NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042550

Metagenome / Metatranscriptome Family F042550

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042550
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 48 residues
Representative Sequence VTILTSILGTKALGLLLLLQEAAASPEASGADHFTLTEMVKNMGGVAIA
Number of Associated Samples 138
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.89 %
% of genes near scaffold ends (potentially truncated) 99.37 %
% of genes from short scaffolds (< 2000 bps) 96.20 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.304 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(9.494 % of family members)
Environment Ontology (ENVO) Unclassified
(37.975 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(63.291 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 42.86%    β-sheet: 0.00%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 158 Family Scaffolds
PF03544TonB_C 96.20
PF02355SecD_SecF 2.53
PF02699YajC 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 158 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 96.20
COG0341Preprotein translocase subunit SecFIntracellular trafficking, secretion, and vesicular transport [U] 2.53
COG0342Preprotein translocase subunit SecDIntracellular trafficking, secretion, and vesicular transport [U] 2.53
COG1862Protein translocase subunit YajCIntracellular trafficking, secretion, and vesicular transport [U] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.30 %
UnclassifiedrootN/A5.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000953|JGI11615J12901_12365378All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum530Open in IMG/M
3300003319|soilL2_10030554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1022Open in IMG/M
3300003324|soilH2_10080300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1546Open in IMG/M
3300003998|Ga0055472_10071943All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300004153|Ga0063455_100442001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium785Open in IMG/M
3300004463|Ga0063356_105011295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300004643|Ga0062591_102306439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300004798|Ga0058859_11765126All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300004800|Ga0058861_11934283Not Available1292Open in IMG/M
3300004801|Ga0058860_12070404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1228Open in IMG/M
3300004803|Ga0058862_12857482Not Available1329Open in IMG/M
3300005093|Ga0062594_100771563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300005288|Ga0065714_10520064All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300005293|Ga0065715_10260777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1139Open in IMG/M
3300005295|Ga0065707_10002147All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum7495Open in IMG/M
3300005328|Ga0070676_10189864Not Available1341Open in IMG/M
3300005328|Ga0070676_11558441All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300005330|Ga0070690_100077322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2172Open in IMG/M
3300005330|Ga0070690_100498572All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium911Open in IMG/M
3300005334|Ga0068869_100223470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1493Open in IMG/M
3300005334|Ga0068869_101186213All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum670Open in IMG/M
3300005338|Ga0068868_102206442All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300005340|Ga0070689_100629701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium931Open in IMG/M
3300005341|Ga0070691_10712227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300005343|Ga0070687_100605074All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300005343|Ga0070687_100679731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300005344|Ga0070661_101276276All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300005344|Ga0070661_101759298All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300005345|Ga0070692_10482456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300005354|Ga0070675_101727103All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300005365|Ga0070688_101379937All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300005440|Ga0070705_101672905All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300005444|Ga0070694_100707359All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum820Open in IMG/M
