Basic Information | |
---|---|
Family ID | F042984 |
Family Type | Metagenome |
Number of Sequences | 157 |
Average Sequence Length | 40 residues |
Representative Sequence | QIIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFAL |
Number of Associated Samples | 129 |
Number of Associated Scaffolds | 157 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.64 % |
% of genes near scaffold ends (potentially truncated) | 98.09 % |
% of genes from short scaffolds (< 2000 bps) | 90.45 % |
Associated GOLD sequencing projects | 117 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.726 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.752 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.032 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.414 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 157 Family Scaffolds |
---|---|---|
PF04055 | Radical_SAM | 42.04 |
PF13186 | SPASM | 24.20 |
PF13924 | Lipocalin_5 | 5.10 |
PF01120 | Alpha_L_fucos | 4.46 |
PF11528 | DUF3224 | 2.55 |
PF05402 | PqqD | 1.27 |
PF05977 | MFS_3 | 1.27 |
PF05345 | He_PIG | 0.64 |
PF01797 | Y1_Tnp | 0.64 |
PF01523 | PmbA_TldD | 0.64 |
PF14534 | DUF4440 | 0.64 |
PF03070 | TENA_THI-4 | 0.64 |
PF08281 | Sigma70_r4_2 | 0.64 |
PF02535 | Zip | 0.64 |
PF01979 | Amidohydro_1 | 0.64 |
PF10905 | DUF2695 | 0.64 |
PF00882 | Zn_dep_PLPC | 0.64 |
PF11304 | DUF3106 | 0.64 |
COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
---|---|---|---|
COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 4.46 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.27 |
COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.64 |
COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.64 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.64 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.73 % |
Unclassified | root | N/A | 1.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001175|JGI12649J13570_1007507 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100637642 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300003224|JGI26344J46810_1004563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1025 | Open in IMG/M |
3300003350|JGI26347J50199_1038759 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300004080|Ga0062385_10093287 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300004080|Ga0062385_10422265 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300004092|Ga0062389_100577528 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300004114|Ga0062593_101413161 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300005175|Ga0066673_10811306 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005180|Ga0066685_10684570 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300005602|Ga0070762_10273009 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300005610|Ga0070763_10311123 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300006028|Ga0070717_12034531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300006031|Ga0066651_10677804 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300006086|Ga0075019_11043221 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006176|Ga0070765_101196651 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300006176|Ga0070765_102152299 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300006176|Ga0070765_102196299 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300006804|Ga0079221_11585867 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006854|Ga0075425_101405155 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300007255|Ga0099791_10030737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2356 | Open in IMG/M |
3300007255|Ga0099791_10633975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300007258|Ga0099793_10006216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4382 | Open in IMG/M |
