_100222841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3545	Open in IMG/M
3300010379\|Ga0136449_104492110	Not Available	513	Open in IMG/M
3300012089\|Ga0153924_1010764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2083	Open in IMG/M
3300012177\|Ga0153943_1053812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	848	Open in IMG/M
3300012180\|Ga0153974_1104838	All Organisms → cellular organisms → Bacteria → Proteobacteria	644	Open in IMG/M
3300012181\|Ga0153922_1166784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	520	Open in IMG/M
3300012985\|Ga0164308_10842049	Not Available	803	Open in IMG/M
3300014156\|Ga0181518_10035335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3171	Open in IMG/M
3300014159\|Ga0181530_10199747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1101	Open in IMG/M
3300014160\|Ga0181517_10050182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2576	Open in IMG/M
3300014162\|Ga0181538_10306025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	862	Open in IMG/M
3300014165\|Ga0181523_10629909	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	588	Open in IMG/M
3300014169\|Ga0181531_10693809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	633	Open in IMG/M
3300014169\|Ga0181531_11055381	Not Available	511	Open in IMG/M
3300014199\|Ga0181535_10027398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	4338	Open in IMG/M
3300014199\|Ga0181535_10659156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	597	Open in IMG/M
3300014201\|Ga0181537_10600244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	751	Open in IMG/M
3300014325\|Ga0163163_10447376	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300014489\|Ga0182018_10126249	Not Available	1478	Open in IMG/M
3300014501\|Ga0182024_11880125	Not Available	666	Open in IMG/M
3300014655\|Ga0181516_10340844	Not Available	763	Open in IMG/M
3300014838\|Ga0182030_10199381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2399	Open in IMG/M
3300015371\|Ga0132258_10828485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2334	Open in IMG/M
3300015371\|Ga0132258_11441718	Not Available	1739	Open in IMG/M
3300016294\|Ga0182041_12058611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	532	Open in IMG/M
3300016371\|Ga0182034_11194666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	661	Open in IMG/M
3300016371\|Ga0182034_11724760	Not Available	551	Open in IMG/M
3300017823\|Ga0187818_10176483	All Organisms → cellular organisms → Bacteria → Proteobacteria	931	Open in IMG/M
3300017823\|Ga0187818_10412048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	601	Open in IMG/M
3300017925\|Ga0187856_1001088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	22408	Open in IMG/M
3300017925\|Ga0187856_1003700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	10536	Open in IMG/M
3300017940\|Ga0187853_10519392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	518	Open in IMG/M
3300017941\|Ga0187850_10216613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	871	Open in IMG/M
3300017943\|Ga0187819_10054655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2370	Open in IMG/M
3300017946\|Ga0187879_10323533	Not Available	856	Open in IMG/M
3300017955\|Ga0187817_10417293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	856	Open in IMG/M
3300017955\|Ga0187817_10822030	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	593	Open in IMG/M
3300017955\|Ga0187817_11019103	Not Available	531	Open in IMG/M
3300017970\|Ga0187783_10654529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	759	Open in IMG/M
3300017972\|Ga0187781_10000452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	29172	Open in IMG/M
3300017972\|Ga0187781_10009712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	6945	Open in IMG/M
3300017972\|Ga0187781_10081664	Not Available	2233	Open in IMG/M
3300017972\|Ga0187781_10088424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2143	Open in IMG/M
3300017972\|Ga0187781_10402821	Not Available	977	Open in IMG/M
3300017972\|Ga0187781_11005819	Not Available	610	Open in IMG/M
3300017973\|Ga0187780_10016496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	5350	Open in IMG/M
3300017973\|Ga0187780_10448204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	919	Open in IMG/M