3300005457|Ga0070662_100202489All Organisms → cellular organisms → Bacteria → Acidobacteria1576Open in IMG/M
3300005466|Ga0070685_10826459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300005466|Ga0070685_11428282All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300005468|Ga0070707_100304416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1549Open in IMG/M
3300005471|Ga0070698_101740776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300005530|Ga0070679_101073246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300005535|Ga0070684_101432384All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum651Open in IMG/M
3300005539|Ga0068853_101679085All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300005539|Ga0068853_101836338All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300005545|Ga0070695_100293787All Organisms → cellular organisms → Bacteria → Acidobacteria1199Open in IMG/M
3300005546|Ga0070696_100244425All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1355Open in IMG/M
3300005546|Ga0070696_100453215All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum1013Open in IMG/M
3300005564|Ga0070664_100540346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1077Open in IMG/M
3300005577|Ga0068857_100431074All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1230Open in IMG/M
3300005578|Ga0068854_100832211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300005615|Ga0070702_100373080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1012Open in IMG/M
3300005615|Ga0070702_100620337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium813Open in IMG/M
3300005617|Ga0068859_100105841All Organisms → cellular organisms → Bacteria → Acidobacteria2872Open in IMG/M
3300005617|Ga0068859_102845615All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300005618|Ga0068864_102491160All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300005719|Ga0068861_100447478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1157Open in IMG/M
3300005840|Ga0068870_10169222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1303Open in IMG/M
3300005841|Ga0068863_101181797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300005843|Ga0068860_102513413All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300005844|Ga0068862_100290365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1501Open in IMG/M
3300005844|Ga0068862_100577388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1076Open in IMG/M
3300005873|Ga0075287_1005880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1451Open in IMG/M
3300006169|Ga0082029_1620134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300006173|Ga0070716_101156186All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300006804|Ga0079221_10464126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300006844|Ga0075428_100324563All Organisms → cellular organisms → Bacteria → Acidobacteria1654Open in IMG/M
3300006853|Ga0075420_101349634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300006871|Ga0075434_102204463All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300006876|Ga0079217_10141436All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1150Open in IMG/M
3300006876|Ga0079217_10676778All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300006880|Ga0075429_101032067All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia719Open in IMG/M
3300006881|Ga0068865_100807846All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300006881|Ga0068865_101034492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300006904|Ga0075424_101249767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium790Open in IMG/M