3300007258|Ga0099793_10373399 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300009038|Ga0099829_10587013 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300009088|Ga0099830_11389438 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300009088|Ga0099830_11494405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300009089|Ga0099828_10264774 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
3300009143|Ga0099792_10388873 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300009525|Ga0116220_10418716 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300010043|Ga0126380_10300915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
3300010046|Ga0126384_11438643 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300010048|Ga0126373_10922809 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300010159|Ga0099796_10148170 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300010322|Ga0134084_10062614 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300010358|Ga0126370_12528537 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300010359|Ga0126376_11615481 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300010359|Ga0126376_13195705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300010360|Ga0126372_11057497 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300010361|Ga0126378_10186839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2141 | Open in IMG/M |
3300010361|Ga0126378_10357350 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
3300010366|Ga0126379_11498152 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300010376|Ga0126381_103492132 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010376|Ga0126381_105088596 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300010400|Ga0134122_11622453 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300011271|Ga0137393_11005921 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300011271|Ga0137393_11056178 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300012096|Ga0137389_10385482 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300012096|Ga0137389_10640274 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300012189|Ga0137388_11825598 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300012189|Ga0137388_11967703 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300012200|Ga0137382_10521382 | Not Available | 845 | Open in IMG/M |
3300012202|Ga0137363_10407133 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300012202|Ga0137363_11188918 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300012203|Ga0137399_11068576 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300012349|Ga0137387_10250130 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300012354|Ga0137366_10958437 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300012361|Ga0137360_11197964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300012363|Ga0137390_10873698 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300012922|Ga0137394_10343725 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300012923|Ga0137359_10041276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3996 | Open in IMG/M |
3300012923|Ga0137359_11084028 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300012925|Ga0137419_10745201 | Not Available | 798 | Open in IMG/M |
3300012929|Ga0137404_12207337 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300012944|Ga0137410_11239436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300012975|Ga0134110_10149563 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300014501|Ga0182024_11646133 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300015053|Ga0137405_1386682 | All Organisms → cellular organisms → Bacteria | 4413 | Open in IMG/M |
3300015053|Ga0137405_1427100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3088 | Open in IMG/M |
3300015242|Ga0137412_10227148 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