3300017975\|Ga0187782_10066766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2623	Open in IMG/M
3300017975\|Ga0187782_10289033	Not Available	1236	Open in IMG/M
3300017975\|Ga0187782_10378341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1074	Open in IMG/M
3300017975\|Ga0187782_10461942	Not Available	968	Open in IMG/M
3300017975\|Ga0187782_10670414	Not Available	799	Open in IMG/M
3300017975\|Ga0187782_10986032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	655	Open in IMG/M
3300017988\|Ga0181520_10002311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	35785	Open in IMG/M
3300018008\|Ga0187888_1040696	Not Available	2211	Open in IMG/M
3300018013\|Ga0187873_1181159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	794	Open in IMG/M
3300018013\|Ga0187873_1381338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	514	Open in IMG/M
3300018017\|Ga0187872_10217292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	873	Open in IMG/M
3300018033\|Ga0187867_10252795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	992	Open in IMG/M
3300018042\|Ga0187871_10107775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1601	Open in IMG/M
3300018057\|Ga0187858_10083343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2207	Open in IMG/M
3300018058\|Ga0187766_10631058	Not Available	734	Open in IMG/M
3300018060\|Ga0187765_10833710	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	618	Open in IMG/M
3300018062\|Ga0187784_10000458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	29829	Open in IMG/M
3300018085\|Ga0187772_10052927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2499	Open in IMG/M
3300018085\|Ga0187772_11458829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	509	Open in IMG/M
3300018086\|Ga0187769_10067407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2517	Open in IMG/M
3300018086\|Ga0187769_10188564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1523	Open in IMG/M
3300020579\|Ga0210407_10010058	All Organisms → cellular organisms → Bacteria	7057	Open in IMG/M
3300020582\|Ga0210395_10012784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6220	Open in IMG/M
3300021168\|Ga0210406_10193063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1691	Open in IMG/M
3300021388\|Ga0213875_10412347	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	645	Open in IMG/M
3300021406\|Ga0210386_11017610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	706	Open in IMG/M
3300022525\|Ga0242656_1029710	All Organisms → cellular organisms → Bacteria → Proteobacteria	867	Open in IMG/M
3300022557\|Ga0212123_10115587	Not Available	2149	Open in IMG/M
3300022881\|Ga0224545_1027201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	818	Open in IMG/M
3300025459\|Ga0208689_1093587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	539	Open in IMG/M
3300025460\|Ga0208562_1074527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	694	Open in IMG/M
3300025919\|Ga0207657_10449532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1011	Open in IMG/M
3300026095\|Ga0207676_12154892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	556	Open in IMG/M
3300027504\|Ga0209114_1079149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	598	Open in IMG/M
3300027570\|Ga0208043_1004274	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5063	Open in IMG/M
3300027652\|Ga0209007_1002319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	5447	Open in IMG/M
3300027698\|Ga0209446_1117096	Not Available	686	Open in IMG/M
3300027703\|Ga0207862_1216864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	566	Open in IMG/M
3300027783\|Ga0209448_10082762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1076	Open in IMG/M
3300027795\|Ga0209139_10324464	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129	540	Open in IMG/M
3300027867\|Ga0209167_10275198	Not Available	907	Open in IMG/M
3300027908\|Ga0209006_11037328	All Organisms → cellular organisms → Bacteria → Proteobacteria	650	Open in IMG/M
3300027986\|Ga0209168_10148157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1191	Open in IMG/M
3300028792\|Ga0307504_10299798	Not Available	605	Open in IMG/M
3300029910\|Ga0311369_10667955	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	857	Open in IMG/M