3300006904|Ga0075424_102577179All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300006954|Ga0079219_10645124All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium789Open in IMG/M
3300006969|Ga0075419_11107140All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300007076|Ga0075435_100062923All Organisms → cellular organisms → Bacteria → Acidobacteria3012Open in IMG/M
3300009011|Ga0105251_10508383All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300009088|Ga0099830_11755860All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300009093|Ga0105240_12217821All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300009168|Ga0105104_10174663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1165Open in IMG/M
3300009174|Ga0105241_11287826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300009840|Ga0126313_11241169All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300010040|Ga0126308_10816318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300010041|Ga0126312_10563156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300010041|Ga0126312_11374608All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300010042|Ga0126314_11088249All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes595Open in IMG/M
3300010043|Ga0126380_11954360All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes535Open in IMG/M
3300010045|Ga0126311_10119846All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1834Open in IMG/M
3300010047|Ga0126382_12544615All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300010358|Ga0126370_10417032Not Available1108Open in IMG/M
3300010362|Ga0126377_11328614All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300010373|Ga0134128_10646714All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1175Open in IMG/M
3300010373|Ga0134128_10871945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium997Open in IMG/M
3300010375|Ga0105239_13112197All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300010399|Ga0134127_11380430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300010399|Ga0134127_13037528All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes547Open in IMG/M
3300010403|Ga0134123_11256674All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300011119|Ga0105246_10944724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300011993|Ga0120182_1024572All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300012354|Ga0137366_10182706Not Available1572Open in IMG/M
3300012509|Ga0157334_1037259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300012929|Ga0137404_10763596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300012948|Ga0126375_11514740All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300012955|Ga0164298_10157255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1284Open in IMG/M
3300012958|Ga0164299_11176464All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300012961|Ga0164302_11230146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300012984|Ga0164309_10202759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1365Open in IMG/M
3300013100|Ga0157373_10786352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300014326|Ga0157380_10813422All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium953Open in IMG/M
3300015372|Ga0132256_101821754All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300015374|Ga0132255_105997576All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes514Open in IMG/M
3300018466|Ga0190268_12064056All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300019377|Ga0190264_12066229All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300021445|Ga0182009_10164576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1062Open in IMG/M
3300025885|Ga0207653_10272849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300025907|Ga0207645_10195269Not Available1331Open in IMG/M
3300025911|Ga0207654_11233387All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes545Open in IMG/M
3300025927|Ga0207687_10883495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300025934|Ga0207686_11694605All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300025939|Ga0207665_10052948All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2735Open in IMG/M