3300015264|Ga0137403_10465358 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300016270|Ga0182036_11732255 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300016294|Ga0182041_10835416 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300016422|Ga0182039_10670290 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300016445|Ga0182038_11772942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300017927|Ga0187824_10299698 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300018006|Ga0187804_10262478 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300018086|Ga0187769_10832445 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300018086|Ga0187769_11459976 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300018433|Ga0066667_10049390 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
3300020199|Ga0179592_10081089 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300020579|Ga0210407_10170869 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
3300020583|Ga0210401_10374929 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300021046|Ga0215015_10485068 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
3300021168|Ga0210406_10227070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1540 | Open in IMG/M |
3300021168|Ga0210406_11278119 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300021171|Ga0210405_10925105 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300021180|Ga0210396_10799773 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300021181|Ga0210388_10215005 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300021181|Ga0210388_10756143 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300021401|Ga0210393_10762469 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300021402|Ga0210385_10034514 | All Organisms → cellular organisms → Bacteria | 3296 | Open in IMG/M |
3300021403|Ga0210397_11466283 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300021404|Ga0210389_11244215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300021407|Ga0210383_11551303 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300021420|Ga0210394_10434024 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300021432|Ga0210384_10709623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
3300021478|Ga0210402_10416635 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300024330|Ga0137417_1497299 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300026296|Ga0209235_1280252 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300026320|Ga0209131_1192384 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300026360|Ga0257173_1000873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2244 | Open in IMG/M |
3300026551|Ga0209648_10146438 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
3300026551|Ga0209648_10346783 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300026551|Ga0209648_10711796 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300026557|Ga0179587_10020032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3598 | Open in IMG/M |
3300027575|Ga0209525_1145766 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300027603|Ga0209331_1039803 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300027671|Ga0209588_1090007 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300027725|Ga0209178_1081753 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300027738|Ga0208989_10058486 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300027795|Ga0209139_10017450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2606 | Open in IMG/M |
3300027825|Ga0209039_10337527 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300027846|Ga0209180_10263215 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300027853|Ga0209274_10362637 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300027853|Ga0209274_10731051 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300027855|Ga0209693_10303199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
3300027867|Ga0209167_10093384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1531 | Open in IMG/M |