3300029999\|Ga0311339_10668698	Not Available	1021	Open in IMG/M
3300030617\|Ga0311356_10810472	Not Available	888	Open in IMG/M
3300030659\|Ga0316363_10026839	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3010	Open in IMG/M
3300030707\|Ga0310038_10007142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7698	Open in IMG/M
3300030813\|Ga0265750_1054481	All Organisms → cellular organisms → Bacteria → Proteobacteria	613	Open in IMG/M
3300030862\|Ga0265753_1122689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	546	Open in IMG/M
3300031234\|Ga0302325_10904472	Not Available	1224	Open in IMG/M
3300031544\|Ga0318534_10461875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	727	Open in IMG/M
3300031670\|Ga0307374_10016045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9991	Open in IMG/M
3300031680\|Ga0318574_10365122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	842	Open in IMG/M
3300031708\|Ga0310686_102373482	Not Available	775	Open in IMG/M
3300031708\|Ga0310686_103776202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	658	Open in IMG/M
3300031708\|Ga0310686_110359664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	517	Open in IMG/M
3300031708\|Ga0310686_113548373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3133	Open in IMG/M
3300031708\|Ga0310686_115298383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	920	Open in IMG/M
3300031823\|Ga0307478_11012564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	694	Open in IMG/M
3300031942\|Ga0310916_10152280	Not Available	1909	Open in IMG/M
3300032059\|Ga0318533_10156424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3	1616	Open in IMG/M
3300032180\|Ga0307471_104078120	Not Available	516	Open in IMG/M
3300032261\|Ga0306920_100360903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2161	Open in IMG/M
3300032261\|Ga0306920_101017219	Not Available	1206	Open in IMG/M
3300032770\|Ga0335085_10011989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12806	Open in IMG/M
3300032805\|Ga0335078_10056084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5808	Open in IMG/M
3300032893\|Ga0335069_10163744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2743	Open in IMG/M
3300032893\|Ga0335069_10195732	Not Available	2467	Open in IMG/M
3300032897\|Ga0335071_11145903	Not Available	723	Open in IMG/M
3300032898\|Ga0335072_10146653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2903	Open in IMG/M
3300033402\|Ga0326728_11143143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	523	Open in IMG/M
3300033755\|Ga0371489_0000043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	255228	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.99%
Host-Associated	Host-Associated	7.01%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.06%
Aquatic	Environmental → Aquatic	29.94%
Plants	Host-Associated → Plants	4.46%
Fungi	Host-Associated → Fungi	2.55%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	58.60%
Freshwater	Environmental → Aquatic → Freshwater	28.03%
Peat	Environmental → Terrestrial → Peat	4.46%
Mycelium	Host-Associated → Fungi → Mycelium	2.55%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.91%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.27%
Roots	Host-Associated → Plants → Roots	1.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.27%
Sediment	Environmental → Aquatic → Sediment	0.64%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	29.30%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	28.03%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	21.02%
Loam	Environmental → Terrestrial → Soil → Loam	7.64%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.46%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	2.55%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.27%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.27%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.64%