3300025941|Ga0207711_11511764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300025942|Ga0207689_11327211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300025942|Ga0207689_11337809All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300025945|Ga0207679_10284136Not Available1420Open in IMG/M
3300025981|Ga0207640_10925365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300026041|Ga0207639_10266904Not Available1499Open in IMG/M
3300026075|Ga0207708_10333498All Organisms → cellular organisms → Bacteria → Acidobacteria1240Open in IMG/M
3300026088|Ga0207641_10788662All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium939Open in IMG/M
3300026095|Ga0207676_12570465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300026116|Ga0207674_10679498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium994Open in IMG/M
3300026680|Ga0208345_102826All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300026704|Ga0208581_103845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300026900|Ga0207444_1017156All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300027691|Ga0209485_1257722All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300027875|Ga0209283_10636389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300027909|Ga0209382_10574890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1231Open in IMG/M
3300028380|Ga0268265_10779468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium930Open in IMG/M
3300028380|Ga0268265_11403526All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300028802|Ga0307503_10798432All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300030496|Ga0268240_10142051All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes587Open in IMG/M
3300030499|Ga0268259_10129935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300031058|Ga0308189_10337384All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300031547|Ga0310887_10127717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1302Open in IMG/M
3300031740|Ga0307468_101294009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300031740|Ga0307468_101786054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300031824|Ga0307413_10509095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium968Open in IMG/M
3300031892|Ga0310893_10434275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300031908|Ga0310900_11175675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300031944|Ga0310884_10795973All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300031962|Ga0307479_10285719All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1631Open in IMG/M
3300031996|Ga0308176_12510509All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300032002|Ga0307416_102370522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300032005|Ga0307411_11691313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300032211|Ga0310896_10495602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300033412|Ga0310810_11369105All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300034479|Ga0314785_025257All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300034659|Ga0314780_133323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.06%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere5.06%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.06%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.43%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.16%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.16%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.16%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.16%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.53%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.27%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.27%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.63%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.63%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.63%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.63%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.63%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.63%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011993Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1EnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026680Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized - NN609 (SPAdes)EnvironmentalOpen in IMG/M