3300027879|Ga0209169_10064989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1887 | Open in IMG/M |
3300027879|Ga0209169_10658921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300027884|Ga0209275_10865549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300027895|Ga0209624_10591617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300027903|Ga0209488_10021094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4727 | Open in IMG/M |
3300028023|Ga0265357_1044538 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300028047|Ga0209526_10236384 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300028536|Ga0137415_10267075 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300028536|Ga0137415_10414275 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300028780|Ga0302225_10575020 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300028906|Ga0308309_10440253 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300029882|Ga0311368_10859834 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300030503|Ga0311370_12043393 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300030737|Ga0302310_10276840 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300031057|Ga0170834_100844132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 586 | Open in IMG/M |
3300031231|Ga0170824_120624313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300031708|Ga0310686_105938748 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales | 632 | Open in IMG/M |
3300031718|Ga0307474_11608580 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300031754|Ga0307475_10309050 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300031754|Ga0307475_11180781 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300031820|Ga0307473_10156188 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300031823|Ga0307478_10270993 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300031823|Ga0307478_10852300 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300031890|Ga0306925_11319814 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300031912|Ga0306921_10000544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 33704 | Open in IMG/M |
3300031945|Ga0310913_10089122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2070 | Open in IMG/M |
3300031947|Ga0310909_10240672 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300031962|Ga0307479_10658663 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300031962|Ga0307479_10695781 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300032001|Ga0306922_10052916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4204 | Open in IMG/M |
3300032044|Ga0318558_10225025 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300032180|Ga0307471_101782379 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300032180|Ga0307471_102050953 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300032180|Ga0307471_104177848 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300032205|Ga0307472_100265006 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300032805|Ga0335078_12052732 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300032892|Ga0335081_11927563 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300032955|Ga0335076_10747000 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300033513|Ga0316628_103853937 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.64% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.64% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.64% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.46% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.82% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.55% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.55% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.27% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.27% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.27% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.27% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.64% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.64% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.64% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.64% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.64% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.64% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.64% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003224 