Clay	Environmental → Terrestrial → Soil → Clay	0.64%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.64%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.64%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.64%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	19.11%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.47%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	17.20%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.19%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.64%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	7.01%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.46%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	3.82%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	2.55%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.91%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.27%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.64%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.64%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.64%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.64%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.64%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.64%

Habitat	Taxonomy	Distribution
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	14.01%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	7.64%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	7.64%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	7.01%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	6.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.73%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	3.82%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.82%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.18%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.18%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.55%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	2.55%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	2.55%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	1.91%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.91%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.27%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.27%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.27%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	1.27%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.27%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.27%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.64%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.64%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.64%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.64%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.64%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.64%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.64%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.64%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.64%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.64%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459004	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)	Environmental	Open in IMG/M
3300001356	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009518	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150	Environmental	Open in IMG/M
3300009525	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG	Environmental	Open in IMG/M
3300009632	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40	Environmental	Open in IMG/M
3300009637	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40	Environmental	Open in IMG/M
3300009639	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40	Environmental	Open in IMG/M
3300009640	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40	Environmental	Open in IMG/M
3300009643	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40	Environmental	Open in IMG/M
3300009645	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40	Environmental	Open in IMG/M
3300009764	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40	Environmental	Open in IMG/M
3300009824	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300012089	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG	Host-Associated	Open in IMG/M
3300012177	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG	Host-Associated	Open in IMG/M
3300012180	Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG	Host-Associated	Open in IMG/M
3300012181	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG	Host-Associated	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300014156	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG	Environmental	Open in IMG/M