3300026704Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized - NN606 (SPAdes)EnvironmentalOpen in IMG/M
3300026900Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034479Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11615J12901_1236537813300000953SoilMSLFGTKAIGLFLLLQDAAAGASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMSVYS
soilL2_1003055413300003319Sugarcane Root And Bulk SoilVTILTSLLGAKALGLLLLFQEAAASPAADAGNTFTLTEMVKNMGGVAI
soilH2_1008030033300003324Sugarcane Root And Bulk SoilVTILTSLLGTKAFGLLMFLQEAAASPESSGADHFTLTEMVKNM
Ga0055472_1007194323300003998Natural And Restored WetlandsLEGFTVTILTSLLGTKALGLLLLLQEATASPQTADHFTLTEMV
Ga0063455_10044200113300004153SoilVTMLTSIFIGFLMLLQDAAASPAASDADHFTLTEMVKNMGGVAIAVVI
Ga0063356_10501129523300004463Arabidopsis Thaliana RhizosphereLEGFTVTILTSLLGAKALGLFLLFQEAAASPAADTGNTFTL
Ga0062591_10230643923300004643SoilLEGFTVTILTSLFGTKVLGLLLLLQEAAASPSAGENAANTFTLT
Ga0058859_1176512613300004798Host-AssociatedVTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMVKNMGGVAIAV
Ga0058861_1193428313300004800Host-AssociatedVTILTSILGTKVLGLFLLLQEAAAAASPGASDADHFTLTEMVKNMGGVAI
Ga0058860_1207040413300004801Host-AssociatedVTILMSLLGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGG
Ga0058862_1285748223300004803Host-AssociatedVTILMSLFGTKALGLLMLLQEAAASPAEGANTANTFTLTEMVK
Ga0062594_10077156313300005093SoilVTMLISLFGTKALGLLMLLQDAATSPEASSADHFTLTEMVKNMGGVAIAVVIVLL
Ga0065714_1052006423300005288Miscanthus RhizosphereVTMLISLFGTKVLGLFMLLQEAAASPAQDTGNTFTLTEMV
Ga0065715_1026077723300005293Miscanthus RhizosphereVTMLISLFGTKALGLLMLLQEAATSPETSSADHFTLTEMVKN
Ga0065707_1000214773300005295Switchgrass RhizosphereVTILTSLLGTKALGLLLFLQDAAASPEASGADHFTLTEMVKNMGGVAIAVVIVLLIMSVY
Ga0070676_1018986413300005328Miscanthus RhizosphereVTILTSILGTKALGLLLLLQEAAAATSPEASGADHFTLTEMVKNMGGVAIAVV
Ga0070676_1155844113300005328Miscanthus RhizosphereVTILTSLLGAKALGLFLLFQEAAASPAADTGNTFTLTEMVKNMGGVAIAVVIV
Ga0070690_10007732213300005330Switchgrass RhizosphereLEGFIVTILTSLLGTKVLGVVIFLLQEAAASPAASPAAAGH
Ga0070690_10049857223300005330Switchgrass RhizosphereVTILTSIFLGFLMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLL
Ga0068869_10022347013300005334Miscanthus RhizosphereVTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMV
Ga0068869_10118621313300005334Miscanthus RhizosphereVTILMSLLGTKALGLFMLLQEAAASPAEGANAATQFTLTEMVKNMGGVAIAVVIVLLIMSVYS
Ga0068868_10220644223300005338Miscanthus RhizosphereVTMLTSIFIGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMSVY
Ga0070689_10062970123300005340Switchgrass RhizosphereVTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMSV
Ga0070691_1071222713300005341Corn, Switchgrass And Miscanthus RhizosphereVTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGGVAI
Ga0070687_10060507413300005343Switchgrass RhizosphereVTMLTSIFVGFLMLLQEAAASPEASNANQFTLTEMVKNMGGVAIAVVIVLLIMSV
Ga0070687_10067973123300005343Switchgrass RhizosphereVTMLMSIFGTKILGLFVLLQDAAAAASPEAGTGDHFTLTEMVKNMGGVAIAV
Ga0070661_10127627613300005344Corn RhizosphereLEGFTVTMLISLFGTKVLGLFMLLQEAAASPAEGANAANTFTLT
Ga0070661_10175929813300005344Corn RhizosphereVTILMSLFGTKAIGLLMLLQDAAASPAEGANAATQFTLTEMVKNMGGVAIAVVI
Ga0070692_1048245613300005345Corn, Switchgrass And Miscanthus RhizosphereVTMLMSIFGTKVLGLMLLLQEAAASPESSGADHFTLTEMVKNMGGVAIAVV
Ga0070675_10172710323300005354Miscanthus RhizosphereVTILTSLLGMKAFGLLMFLQEAAASPESSGADHFTLTEMVKNMGGV
Ga0070688_10137993713300005365Switchgrass RhizosphereVTILTSILGTKALGLLLLLQEAAASPEASGADHFTLTEMVKNMGGVAIA
Ga0070705_10167290513300005440Corn, Switchgrass And Miscanthus RhizosphereVTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGV
Ga0070694_10070735923300005444Corn, Switchgrass And Miscanthus RhizosphereVTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMVKNMGGVAIAVVIVLLIMSVY
Ga0070662_10020248933300005457Corn RhizosphereVTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAV