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 | Environmental | Open in IMG/M |
3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12649J13570_10075071 | 3300001175 | Forest Soil | HTVQQIISELQKIYSKAEPERVEKDILGYLALLQEQQALEFTLEDAAERK* |
JGIcombinedJ26739_1006376422 | 3300002245 | Forest Soil | QQIISELQQIYSKAEPKKVEADILDYLARLHDQRAIDFDA* |
JGI26344J46810_10045631 | 3300003224 | Bog Forest Soil | QQIIAELQQLYSKADPAKVEQDIFGYLALLQKERALDFEM* |
JGI26347J50199_10387591 | 3300003350 | Bog Forest Soil | QIITELQQLYEKAEPAKVEQDILGYLALLQKERALNFEP* |
Ga0062385_100932871 | 3300004080 | Bog Forest Soil | GQHTVEQIISELQKIYSKAVPEKVAQDILGYLKLLHNQRALDFQ* |
Ga0062385_104222651 | 3300004080 | Bog Forest Soil | SVQQIITELQQLYSKAEPAKVESDILGYLALLQKERALDFEP* |
Ga0062389_1005775281 | 3300004092 | Bog Forest Soil | QHTVQQIITELQQLYAKADPTKVETDIMGYLALLQKERALNFEP* |
Ga0062593_1014131611 | 3300004114 | Soil | HTVQQIISELQQLYSKAEPSKVEQDILGYLALLQKERALDFEPVGA* |
Ga0066673_108113062 | 3300005175 | Soil | DGKHTVEQIIVDLQKIYSKAEPHKVEQDILGYLNLLQKERALDFQL* |
Ga0066685_106845702 | 3300005180 | Soil | TVQQIISDLQMIYSKAEPHKVEQDILGYLALLQKERALDFEL* |
Ga0070762_102730092 | 3300005602 | Soil | ELQHLYSKADPAKVESDILGYLKLLQDQRALDFE* |
Ga0070763_103111233 | 3300005610 | Soil | ELQQLYSKAEPSKVEQDILGYLTLLQKERALDFEP* |
Ga0070717_120345311 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KHTIAEIVADLQKLYSKAQPHKVETDILSYLTLLQNERALDFTQ* |
Ga0066651_106778041 | 3300006031 | Soil | IGELQLLYSKAEPHKVEQDILGYLELLQKERALDFDV* |
Ga0075019_110432212 | 3300006086 | Watersheds | VQQIIVDLQKIYSKAEPKKVETDILGYLTLLQNERALDFEL* |
Ga0070765_1011966512 | 3300006176 | Soil | GNHTVQQIITELQQIYSQADPQKVETDILGYLQLLNDQRALDFE* |
Ga0070765_1021522992 | 3300006176 | Soil | ELQQRYSKAEPAKVEQDILGYLALLQKERALDFEPANT* |
Ga0070765_1021962991 | 3300006176 | Soil | QIITELQQLYSQAEPSKVEQDILGYLALLQKERALDFEPPSA* |
Ga0079221_115858671 | 3300006804 | Agricultural Soil | SVSQIIGELQLLYSKAEPNKVEQDILGYLTLLQKERALDFESGSM* |
Ga0075425_1014051551 | 3300006854 | Populus Rhizosphere | HTVAQLIADLQKLYSKADPHKVEQDILGYLQLLHTQRALDFVS* |
Ga0099791_100307373 | 3300007255 | Vadose Zone Soil | SKAEPQKVEQDILGYLTLLQKERALDFIPANATEA* |
Ga0099791_106339751 | 3300007255 | Vadose Zone Soil | KHTVQQIILDLQKIYSKAEPQKVEQDILGYLTLLQKERALDFL* |
Ga0099793_100062161 | 3300007258 | Vadose Zone Soil | HTVQQIIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFAL* |
Ga0099793_103733991 | 3300007258 | Vadose Zone Soil | TVQQIIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFQL* |
Ga0099829_105870131 | 3300009038 | Vadose Zone Soil | HTIQQIVSELQQIYSKAQPQKVEEDILGYLALLQKERALDFEL* |
Ga0099830_113894381 | 3300009088 | Vadose Zone Soil | QIVTDLQKLYSKAEPSKVEQDILGYLTLLHDQRALDFSL* |
Ga0099830_114944051 | 3300009088 | Vadose Zone Soil | GDGKHTVQQIIVDLQKIYSKAEPQKVEQDILGYLALLQKERALDFEP* |
Ga0099828_102647743 | 3300009089 | Vadose Zone Soil | SRCDGKYTVAQIIGELQLLYSKAEPHKVEQDILGYLALLQKERALDFEL* |
Ga0099792_103888732 | 3300009143 | Vadose Zone Soil | GQHTVQQIILDLQKIYSKAEPRKVEQDILGYLTLLQKERALDFAL* |
Ga0116220_104187161 | 3300009525 | Peatlands Soil | ISELQALYSKAEPQKVEQDILGYLERLQEQRALDFE* |
Ga0126380_103009151 | 3300010043 | Tropical Forest Soil | VAELQKLYGKAEPSKVESDILGYLERLHIQRALNFSS* |
Ga0126384_114386432 | 3300010046 | Tropical Forest Soil | DGNQTAQQIITELQALYSKADPAKVESDILGYLQLLKDQRALDFES* |
Ga0126373_109228093 | 3300010048 | Tropical Forest Soil | GKHSVAQIVGELQLLYSKAEPRKVEQDILGYLALLQKERALDFD* |