3300014159	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG	Environmental	Open in IMG/M
3300014160	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG	Environmental	Open in IMG/M
3300014162	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG	Environmental	Open in IMG/M
3300014165	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG	Environmental	Open in IMG/M
3300014169	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG	Environmental	Open in IMG/M
3300014199	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG	Environmental	Open in IMG/M
3300014201	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014655	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG	Environmental	Open in IMG/M
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300017823	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3	Environmental	Open in IMG/M
3300017925	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40	Environmental	Open in IMG/M
3300017940	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100	Environmental	Open in IMG/M
3300017941	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150	Environmental	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017946	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300017988	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG	Environmental	Open in IMG/M
3300018008	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40	Environmental	Open in IMG/M
3300018013	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100	Environmental	Open in IMG/M
3300018017	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40	Environmental	Open in IMG/M
3300018033	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10	Environmental	Open in IMG/M
3300018042	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10	Environmental	Open in IMG/M
3300018057	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018085	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Host-Associated	Open in IMG/M
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental	Open in IMG/M
3300022525	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300022881	Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24	Environmental	Open in IMG/M
3300025459	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)	Environmental	Open in IMG/M
3300025460	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027504	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)	Environmental	Open in IMG/M
3300027570	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)	Environmental	Open in IMG/M
3300027652	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)	Environmental	Open in IMG/M
3300027698	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027703	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)	Environmental	Open in IMG/M
3300027783	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027795	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300029910	III_Palsa_E2 coassembly	Environmental	Open in IMG/M
3300029999	I_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030617	II_Palsa_N2 coassembly	Environmental	Open in IMG/M
3300030659	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)	Environmental	Open in IMG/M
3300030707	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)	Environmental	Open in IMG/M
3300030813	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030862	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031670	Soil microbial communities from Risofladan, Vaasa, Finland - OX-3	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental	Open in IMG/M
3300032898	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1	Environmental	Open in IMG/M
3300033402	Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN	Environmental	Open in IMG/M
3300033755	Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.52
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.52
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F042985

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E4B_05251970	2170459004	Grass Soil	MRRVLRKSIPFVQAALIGTLAAAAVAGVAMLISHS
JGI12269J14319_100304644	3300001356	Peatlands Soil	MRRVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS*