Ga0070685_1082645913300005466Switchgrass RhizosphereVTILMSLFGTKAIGLLMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAI
Ga0070685_1142828213300005466Switchgrass RhizosphereMSLFGTKAIGLLMLLQDAAASPAEGANAATQFTLTEMVKNMGGVAIAVVIVLLI
Ga0070707_10030441633300005468Corn, Switchgrass And Miscanthus RhizosphereVTMLMSIFGTKVLGLMLLLQEAAASPESSGADHFTLTEMVKNMGGVAIAVVIV
Ga0070698_10174077623300005471Corn, Switchgrass And Miscanthus RhizosphereVTILMSLLGTKVLGLFMLLQEAAASPAAESSANTFTLTEMVKNMGGVAIAVVIVL
Ga0070679_10107324623300005530Corn RhizosphereVTILTSLLGMKAFGLLMFLQEAAASPESSGADHFTLTEMVKNMGGVAIAVV
Ga0070684_10143238413300005535Corn RhizosphereVTMLTSIFIGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMSVYS
Ga0068853_10167908513300005539Corn RhizosphereVTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGG
Ga0068853_10183633823300005539Corn RhizosphereVTILTSILGTKVLGLFLLLQEAAAAASPGASDADHFTLTEMVKNMGGVAIAVVIVLL
Ga0070695_10029378723300005545Corn, Switchgrass And Miscanthus RhizosphereVTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAVVI
Ga0070696_10024442513300005546Corn, Switchgrass And Miscanthus RhizosphereVTMLMSIFGTKVLGLMLLLQEAAASPESSGADHFTLTEMVKNMGGVAIAVVIVL
Ga0070696_10045321513300005546Corn, Switchgrass And Miscanthus RhizosphereVTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMSVYS
Ga0070664_10054034613300005564Corn RhizosphereVTILTSFLGIKALGLLMLFQEAAASPAADTGNTFTLTEMVKNMGGVAI
Ga0068857_10043107433300005577Corn RhizosphereVTILTSLLGTKAFGLLMFLQEAAASPESSGADHFTLTEM
Ga0068854_10083221123300005578Corn RhizosphereVTMLISLFGTKVLGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAI
Ga0070702_10037308033300005615Corn, Switchgrass And Miscanthus RhizosphereVTILTSLFGAKALGLFLLLQEAAASPEASNANQFTLTEMVKNMG
Ga0070702_10062033723300005615Corn, Switchgrass And Miscanthus RhizosphereMSLFGTKVFGLLLLLQEAAASPEASSADHFTLTEMVKNMGGVAI
Ga0068859_10010584113300005617Switchgrass RhizosphereVTILMSLLGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVLLIM
Ga0068859_10284561523300005617Switchgrass RhizosphereVTMLMSLFGTKVVGLFMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIV
Ga0068864_10249116023300005618Switchgrass RhizosphereVTILMSLFGTKVLGLFMLLQDAAASPEASSADHFTLTEMVKN
Ga0068861_10044747813300005719Switchgrass RhizosphereVTILMSLFGTKAIGLLMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAV
Ga0068870_1016922233300005840Miscanthus RhizosphereVTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVL
Ga0068863_10118179723300005841Switchgrass RhizosphereVTILMSLLGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVLLIMS
Ga0068860_10251341323300005843Switchgrass RhizosphereVTILMSLLGTKALGLFMLLQEAAASPAEGANAATQFTLTEMVKNMGGVAIAVVIV
Ga0068862_10029036513300005844Switchgrass RhizosphereVTILMSVFGTKVLGLLLLLQEAAASPETSSADHFTLTEMVKNMGG
Ga0068862_10057738813300005844Switchgrass RhizosphereVTILMSLFGTKAIGLLMLLQDAAASPAEGANAATQFTLTEMV
Ga0075287_100588023300005873Rice Paddy SoilVTMLTSIFIGFLMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMS
Ga0082029_162013423300006169Termite NestVTILMSLLGTKALGLFMLLQEAAASPAEGNAATQFTLTEMVK
Ga0070716_10115618623300006173Corn, Switchgrass And Miscanthus RhizosphereVTILMSLFGTKALGLLMLLQEAAASPAEGANTANTFTLTEMVKNMGGVAIAVV
Ga0079221_1046412623300006804Agricultural SoilVTILTSLLGAKALGLLLLFQEAAASPAADTGSTFTLTEMVKNMGGVAIAGVI
Ga0075428_10032456313300006844Populus RhizosphereVTMLISIFGTKALGLLMLLQEAAASPESSGADHFTLTEMVKNMGGVAIAVVVV
Ga0075420_10134963423300006853Populus RhizosphereVTILTSLLGTKALGLLLFLQDAAASPEASGADHFTLTEMVKNMGGVAIAV
Ga0075434_10220446313300006871Populus RhizosphereVTILMSLFGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAI
Ga0079217_1014143633300006876Agricultural SoilVTMLMSVFGTKVLGLLVLLQDAAASPESSGADHFTLTEMVKNMG
Ga0079217_1067677813300006876Agricultural SoilVTMLMSLFGTKFLSFMLLLQDAAASTEAAGADHFSLTAMIKSMGAVAIAVVLV
Ga0075429_10103206713300006880Populus RhizosphereVTILISLFGTKALGFLMLLQEAAATEATGADHFSLTEMVKSMGGVAIAVVVVLLIMSVYS
Ga0068865_10080784613300006881Miscanthus RhizosphereVTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIAVVIVLLIMS
Ga0068865_10103449223300006881Miscanthus RhizosphereVTILTSLFGLLLLLQEAAASPEAGASSANTFTLTEMVKNMGGVAIAV