Ga0099796_101481701 | 3300010159 | Vadose Zone Soil | QIVSELQQIYSKAEPKKVESDILDYLARLHDQRALDFDAQV* |
Ga0134084_100626141 | 3300010322 | Grasslands Soil | TVAQIIGELQLLYSKAEPHKVEQDILGYLELLQKERALDFDV* |
Ga0126370_125285373 | 3300010358 | Tropical Forest Soil | GAHSVSQIIGELQLLYSKAEPRKVEQDILGYLALLEKERALDFEIK* |
Ga0126376_116154811 | 3300010359 | Tropical Forest Soil | QIVTELQQLYVKAQPKKVESDILGYLDLLLKERALNFE* |
Ga0126376_131957052 | 3300010359 | Tropical Forest Soil | DLQELYSKAQPHKVESDILGYLELLQKDRALDFSI* |
Ga0126372_110574972 | 3300010360 | Tropical Forest Soil | DGSHTIQQIVSELQQLYGKAQPEKVRSDILGYLELLNTERAINFE* |
Ga0126378_101868393 | 3300010361 | Tropical Forest Soil | CDGQHTVAQIVGELQLIYSKAEPRKVEQDILGYLVLLQKERALDFDP* |
Ga0126378_103573503 | 3300010361 | Tropical Forest Soil | DGKHTVAQIVGELQLLYSKAEPRKVEQDIVGYLALLHKERALDFEP* |
Ga0126379_114981521 | 3300010366 | Tropical Forest Soil | IELQKIYGKAKPEKVEQDIFDYLALLHEKRALDFE* |
Ga0126381_1034921322 | 3300010376 | Tropical Forest Soil | DLQQIYSKAEPKKVETDILAYLALLHDKRAIDFDL* |
Ga0126381_1050885962 | 3300010376 | Tropical Forest Soil | IIGELQLLYSKAEPQKVEQDILGYLDLLQKERALDFESGAV* |
Ga0134122_116224531 | 3300010400 | Terrestrial Soil | QLVAELQKLYGKAEPHKVEQDILGYLELLHTQRALNFGS* |
Ga0137393_110059212 | 3300011271 | Vadose Zone Soil | AKLQQIYSKAEPKKVETDILDYLARLHDQRALDFA* |
Ga0137393_110561782 | 3300011271 | Vadose Zone Soil | DGQHTVQQIISELQQIYSKAVPKKVETDILGYLSLLHDQRALDFA* |
Ga0137389_103854821 | 3300012096 | Vadose Zone Soil | VDLQKIYSKAEPHKVEQDILGYLTLLQKERALNFQL* |
Ga0137389_106402742 | 3300012096 | Vadose Zone Soil | DLQKIYSKAEPQKVAQDILGYLALLHKERALDFEL* |
Ga0137388_118255981 | 3300012189 | Vadose Zone Soil | DLQKIYSKAEPHKVEQDILGYLTLLQKERALDFQL* |
Ga0137388_119677032 | 3300012189 | Vadose Zone Soil | LQKIYSKAAPHKVEQDILGYLTLLQKERALDFEL* |
Ga0137382_105213822 | 3300012200 | Vadose Zone Soil | GKHTVAQIITELQKLYSKALAKKVEDDILGYLQLLHDQRALDFAM* |
Ga0137363_104071332 | 3300012202 | Vadose Zone Soil | DGQHTVQQIIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFAL* |
Ga0137363_111889181 | 3300012202 | Vadose Zone Soil | DGQHTVQQIIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFQL* |
Ga0137399_110685761 | 3300012203 | Vadose Zone Soil | VQQIVEELQKIYSKAAPQKVEQDILGYLALLHDQRALDFES* |
Ga0137387_102501301 | 3300012349 | Vadose Zone Soil | IIVDLQKIYSKAAPQKVAQDILGYLALLQKERALDFEL* |
Ga0137366_109584371 | 3300012354 | Vadose Zone Soil | QQIISDLQMIYSKAEPHKVEQDILGYLALLQKERALDFEL* |
Ga0137360_111979642 | 3300012361 | Vadose Zone Soil | HTVQQIILDLQKIYSKAEPQKVEQDILGYLTLLQKERALDFL* |
Ga0137390_108736982 | 3300012363 | Vadose Zone Soil | ISELQQIYSKAQGQKVEEDILGYLALLQKERALDFEL* |
Ga0137394_103437251 | 3300012922 | Vadose Zone Soil | IAEIVADLQKLYSKAQPHKVETDILSYLTLLQNERALDFTQ* |
Ga0137359_100412765 | 3300012923 | Vadose Zone Soil | ELQQIYSKAEPKKVETDILDYLARLHDQRALDFA* |
Ga0137359_110840282 | 3300012923 | Vadose Zone Soil | QQIISELQQIYSKAEPKKVESDIIDYLARLHDQRALDFDA* |
Ga0137419_107452011 | 3300012925 | Vadose Zone Soil | IITELQKLYSKALPKKVEDDILGYLQLLNDQRALDFAM* |
Ga0137404_122073371 | 3300012929 | Vadose Zone Soil | TVGQIVAELQKIYSKAVPQKVEQDILGYLVLLHDQRALDFDP* |
Ga0137410_112394363 | 3300012944 | Vadose Zone Soil | CSTFCGSALDLQKIYSKAEPQKVEQDILGYLTLLQKERALDFL* |
Ga0134110_101495632 | 3300012975 | Grasslands Soil | DLQKIYSKAEPHKVEQDILGYLNLLQKERALDFQL* |
Ga0182024_116461331 | 3300014501 | Permafrost | QIVADLQKLYSKAEPQKVEQDILGYLERLREQRALDFE* |
Ga0137405_13866825 | 3300015053 | Vadose Zone Soil | MASCQQIYSKAEPKKVEADILDYLARLHDQRALDFDS* |
Ga0137405_14271001 | 3300015053 | Vadose Zone Soil | LSSAATASHTVQQIVSELQQIYSKAQPQKVEEDILGYLAHLQKERALDFEL* |
Ga0137412_102271483 | 3300015242 | Vadose Zone Soil | ADLQKIYSKASAQKVEQDILGYLALLEKERALNFEP* |
Ga0137403_104653582 | 3300015264 | Vadose Zone Soil | NIYSKAEPQKVESDILGYLALLHERGALNFGDGGS* |
Ga0182036_117322551 | 3300016270 | Soil | IAELQKLYSKADARKVEQDILGYLELLHNQRALDFTS |