JGI12269J14319_102447962	3300001356	Peatlands Soil	MRRALRKSIPFMQAALIGTVAAAALAGVAMLISHS*
JGIcombinedJ26739_1003296912	3300002245	Forest Soil	MRRVLRKSIPFVQAVLIGTLTAAAIAGVAMLIPHS*
Ga0070735_101099903	3300005534	Surface Soil	MRRVLRKSIPFVQAALIGTLAAAALAGVAMLISHS*
Ga0070735_102150022	3300005534	Surface Soil	MRRVLRKSIPFVQAALIGTLAAAALAGAALLITHS*
Ga0070733_100165256	3300005541	Surface Soil	MMRRKLRKTVALIQAALIGTLAAAAIAGIALWISHS*
Ga0070733_107514682	3300005541	Surface Soil	MRRVLRKSVPFVQAALIGTLAAAVIAGVAMLLPHS*
Ga0070665_1004433003	3300005548	Switchgrass Rhizosphere	MRRTFRRSVPFVQAAFIGTFAAALLAGLAILISHLAA*
Ga0070762_102000043	3300005602	Soil	MMQRALRRSVPFVQAALIGTLAAAALAGLAILISHS*
Ga0070762_109227662	3300005602	Soil	MRRALRRSVPFVQAAFIGTFAAALLAGLAMLISHS*
Ga0066903_1011999232	3300005764	Tropical Forest Soil	MRHVLRKSIPFVQAALIGTLAAAALAGVAFLISHS*
Ga0066903_1013265693	3300005764	Tropical Forest Soil	MRRVLRKSIPFVQAVLIGTLAAAAVAGVAMLISHS*
Ga0066903_1026154972	3300005764	Tropical Forest Soil	MCHALWKSIPFVQAALIGTLAAAALADVDFLISHS*
Ga0066903_1044749922	3300005764	Tropical Forest Soil	MRRTFRMSVPFVQAAFIGTFAAALLAGLAILISHLAA*
Ga0075028_1003828282	3300006050	Watersheds	MRRVLRKSIPFVQAAMIGTLAAAAVAGVAMLISHS*
Ga0070765_1010973471	3300006176	Soil	MQRVLRKSIPFVQAVLIGTLAAAAIAGVAMLIPHS*
Ga0073928_101895062	3300006893	Iron-Sulfur Acid Spring	MRRVLRKSIPFVQAALIGTLAAAAIAGVALLIPHS*
Ga0074063_135155922	3300006953	Soil	MRRVLRKSIPFVQAALIGTLAAAVLAGVAMLISHS*
Ga0116128_11991882	3300009518	Peatland	MRRVLRKSVPFVQAALIGTLTAAALAGVAILISHS*
Ga0116220_105016652	3300009525	Peatlands Soil	MRRVLRKSIPFVQAALIGTLAAAAVAGVAMLISHS*
Ga0116102_11630222	3300009632	Peatland	MRRVLRKSVPFVQAALIGTFAAVTLAGVAMLISHS*
Ga0116118_11247572	3300009637	Peatland	MRRALRRSIPFVQAALIGTLAAVALAAVAMLISHS*
Ga0116122_11993272	3300009639	Peatland	GQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS*
Ga0116126_10551553	3300009640	Peatland	MRRALRRSIPFVQAALIGTLAAAALAAVAMLISHS*
Ga0116110_10452801	3300009643	Peatland	RRVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS*
Ga0116106_12288901	3300009645	Peatland	MRRVLRRSIPFVQAALIGTLAAAAVAGVAMFISHS*
Ga0116134_10185034	3300009764	Peatland	MRRALRRSIPFVQAVLIGVLAAAALATVAMLISHS*
Ga0116134_11740452	3300009764	Peatland	MRRVLRKSVPFVQAALVGTFAAAALAGVAMLISHS*
Ga0116219_104170352	3300009824	Peatlands Soil	MRRALRRSIPFVQAALIGTLAAAALAAVAMLISHT*
Ga0126373_104666153	3300010048	Tropical Forest Soil	MCHALWKSIPFVQAALIGTLAAAALADVGFLISHS*
Ga0074046_103963311	3300010339	Bog Forest Soil	MRRALRRSIPFVQAALIGTLAAAALAGIAMLISHS*
Ga0074044_106406721	3300010343	Bog Forest Soil	MRRVLRRSIPFVQAALIGTLAAAALAGVAMFISHS*
Ga0134128_125563022	3300010373	Terrestrial Soil	REQAMRHVVRKSIPFVQAALIGTLAAAALAGVALLISHS*
Ga0126381_1018004882	3300010376	Tropical Forest Soil	MRRVLRKSIPFVQAMIIGTLAAAALAGAAMLIPHS*
Ga0136449_1000394426	3300010379	Peatlands Soil	MRRVLRKSIPFVQAALIGTLAAVALAGVALLISHS*
Ga0136449_1002228416	3300010379	Peatlands Soil	MRRVLRRSIPFVQAALIGTLAAVALAGVAVLISHS*
Ga0136449_1044921102	3300010379	Peatlands Soil	MRRALRRSVPFVQAAFIGTFAAALLAGLAMLISQS*
Ga0153924_10107642	3300012089	Attine Ant Fungus Gardens	MSRALRRSVPFVQAAFIGTSAAALLTGIAMLISHS*
Ga0153943_10538122	3300012177	Attine Ant Fungus Gardens	MRHLLRKSIPFVQAALIGSLAAAVLAAVAVLISHS*
Ga0153974_11048382	3300012180	Attine Ant Fungus Gardens	MRRLLRKSIPFVQAALIGTLAAAAVAGVAMLISHS*
Ga0153922_11667842	3300012181	Attine Ant Fungus Gardens	MRRVLRKSVPFVQAVLIGTLAAAVIAGVAMLLPHS*
Ga0164308_108420492	3300012985	Soil	MRRALRRSVPFVQAAFIGTLAAALLAGLAMLISHS*
Ga0181518_100353354	3300014156	Bog	MRRVLRKSVPFVQAALIGTLAAAALAGVAMLISHS*
Ga0181530_101997471	3300014159	Bog	SRGQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS*
Ga0181517_100501824	3300014160	Bog	MRKAIRKTLPFVQSALIGTLAAAALAGVALLVSYF*
Ga0181538_103060251	3300014162	Bog	SMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS*
Ga0181523_106299091	3300014165	Bog	QAESRGQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS*
Ga0181531_106938091	3300014169	Bog	MRRALRRSIPFVQAALIGTVAAAALVGFAMLISHS*
Ga0181531_110553812	3300014169	Bog	MRRVLRKSIPFVQAVLIGTLAAAAIAGAAMLIPHS*
Ga0181535_100273984	3300014199	Bog	MRRALRKSIPFVQAALIGTLAAAALAGVALLISHS*
Ga0181535_106591562	3300014199	Bog	RKAIRKTLPFVQSALIGTLAAAALAGVALLVSYF*
Ga0181537_106002441	3300014201	Bog	MRRSLRKSVPFMQAALIGTLAAAALAAVAMLISHS*