Ga0075424_10124976713300006904Populus RhizosphereVTILTSLLGTKALGLLIFLQEAAQPGASPGGEAANTFTITEMVKNMGGVA
Ga0075424_10257717923300006904Populus RhizosphereVTILTSLFGILLLLQEAAASPEGASNANQFTLTEMVK
Ga0079219_1064512423300006954Agricultural SoilVTILTSLLGAKALGLLLLFQEAAASPAADTGNTFTLT
Ga0075419_1110714013300006969Populus RhizosphereVTILTSLLGTKALGLLLLLQEAAASPEGASAQNTFT
Ga0075435_10006292353300007076Populus RhizosphereVTILMSLLGTKVLGLFMLLQEAAASPAAESSANTFTLTEMVKNMGGV
Ga0105251_1050838313300009011Switchgrass RhizosphereMSLFGTKVLGLLMLLQDAAASPSEGANAANTFTLTEMVKNMGGVAI
Ga0099830_1175586013300009088Vadose Zone SoilLEGFAVTILTSLLGTKALGLVIFLLQAAEASPAGSPKASNDQFALTEMVKNMGAVAIGVVIVL
Ga0105240_1221782123300009093Corn RhizosphereMSLFGTKALGLLMLLQEAAASPAEGANTANTFTLT
Ga0105104_1017466313300009168Freshwater SedimentLEGFTVTILTSLLGTKAFGLLLLLQEAAASPEGSTGADHFSLTEM
Ga0105241_1128782623300009174Corn RhizosphereMSLLGTKALGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAI
Ga0126313_1124116923300009840Serpentine SoilMSIFGTKALGLFMLLQEAAASPEASSADHFTLTEMVKN
Ga0126308_1081631823300010040Serpentine SoilLEGFTVTILMSLFGTKALGLFMLLQEAAASPEASGADHFTLTEMVKN
Ga0126312_1056315613300010041Serpentine SoilVTILTSLLGTKAFGLLMLLQEAAASPEASGADHFTLTEMV
Ga0126312_1137460813300010041Serpentine SoilMSVFGTKVLGLLLLLQEAAASPEASGADHFTLTEMVKNMGGVA
Ga0126314_1108824923300010042Serpentine SoilMSLFGTKALGLLMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVLLIM
Ga0126380_1195436013300010043Tropical Forest SoilMLISLLGTKALGLFLLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVLLIMSVY
Ga0126311_1011984613300010045Serpentine SoilMKAFGLLMLLQEAAASPEASGADHFTLTEMVKNMGG
Ga0126382_1254461513300010047Tropical Forest SoilLEGFTVTILTSLLGSKALGLLLMFQEAQAAASPATENQFTITEMVKNMGG
Ga0126370_1041703213300010358Tropical Forest SoilMSLFGTKTLGLLLLLQEAAASPAEGANTANTFTLTEMVKN
Ga0126377_1132861413300010362Tropical Forest SoilVTILTSLLGTKALGLLILFQEAAASPEASSADHFTLTEM
Ga0134128_1064671423300010373Terrestrial SoilLEGFTVTILTSLFGTKVLGLLLFLQEAAASPEGGGGADHFTLTEMVKNMGGVAIAVVIVLLI
Ga0134128_1087194513300010373Terrestrial SoilMSLFGTKALGLLMLLQEAAASPAEGANTANTFTQAEMVKN
Ga0105239_1311219723300010375Corn RhizosphereMLISLFGTKALGLLMLLQEAATSPEASSADHFTLTE
Ga0134127_1138043023300010399Terrestrial SoilMLMSLFGTKVVGLFMLLQEAAASPEASSADHFTLTEMVKNM
Ga0134127_1303752813300010399Terrestrial SoilLEGFTVTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGGVAIAVVVVLLIMSVYS
Ga0134123_1125667413300010403Terrestrial SoilMLTSIFIGFLMLLQEAAASPEASNADHFTLTEMVKNMGGVAIAVVIVLLIMSVYSI
Ga0105246_1094472413300011119Miscanthus RhizosphereMSLLGTKALGLFILLQEAATSPAEGADANHFTLTEMVKNMG
Ga0120182_102457213300011993TerrestrialVTMLISLFGTKAFGLLMLLQEAATSPEATGADHFSLT
Ga0137366_1018270633300012354Vadose Zone SoilVTILTSLLGTKALGLFFMLQEAAPAASPATDQNTFTMSEMVKNMGPVAIC
Ga0157334_103725913300012509SoilLEGFTVTILTSILGTKVLGLFLLLQEAAAAASPGASDADHFTLTEMVKNMGGVAIAVVIV
Ga0137404_1076359623300012929Vadose Zone SoilLEGFTVSILTSLLGTKAIVLLFMLQDATAAASPGTDTSNTFTMSEMVKNMGPVAIAVV
Ga0126375_1151474013300012948Tropical Forest SoilMSLFGTKALGLLMLLQEAAASPAEGANAAQTFTLTEMVK
Ga0164298_1015725513300012955SoilMSLFGAKVLGLFMLLQEAAASPEASSADHFTLTEM
Ga0164299_1117646423300012958SoilMLTSIFIGFLMLLQEAAASPAASDADYFTLTEMVTHSGGVAIAVVI
Ga0164302_1123014623300012961SoilVTILTSLFGLLLLLQEAAASPEAAASSANTFTLTEMVK
Ga0164309_1020275923300012984SoilVTILTSLLGTKAFGLLLLLQDAAATPEASGADHFT
Ga0157373_1078635213300013100Corn RhizosphereMSLFGTKAIGLLMLLQEAAASPEASSADHFTLTEMVKNM
Ga0157380_1081342213300014326Switchgrass RhizosphereMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAVVIV
Ga0132256_10182175413300015372Arabidopsis RhizosphereMLISLFGTKALGLFMLLQEAAASPEASGADHFTLTEMVKNMGGVAIAVVIVL
Ga0132255_10599757623300015374Arabidopsis RhizosphereLEGFTVTILTSLFGVKALGLLLLLQDAAASPEASSANTFTLTEMVKNMGGVAIAVVIVLLIMSVY
Ga0190268_1206405623300018466SoilVTMLISLFGTKALGLLLLLQEAAASPESSGADHFSLTEMVKSMGG
Ga0190274_1056791223300018476SoilVTILTSLFGTKALGLLLFLQEAAGAEGGAGAGDHFSLTE
Ga0190264_1206622913300019377SoilVTMLMSIFGTKFLSFMLLLQDAAAAGTEATGADHFSLTGMIKSMGG
Ga0182009_1016457623300021445SoilVTILTSFLGILLFFQEQAASPAADTGTQFTLTEMVKNMGGVAIAVVIVLLIM