Ga0182041_108354162 | 3300016294 | Soil | LIAELQKLYSTADAHKVEQEILGYLELRRNQRALDFAP |
Ga0182039_106702901 | 3300016422 | Soil | LISELQKLYSKADPHKVEQDILGYLELLRERRALDFAS |
Ga0182038_117729421 | 3300016445 | Soil | KHTVSQIVAELQKIYAKAKPQKVEEDILGYLQLLCDQRALDFSL |
Ga0187824_102996982 | 3300017927 | Freshwater Sediment | SELQQLYSKAEPGKVEQDILGYLDLLNTQRALDFE |
Ga0187804_102624781 | 3300018006 | Freshwater Sediment | IVAELQKLYAKAEPLKIEQDILGYLQLLHDQRALDFG |
Ga0187769_108324451 | 3300018086 | Tropical Peatland | ELQKLYSKAEPYKVEQDILGYLQLLHDERALDFGA |
Ga0187769_114599761 | 3300018086 | Tropical Peatland | IVADLQKQYAKAKPHKVEQDILGYLGLLHDERAVDFE |
Ga0066667_100493901 | 3300018433 | Grasslands Soil | HSVSQIIGELQLLYSKAEPHKVEQDILGYLALLQKERALDFESGAV |
Ga0179592_100810891 | 3300020199 | Vadose Zone Soil | TVQQIILDLQKIYSKAEPQKVEQDILGYLTLLQKERALDFEPGVPL |
Ga0210407_101708693 | 3300020579 | Soil | ATLIAELQKLYSKAEPKKVEQDILGYLQLLHDQRALDFAS |
Ga0210401_103749291 | 3300020583 | Soil | IADVQRLYSKAEPQKVEQDILEYLGRLHDQRALDFE |
Ga0215015_104850681 | 3300021046 | Soil | VYKRQVQQIVTELQKIYSKAAPEKVAQDILGYLGLLHDRRALDFT |
Ga0210406_102270703 | 3300021168 | Soil | EIITELQKIYAKAEPKKVESDILDYLARLHDQRALDFET |
Ga0210406_112781191 | 3300021168 | Soil | QEIVTELQQLYSKAEPTKVEQDILGYLALLQKERALDFEAAAT |
Ga0210405_109251051 | 3300021171 | Soil | LQKIYSKAVPQKVESDILGYLALLHDQRALDFIDGSNN |
Ga0210396_107997731 | 3300021180 | Soil | VQQIISDLQKIYSKAEPKKVETDILGYLTLLQKERALDFEL |
Ga0210388_102150051 | 3300021181 | Soil | KRTVREIITELQHLYSKADPAKVESDILGYLKLLQDQRALDFE |
Ga0210388_107561431 | 3300021181 | Soil | TDLQKIYSKAVPQKVESDILGYLALLHEQRALDFT |
Ga0210393_107624691 | 3300021401 | Soil | QVIYSKAEPEKVKSDILGYLQLLHDQRALDFESIKQL |
Ga0210385_100345141 | 3300021402 | Soil | VQEIVSELQRLYSKAQPQKVEKDILGYLALLHDERALDFE |
Ga0210397_114662831 | 3300021403 | Soil | QLYSQAEPSKVEQDILGYLALLQKERALDFEPPSA |
Ga0210389_112442151 | 3300021404 | Soil | TELQHLYSKADPAKVESDILGYLKLLHDQRALDFES |
Ga0210383_115513032 | 3300021407 | Soil | QHTVQEIVTELQQLYSKAEPTKVEQDILGYLALLQKERALDFEAAAK |
Ga0210394_104340241 | 3300021420 | Soil | THTVGEIIADVQRLDSKAEPQKVEQDILEYLGRLHDQRALDFE |
Ga0210384_107096231 | 3300021432 | Soil | HTVEQIITELRHHYSKAEPAKVETDILGYLQLLNDQRALDFEP |
Ga0210402_104166351 | 3300021478 | Soil | QEIVTELQQLYSKAEPTKVEQDILGYLALLQKERALDFEAAAK |
Ga0137417_14972991 | 3300024330 | Vadose Zone Soil | AEVQKLYGKAEPGRVEQDVLGYLALLGDQRALDFE |
Ga0209235_12802521 | 3300026296 | Grasslands Soil | VSELQQIYSKAQAQKVEEDILGYLALLQKERALDFEV |
Ga0209131_11923842 | 3300026320 | Grasslands Soil | SELQQIYSKAQPQKVEEDILGYLAHLQKERALDFEL |
Ga0257173_10008733 | 3300026360 | Soil | DLQKIYSKAAPEKVAQDILGYLALLHDQRALDFDL |
Ga0209648_101464381 | 3300026551 | Grasslands Soil | HTVQQIVSELQLIYSKAQPQKVEQDILGYLQLLQKERALDFEQ |
Ga0209648_103467831 | 3300026551 | Grasslands Soil | HTVQQIVSELQLIYSKAQPQKVEQDILGYLQLLQKERALDFEL |
Ga0209648_107117962 | 3300026551 | Grasslands Soil | IVDLQRIYSKAQPQKVEQDILGYLNLLLKERALDFEL |
Ga0179587_100200321 | 3300026557 | Vadose Zone Soil | QIIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFQL |
Ga0209525_11457662 | 3300027575 | Forest Soil | ITDLQKIYSKAAPQKVEQDILGYLALLQKDRALDFEL |
Ga0209331_10398031 | 3300027603 | Forest Soil | TVRQIISELQQIYSKAEPKKVETDILDYLARLHDQRALDFDS |
Ga0209588_10900071 | 3300027671 | Vadose Zone Soil | CDGQHTVLQIILDLQKIYSKAEPQKVEQDILGYLTLLQKERALDFEL |
Ga0209178_10817532 | 3300027725 | Agricultural Soil | SVEQIVTELQQLYSKADPAKVEQDILGYLQLLLKERALDFE |
Ga0208989_100584861 | 3300027738 | Forest Soil | EIILDLQKIYSKAEPQKVEQDILGYLTLLQKERALDFESGVPL |
Ga0209139_100174501 | 3300027795 | Bog Forest Soil | TIQQIITELQKIYAKAEAERVEKDILGYLTLLHDQRALDFTIDDTTGQS |
Ga0209039_103375272 | 3300027825 | Bog Forest Soil | IITELQKLYSKAEPRKVEEDILGYLARLQEQRALYFE |
Ga0209180_102632152 | 3300027846 | Vadose Zone Soil | VQQIIVDLQKIYSKAEPQKVAQDILGYLALLQKERALDFEL |
Ga0209274_103626371 | 3300027853 | Soil | TELQQIYSKAEPKKVETDILGYLTLLRDQRALDFE |
Ga0209274_107310512 | 3300027853 | Soil | IVADLQKLYSKAEPQKVEQDILGYLERLQEQRALDFE |