Ga0163163_104473762	3300014325	Switchgrass Rhizosphere	MRHALRKSIPFVQAALIGTLAAAALAGVAFLILHS*
Ga0182018_101262492	3300014489	Palsa	MRRALRKSIPFMQAVLIGTLAAAALAGVAMLISHS*
Ga0182024_118801251	3300014501	Permafrost	MRRKLRKSIPFMQAALIGTMAAAALAGVALLISHS*
Ga0181516_103408442	3300014655	Bog	MRKAIRKTVPFVQSALIGTLAAAALAGVALLVSYF*
Ga0182030_101993812	3300014838	Bog	MRRVLRKTIPFVQAVLIGTLAAAVVVGFAIYVSHS*
Ga0132258_108284851	3300015371	Arabidopsis Rhizosphere	SWELAMRHVLRKSIPFVQAALIGTLAAAALAGVAFLISHS*
Ga0132258_114417183	3300015371	Arabidopsis Rhizosphere	MRRTFRRSVPFVQAAFIGTFAAAVLAGLAILISHLAA*
Ga0182041_120586112	3300016294	Soil	MCHALWKSIPFVQAALIGTLAAAALAGVTFLIAHS
Ga0182034_111946662	3300016371	Soil	EQAMRRVLRKSIPFVQAALIGTLAAAAVAGVAMLISHS
Ga0182034_117247601	3300016371	Soil	MRRVLRKSVPFVQAVIIGTLAAAALAGVAMLIPHS
Ga0187818_101764831	3300017823	Freshwater Sediment	MRSVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS
Ga0187818_104120482	3300017823	Freshwater Sediment	MRRVLRKSIPFVQAALIGTLAAAVLAGVAMLISHS
Ga0187856_100108820	3300017925	Peatland	MRRVLRRSIPFVQAALIGTLAAAALAGVAMFISHS
Ga0187856_10037008	3300017925	Peatland	MRRVLRKSVPFVQAALIGTLTAAALAGVAILISHS
Ga0187853_105193922	3300017940	Peatland	MRRALRRSIPFVQAALIGTLAAAALAAVAMLISHS
Ga0187850_102166133	3300017941	Peatland	SMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS
Ga0187819_100546555	3300017943	Freshwater Sediment	MRRVLRKSIPFVQAALIGTLAAVAVAGVAMLISHS
Ga0187879_103235332	3300017946	Peatland	MRRVLRKSVPFVQAALVGTFAAAALAGVAMLISHS
Ga0187817_104172931	3300017955	Freshwater Sediment	MRRVLRKSVPFVQAALMGTLTAAALAGVAMLISHS
Ga0187817_108220301	3300017955	Freshwater Sediment	GAMMRRVLRRSMPFVQAALIGTLAAAALAGFAMLISHT
Ga0187817_110191031	3300017955	Freshwater Sediment	MGRVLRKSVPFVQAALMGTLTAAALAGVAMLISDS
Ga0187783_106545291	3300017970	Tropical Peatland	MRRVLRKSIPFVQAMLIGTLAAAVIAGVAMLLPHS
Ga0187781_1000045222	3300017972	Tropical Peatland	MRRVLRKSIPFVQAVLIGTLAAAMLAGVAMLISRS
Ga0187781_100097124	3300017972	Tropical Peatland	MRRVVRRSVPFVQAALIGAIAAAVLAGVAMAVSHS
Ga0187781_100816644	3300017972	Tropical Peatland	MRKALRRSAPFVQAALIGTVAAAALAGFAMLISHS
Ga0187781_100884243	3300017972	Tropical Peatland	MHRVLRKSVPFVQAALMGALAAAALAGVAMLISHS
Ga0187781_104028212	3300017972	Tropical Peatland	MRHVLRKSIPFVQAALIGSLAAAALAGVAMLISHS
Ga0187781_110058192	3300017972	Tropical Peatland	MHRVLRKSVPFVQAALMGALTAAALAGVAMLISHS
Ga0187780_100164962	3300017973	Tropical Peatland	MRRILRRSIPFVQAVLIGTLLAAALAGFAIFVSHS
Ga0187780_104482042	3300017973	Tropical Peatland	MRKAIRKTMPFVQSALIGTLAAAALAGVALLVSHS
Ga0187782_100667663	3300017975	Tropical Peatland	MHRVLRKSVPFVQAALMGALTAAALVGVAMLISHS
Ga0187782_102890332	3300017975	Tropical Peatland	MRHVLRKSIPFVQAALIGSLAAAVLAGVAMLISHS
Ga0187782_103783411	3300017975	Tropical Peatland	MRRVLRRSVPFVQAALIGAMAAAALAGVAMMISHS
Ga0187782_104619422	3300017975	Tropical Peatland	MRRVLRKSVPFVKAVLIGTLAAAALAGVAILVSHS
Ga0187782_106704142	3300017975	Tropical Peatland	MRRKLRKTIALMAAALIGTLAAAALAGIALLISHS
Ga0187782_109860321	3300017975	Tropical Peatland	QSMRRVLRKSIPFVQAVLIGTLAAAVIAGVAMLLPHS
Ga0181520_1000231130	3300017988	Bog	MRKAIRKTLPFVQSALIGTLAAAALAGVALLVSYF
Ga0187888_10406964	3300018008	Peatland	MRRALRRSIPFVQAALIGTLAAVALAAVAMLISHS
Ga0187873_11811592	3300018013	Peatland	MRRVLRRSIPFVQAALIGTLAAAAVAGVAMFISHS
Ga0187873_13813382	3300018013	Peatland	AGWEQSMRRALRRSIPFVQAALIGTLAAAALAAVAMLISHS
Ga0187872_102172923	3300018017	Peatland	RGQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS
Ga0187867_102527953	3300018033	Peatland	MRQVLRKSIPFIGAVLIGMTAAALLGGVAMLASHS
Ga0187871_101077753	3300018042	Peatland	MMQRALRRSVPFVQAALIGTLAAAALAGLAILISHS
Ga0187858_100833432	3300018057	Peatland	MRRVLRKSVPFVQAALIGAFAAAALAGVAMLISHS
Ga0187766_106310582	3300018058	Tropical Peatland	MRRVLRRSVPFVQAALIGAMAAAALAGVAIVISHS
Ga0187765_108337102	3300018060	Tropical Peatland	MRHLLRKSIPFVQAALIGSLAAAVLAAVAVLISHS
Ga0187784_1000045816	3300018062	Tropical Peatland	MSQILRKSIPFVQAALIGTLAAATLVGVAMLMAHS
Ga0187772_100529271	3300018085	Tropical Peatland	MMRRVLRKSIPFVQAALIGTVAAAALAAFAVYVSHS
Ga0187772_114588291	3300018085	Tropical Peatland	MRRVLRKSIPFVQAVLIGTLAAAVIAGVAMLLPHS
Ga0187769_100674073	3300018086	Tropical Peatland	MRRVLRQSVPFVQAVLIGALAAAALAGVAMLISHS
Ga0187769_101885642	3300018086	Tropical Peatland	MMRRVLRKSIPFVHAALIGTVAAAALAAFAVYVSHS