Ga0207653_1027284923300025885Corn, Switchgrass And Miscanthus RhizosphereVTILTSIFLGFLMLLQEAAASPEASSADHFTLTEMVKNMG
Ga0207645_1019526923300025907Miscanthus RhizosphereVTILTSILGTKALGLLLLLQEAAAATSPEASGADHFTLTEMVKNMGGV
Ga0207654_1123338723300025911Corn RhizosphereVTMLMSLFGTKVVGLFMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMSV
Ga0207687_1088349513300025927Miscanthus RhizosphereVTILTSLFGAKALGLLLLLQEAAASPEASNANQFTLTEMVKNMGGVAIAVVI
Ga0207686_1169460523300025934Miscanthus RhizosphereVTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAVVIVL
Ga0207665_1005294843300025939Corn, Switchgrass And Miscanthus RhizosphereVTILTSLLGAKALGLLLLFQEAAASPAAADTGNTFTLTEMVKNMGGVAIAVVIVLLIMSV
Ga0207711_1151176423300025941Switchgrass RhizosphereVTMLISLFGTKVLGLFMLLQEAAASPAEGANAANTFTLTEM
Ga0207689_1132721123300025942Miscanthus RhizosphereVTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMVKNM
Ga0207689_1133780913300025942Miscanthus RhizosphereVTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVAIAVVIVLLI
Ga0207679_1028413613300025945Corn RhizosphereVTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGGVAIAVVVVLL
Ga0207640_1092536513300025981Corn RhizosphereVTMLISLFGTKVLGLFMLLQEAAASPAEGANAANTFTLTEMVKNMGGVAIAVVIVL
Ga0207639_1026690423300026041Corn RhizosphereVTILTSILGTKALGLLLLLQEAAASPEASGADHFTL
Ga0207708_1033349813300026075Corn, Switchgrass And Miscanthus RhizosphereVTMLTSLLGTKALGLLILFQDAAPSPADAAAQNTFTLTEMVKNMGGVA
Ga0207641_1078866223300026088Switchgrass RhizosphereVTMLMSLFGTKALGLLLLLQDAAASPAEGAGANAA
Ga0207676_1257046513300026095Switchgrass RhizosphereVTILTSIFLGFLMLLQEAAASPEASSADHFTLTEMVKNMGGVAIA
Ga0207674_1067949823300026116Corn RhizosphereVTILTSLFGTKILGLMLFLQEAAASPDASASTNQFTLTEMVKNMGGVAIA
Ga0208345_10282613300026680SoilVTILTSIFLGFLMLLQDAAASPEASSADHFTLTEMVKNM
Ga0208581_10384523300026704SoilVTILTSIFLGFLMLLQDAAASPEASSADHFTLTEMVKNMGG
Ga0207444_101715623300026900SoilVTILTSLLGAKALGLFLLFQDAAASPAADTGSQFTLTEMVKNMGGV
Ga0209485_125772223300027691Agricultural SoilVTMLMSLFGTKFLSFMLLLQDAAASTEAAGADHFSLTAMIKSMGAVAIAVV
Ga0209283_1063638923300027875Vadose Zone SoilVTILTSILGTKALGLLVFLWQASPAASPPANTLRID
Ga0209382_1057489023300027909Populus RhizosphereVTILMSLFGTKALGLFMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMS
Ga0268265_1077946813300028380Switchgrass RhizosphereVTILMSVFGTKVLGLLLLLQEAAASPETSSADHFTL
Ga0268265_1140352623300028380Switchgrass RhizosphereVTMLISLFGTKVLGLFMLLQEAAASPEASGADHFTLTEMVKNMGGVAI
Ga0307503_1079843213300028802SoilVTILTSLLGTKALGLLLFLQEAAASPEGGGGADHF
Ga0268240_1014205123300030496SoilVTMLMSLFGTKVIGLMLWLQDAAATGSPEAGTGDHFTLTEMVKNMGGVAIAVVIVLLIMSVYS
Ga0268259_1012993513300030499AgaveVTMLMSLFGTKFLSFMLLLQEAAAGTEATGADHFSLTGMIKSMGGVAIAV
Ga0308189_1033738423300031058SoilVTILTSLLGTKALGLLYFLQDAAAAPSPGTDTTNAFSMTEMFKHMGPVGL
Ga0310887_1012771723300031547SoilVTILTSLLGTKALGLLLFLQDAAASPEASGADHFTLTEMVKNMGGV
Ga0307468_10129400913300031740Hardwood Forest SoilVTILMSLFGTKVLGLFVLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVIVLLIMS
Ga0307468_10178605423300031740Hardwood Forest SoilVTILTSLLGTKALGLLIFLQDAAPGASPASATENTFTITEMVKNMGGVAIAVV
Ga0307413_1050909523300031824RhizosphereVTILISLFGTKALGLFMLLQEAAASPEASSADHFTLTEMVKNMGGVAIAVVI
Ga0310893_1043427513300031892SoilVTILTSLLGTKALGLLLFLQDAAASPEASGADHFT
Ga0310900_1117567523300031908SoilVTILTSLLGTKALGLLLFLQDAAASPEASGADHFTLTEMVKNMGGVAIA
Ga0310884_1079597323300031944SoilVTILTSIFLGFLMLLQEAAASPAASDADHFTLTEMVKNMGGVAIA
Ga0307479_1028571913300031962Hardwood Forest SoilVTILTSLLGTKAIGLLFMLQDAAAAPSPATDANTFTMSEMVKNMGPV
Ga0308176_1251050913300031996SoilVTILTSFLGLKALGLLLMFQDAAATPAADAGSQFTLTEMVKNMGGVAIAVVI
Ga0307416_10237052223300032002RhizosphereVTMLLSIFGTKALGLLMLLQEAAASPEASGAGDHFSLTEMVK
Ga0307411_1169131313300032005RhizosphereVTILTSLFGTKVFGLLLLLQEAAASPEASSADHFTLTEMVKNMGGVAIAV
Ga0310896_1049560213300032211SoilVTILTSLLGMKAFGLLMFLQEAAASPESSGADHFTLTEMVKNMGGVA
Ga0310810_1136910513300033412SoilVTILTSLFGAKALGLLLLLQEAAASPEASNANQFTLTEMVKNMGGV
Ga0314785_025257_374_5023300034479SoilMTILMSVFGTKVLGLLLLLQEAAASPEASSADHFTLTEMVKNM
Ga0314780_133323_2_1303300034659SoilMTILMSLMGTKVLGLLLLLQEAAASPEASSADHFTLTEMVKNM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.