Ga0209693_103031991 | 3300027855 | Soil | TELQHLYSKADPAKVESDILGYLKLLQDQRALDFES |
Ga0209167_100933841 | 3300027867 | Surface Soil | QIIAELQKLYSKAEPKKVEQDILGYLQLLHDQRALDFTT |
Ga0209169_100649894 | 3300027879 | Soil | TVREIVTELQHLYSKADPAKVESDILGYLKLLHDQRALDFES |
Ga0209169_106589211 | 3300027879 | Soil | TVREIVTELQHLYSKADPAKVESDILGYLKLLQDQRALDFES |
Ga0209275_108655491 | 3300027884 | Soil | TELQQIYSQADPKKVETDILGYLQLLNDQRALDFES |
Ga0209624_105916171 | 3300027895 | Forest Soil | IVTELQQIYSQADPKKVETDILGYLQLLNDQRALDFES |
Ga0209488_100210946 | 3300027903 | Vadose Zone Soil | IVDLQKIYSKAEPQKVAQDILGYLALLHKERALDFEL |
Ga0265357_10445381 | 3300028023 | Rhizosphere | TELQQLYSQAVLAKVEQDILGYLALLQKERALDFEP |
Ga0209526_102363841 | 3300028047 | Forest Soil | VERCDGKHTVHQIIVDLQKIYPKAEPHKVEQDILGYLILLQKERALDFQQ |
Ga0137415_102670753 | 3300028536 | Vadose Zone Soil | IIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFAL |
Ga0137415_104142751 | 3300028536 | Vadose Zone Soil | IIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALNFQL |
Ga0302225_105750201 | 3300028780 | Palsa | IQQIVADLQKLYSKAEPQKVQQDILGYLERLQEQRALDFE |
Ga0308309_104402532 | 3300028906 | Soil | VQQIISELQQRYSKAEPAKVEQDILGYLALLQKERALDFEPANT |
Ga0311368_108598341 | 3300029882 | Palsa | QQIISELQKIYSKAEPERVEKDILGYLALLQEQQALEFTLEDAAERK |
Ga0311370_120433932 | 3300030503 | Palsa | QQIISELQKIYSKAEPERVEKDILGYLALLHEQGALEFTAEDAAAQK |
Ga0302310_102768402 | 3300030737 | Palsa | TVEQIIAELQKIYSKAVPEKVARDIEGYLKLLHDQRALDFQ |
Ga0170834_1008441321 | 3300031057 | Forest Soil | LIAELQKLYAKADSKKVEQDILGYLQLLHDQRALDLVS |
Ga0170824_1206243131 | 3300031231 | Forest Soil | DGKHTIATLIADLQKLYSKAEPQKVEADILGYLTLLQNERALDFTP |
Ga0310686_1059387481 | 3300031708 | Soil | ITELQGLYSQADPQKVETDILGYLGLLNDQRALDFDQSS |
Ga0307474_116085801 | 3300031718 | Hardwood Forest Soil | IHTVQQIITDLQQIYSKAEPKKVETDILGYLALLHDQRALDFE |
Ga0307475_103090502 | 3300031754 | Hardwood Forest Soil | QIIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFAL |
Ga0307475_111807812 | 3300031754 | Hardwood Forest Soil | GQHTVQQIIVDLQKIYSKAEPHKVEQDILGYLTLLQKEHALDFAL |
Ga0307473_101561881 | 3300031820 | Hardwood Forest Soil | QQIIVDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFAL |
Ga0307478_102709932 | 3300031823 | Hardwood Forest Soil | HTVEQIIAELQKIYSKAVPEKVAEDIRGYLKLLHEQRALDFQ |
Ga0307478_108523002 | 3300031823 | Hardwood Forest Soil | QQIITELQTIYSKADPAKVEQDILGYLERLHDQRALDFS |
Ga0306925_113198141 | 3300031890 | Soil | AELIAELQKLYSKADARKVEQDILGYLELLHNQRALDFTS |
Ga0306921_100005441 | 3300031912 | Soil | QLVAELQKLYAKAEPHKVEQDILGYLQLLRSERALDFAS |
Ga0310913_100891223 | 3300031945 | Soil | TVREIILDLQQIYTKTDPLKVEQDILEYLTLLQEQRALDFE |
Ga0310909_102406721 | 3300031947 | Soil | ELQKLYAKAEPHKVEQDILGYLQLLRSERALDFAS |
Ga0307479_106586631 | 3300031962 | Hardwood Forest Soil | VQQIITELQQIYSQANAQKVETDILGYLQLLNDQRALDFD |
Ga0307479_106957812 | 3300031962 | Hardwood Forest Soil | VDLQKIYSKAEPHKVEQDILGYLTLLQKERALDFAL |
Ga0306922_100529165 | 3300032001 | Soil | VREIILDLQQIYTKTDPLKVEQDILEYLTLLQEQRALDFE |
Ga0318558_102250252 | 3300032044 | Soil | AALISELQKLYSKADPHKVEQDILGYLELLRERRALDFAS |
Ga0307471_1017823792 | 3300032180 | Hardwood Forest Soil | VASLIAELQKLYSKAEPKKVEQDILGYLQLLHDQRALDFAS |
Ga0307471_1020509531 | 3300032180 | Hardwood Forest Soil | KHTVGQIVAELQQIYSKAVPEKVEQDILGYLALLQKDRALDFET |
Ga0307471_1041778481 | 3300032180 | Hardwood Forest Soil | HTVTTLIAELQKLYSKAAPQKVEQDILGYLQLLHDQRALDFEP |
Ga0307472_1002650062 | 3300032205 | Hardwood Forest Soil | IILELQNLYSKAEPQKVETDILVYLELLHNHRALDFASD |
Ga0335078_120527321 | 3300032805 | Soil | NHTVQQIVTELQKLYSKAEPQKVEADILGYLARLHDQRALDFE |
Ga0335081_119275632 | 3300032892 | Soil | KNTVAQIVAELQKLYSKADSQKVEQDILGYLQLLHDQRALDFEP |
Ga0335076_107470002 | 3300032955 | Soil | GKRTVREIVTELQHLYSKADPAKVESDILGYLKLLQDQRALDFE |
Ga0316628_1038539372 | 3300033513 | Soil | HTVQQIISELQTLYSKAEPAKVEQDILGYLALLQKERALDFEP |
⦗Top⦘ |