Ga0210407_100100582	3300020579	Soil	MRRALRRSVPFVQAAFIGTLAAALLAGLAMLISHS
Ga0210395_100127842	3300020582	Soil	MRRVLRKSVPFVQAVLIGTLAAAVIAGVAMLLPHS
Ga0210406_101930631	3300021168	Soil	EQSMRRALRRSAPFVQAAFIGTLAAALLAGLAMLISHS
Ga0213875_104123472	3300021388	Plant Roots	MRRVLRKSVPFVQAVLIGTLAAVAIAGVALLIPHS
Ga0210386_110176101	3300021406	Soil	MRHLLRKSIPFVQAALIGSLAAAVLAAVAVLISHA
Ga0242656_10297102	3300022525	Soil	MRRALRRSVPFVQAAFIGTFAAALLASLAMLISHS
Ga0212123_101155873	3300022557	Iron-Sulfur Acid Spring	MRRVLRKSIPFVQAALIGTLAAAAIAGVALLIPHS
Ga0224545_10272012	3300022881	Soil	MRRALRKSIPFMQAVLIGTLAAAALAGVAMLISHS
Ga0208689_10935872	3300025459	Peatland	QSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS
Ga0208562_10745273	3300025460	Peatland	ESRGQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS
Ga0207657_104495322	3300025919	Corn Rhizosphere	MRRTFRRSVPFVQAAFIGTFAAALVAGLAILISHLAA
Ga0207676_121548923	3300026095	Switchgrass Rhizosphere	MRRTFRRSVPFVQAAFIGTFAAAVLAGLAILISHLAA
Ga0209114_10791492	3300027504	Forest Soil	QPASLEQAVRRVLRKSIPFIQAALIGTLAAAAVAGVAMLISHS
Ga0208043_10042748	3300027570	Peatlands Soil	MRRALRKSIPFMQAALIGTVAAAALAGVAMLISHS
Ga0209007_10023198	3300027652	Forest Soil	VRSVLRKSVPFVGAVLIGLMIAAALAGVAFMVSHS
Ga0209446_11170962	3300027698	Bog Forest Soil	MRRALRRSIPFVQAALMGTMAAAALAGIAMLISHS
Ga0207862_12168642	3300027703	Tropical Forest Soil	QVLRRGQSMRRVLRKSVPFVQAALVGTLAAAALAGVAMLISHS
Ga0209448_100827622	3300027783	Bog Forest Soil	MRRALRRSIPFVQAALIGTLAAAALAGIAMLISHS
Ga0209139_103244642	3300027795	Bog Forest Soil	MRRVLRKSIPFVQAVLIGTLTAAAIAGVAMLIPHS
Ga0209167_102751983	3300027867	Surface Soil	MMRRKLRKTVALIQAALIGTLAAAAIAGIALWISHS
Ga0209006_110373283	3300027908	Forest Soil	MRRALRKSIPFIQAALIGTLAAAAVAGIALLISHS
Ga0209168_101481573	3300027986	Surface Soil	MRRVLRKSIPFVQAALIGTLAAAALAGVAMLISHS
Ga0307504_102997982	3300028792	Soil	MRRALRRSVPFVQAAFIGTLAAALLAGIAMLISHS
Ga0311369_106679553	3300029910	Palsa	MRRVLRRSIPFVQAALIGTLAVAALVAVAMLISHS
Ga0311339_106686983	3300029999	Palsa	MRKAIRKTVPFVQSALIGTLAAAALAGFARMVSYF
Ga0311356_108104722	3300030617	Palsa	MRKAIRKTVPFVQSALIGTLAAAALAGFALLVSYF
Ga0316363_100268392	3300030659	Peatlands Soil	MRRVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS
Ga0310038_100071424	3300030707	Peatlands Soil	MRRVLRKSIPFVQAALIGTLAAVALAGVALLISHS
Ga0265750_10544812	3300030813	Soil	MMQRALRRSVPFVQAALIGALAAAALAGLAILISHS
Ga0265753_11226891	3300030862	Soil	MRRALRRSVPFVQATFIGTFAAALLAGLAMLISHS
Ga0302325_109044723	3300031234	Palsa	MRKAIRKTVPFVQSALIGTLAAAALAGVALLVSYF
Ga0318534_104618752	3300031544	Soil	MRHLLRKFVPFVQAALIGSLAAAVLAAVAVLISHS
Ga0307374_100160456	3300031670	Soil	MMRRKLRKTVALLQAALIGTLAAAAIAGIALWISHS
Ga0318574_103651222	3300031680	Soil	MRRVLRKSIPFVQAMIIGTLAAAALAGAAMLIPHS
Ga0310686_1023734821	3300031708	Soil	MRRVLRKSIPFVQAVLIGTLAAAAIAGVAMLIPHS
Ga0310686_1037762022	3300031708	Soil	MRQVLRKSIPFVAAVLVGAGAAALLVGAAMLAPHS
Ga0310686_1103596642	3300031708	Soil	GREQSMRRVLRKSIPFVQAVLIGTLAAAAIAGVAMLIPHS
Ga0310686_1135483731	3300031708	Soil	PGATMQRVLRRSVPFVQAALIGTLAAAALAGLAILISHS
Ga0310686_1152983833	3300031708	Soil	MMRRKLRKTIALMEAALIGTLAAAVLAGIALLISHS
Ga0307478_110125642	3300031823	Hardwood Forest Soil	MRRVLRKSIPFVQAVLIGTLAAAAIAGVALLLPHS
Ga0310916_101522801	3300031942	Soil	MRRVLRKSIPFVQAMIIGTLAATALAGAAMLIPHS
Ga0318533_101564244	3300032059	Soil	MRRGLRKSIPFVQAALIGTLAAAAVAGVAMLISHS
Ga0307471_1040781202	3300032180	Hardwood Forest Soil	MRRVLRKSIPFVQAALIGTLAAAAVAGVAMRISHS
Ga0306920_1003609031	3300032261	Soil	ASREQSMRRVLRKSVPFVQAVIIGTLAAAALAGVAMLIPHS
Ga0306920_1010172192	3300032261	Soil	MCHALWKSIPFVQAALIGTLAAAALADVGFLISHS
Ga0335085_100119896	3300032770	Soil	MIQKLLRGSVPFVQAALIGTLAAAALAAFAMLISGA
Ga0335078_100560844	3300032805	Soil	MRKALRRSVPFVQAALIGTVAAAALAGLAMLISHS
Ga0335069_101637445	3300032893	Soil	MMRRVLRRSIPFVQAVLIGTLAAAAIAGFAMYVSHS
Ga0335069_101957324	3300032893	Soil	MRRVIRKSMPFVQSALIGSLAAAALAGIALWASHV
Ga0335071_111459032	3300032897	Soil	MRRVLRRSIPFVQAVLIGTLAAAAIAGFAMYVSHS
Ga0335072_101466536	3300032898	Soil	MRRALRKSIPFMQAALIGTLAAAALVAVAMLISHS
Ga0326728_111431432	3300033402	Peat Soil	MRKAIRKTVPFVQSALIGTLVAAALAGMALLISHS
Ga0371489_0000043_151505_151612	3300033755	Peat Soil	MRRVLRRSMPFFGAILIGAMAAGLVAGVAMLVSHS

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign