NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042439

Metagenome / Metatranscriptome Family F042439

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042439
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 47 residues
Representative Sequence LSKVIAPGKKVVFSDEILQDPYPTYARLHEEGPLHYLDVGNKWAVWSI
Number of Associated Samples 123
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.57 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 90.51 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.709 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.291 % of family members)
Environment Ontology (ENVO) Unclassified
(29.747 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.595 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.74%    β-sheet: 21.05%    Coil/Unstructured: 59.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 158 Family Scaffolds
PF13924Lipocalin_5 60.76
PF00106adh_short 8.86
PF13561adh_short_C2 4.43
PF13193AMP-binding_C 4.43
PF00501AMP-binding 1.27
PF01261AP_endonuc_2 1.27
PF027373HCDH_N 1.27
PF00668Condensation 1.27
PF13614AAA_31 0.63
PF00535Glycos_transf_2 0.63
PF00296Bac_luciferase 0.63
PF07963N_methyl 0.63
PF01841Transglut_core 0.63
PF13185GAF_2 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 158 Family Scaffolds
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.27
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 1.27
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.27
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.27
COG1020EntF, seryl-AMP synthase component of non-ribosomal peptide synthetaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.27
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 1.27
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 1.27
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 1.27
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.71 %
UnclassifiedrootN/A13.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101632809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium thermoresistibile542Open in IMG/M
3300002245|JGIcombinedJ26739_101808558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae512Open in IMG/M
3300004082|Ga0062384_100040625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2180Open in IMG/M
3300004082|Ga0062384_100228329All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300004091|Ga0062387_101128611All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300004091|Ga0062387_101220328All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300004092|Ga0062389_100265398All Organisms → cellular organisms → Bacteria1756Open in IMG/M
3300004092|Ga0062389_100389223All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300004092|Ga0062389_104587079All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300004635|Ga0062388_100002838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7874Open in IMG/M
3300004635|Ga0062388_100281565All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300005541|Ga0070733_10394780All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300005541|Ga0070733_10759782All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300005610|Ga0070763_10988240All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005921|Ga0070766_11161574Not Available534Open in IMG/M
3300005952|Ga0080026_10071929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae933Open in IMG/M
3300005993|Ga0080027_10387109All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005995|Ga0066790_10403468All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300006176|Ga0070765_100748959All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300006176|Ga0070765_101381299All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300006176|Ga0070765_102246972All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006893|Ga0073928_10024280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6069Open in IMG/M
3300009525|Ga0116220_10086428All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300009624|Ga0116105_1016719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1522Open in IMG/M
3300009631|Ga0116115_1052055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1087Open in IMG/M
3300009644|Ga0116121_1102832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae896Open in IMG/M
3300009646|Ga0116132_1145124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae723Open in IMG/M
3300009826|Ga0123355_11995322All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300009839|Ga0116223_10043956All Organisms → cellular organisms → Bacteria2952Open in IMG/M
3300010339|Ga0074046_10647410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae623Open in IMG/M
3300010343|Ga0074044_10720513Not Available651Open in IMG/M
3300010361|Ga0126378_11903571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae677Open in IMG/M
3300010379|Ga0136449_103123571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae642Open in IMG/M
3300013307|Ga0157372_10314524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1823Open in IMG/M
3300014165|Ga0181523_10028370All Organisms → cellular organisms → Bacteria3625Open in IMG/M
3300014165|Ga0181523_10393460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae772Open in IMG/M
3300014167|Ga0181528_10337258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales818Open in IMG/M
3300014200|Ga0181526_10134791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1581Open in IMG/M
3300014200|Ga0181526_10857176Not Available572Open in IMG/M
3300014495|Ga0182015_10243897All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1188Open in IMG/M
3300014501|Ga0182024_10047827All Organisms → cellular organisms → Bacteria6849Open in IMG/M
3300014501|Ga0182024_10601857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1376Open in IMG/M
3300014638|Ga0181536_10201322All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae991Open in IMG/M
3300014657|Ga0181522_10321032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae920Open in IMG/M
3300014657|Ga0181522_10601209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae667Open in IMG/M
3300014657|Ga0181522_10896185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae547Open in IMG/M
3300014658|Ga0181519_10998164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300017926|Ga0187807_1335133Not Available507Open in IMG/M
3300017934|Ga0187803_10044925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1748Open in IMG/M
3300017934|Ga0187803_10334525Not Available607Open in IMG/M
3300017938|Ga0187854_10132559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1143Open in IMG/M
3300017940|Ga0187853_10282892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae754Open in IMG/M
3300017941|Ga0187850_10325258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae678Open in IMG/M
3300017970|Ga0187783_10473226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae909Open in IMG/M
3300017972|Ga0187781_10018788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4834Open in IMG/M
3300018007|Ga0187805_10137386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1110Open in IMG/M
3300018008|Ga0187888_1312811All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300018009|Ga0187884_10187849All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae857Open in IMG/M
3300018025|Ga0187885_10571562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae502Open in IMG/M
3300018026|Ga0187857_10577731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae501Open in IMG/M
3300018033|Ga0187867_10412436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae748Open in IMG/M
3300018034|Ga0187863_10747793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae553Open in IMG/M
3300018035|Ga0187875_10136937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1375Open in IMG/M
3300018040|Ga0187862_10556985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae683Open in IMG/M
3300018043|Ga0187887_10068286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2160Open in IMG/M
3300018043|Ga0187887_10146585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1414Open in IMG/M
3300018047|Ga0187859_10253939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae945Open in IMG/M
3300018047|Ga0187859_10742376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae560Open in IMG/M
3300018062|Ga0187784_10514450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales964Open in IMG/M
3300018062|Ga0187784_11680116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae503Open in IMG/M
3300018085|Ga0187772_11433465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae513Open in IMG/M
3300019082|Ga0187852_1227365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae761Open in IMG/M
3300020579|Ga0210407_10132144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1914Open in IMG/M
3300020580|Ga0210403_10451981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1047Open in IMG/M
3300021088|Ga0210404_10060380All Organisms → cellular organisms → Bacteria1814Open in IMG/M
3300021170|Ga0210400_10124960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales2056Open in IMG/M
3300021181|Ga0210388_10498583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1069Open in IMG/M
3300021402|Ga0210385_10272276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1249Open in IMG/M
3300021402|Ga0210385_10942675All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300021403|Ga0210397_11203838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae589Open in IMG/M
3300021405|Ga0210387_10596050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales982Open in IMG/M
3300021405|Ga0210387_10966707All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae747Open in IMG/M
3300021407|Ga0210383_10471751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1083Open in IMG/M
3300021407|Ga0210383_11614745Not Available533Open in IMG/M
3300021474|Ga0210390_10286873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1394Open in IMG/M
3300021474|Ga0210390_10398398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella1163Open in IMG/M
3300021474|Ga0210390_10755305Not Available808Open in IMG/M
3300021477|Ga0210398_10039164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales3934Open in IMG/M
3300021478|Ga0210402_11993958Not Available506Open in IMG/M
3300021478|Ga0210402_12037387All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae500Open in IMG/M
3300021479|Ga0210410_11411347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae589Open in IMG/M
3300022713|Ga0242677_1075266Not Available536Open in IMG/M
3300024225|Ga0224572_1087456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae575Open in IMG/M
3300024271|Ga0224564_1017862Not Available1267Open in IMG/M
3300025419|Ga0208036_1052133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae694Open in IMG/M
3300025477|Ga0208192_1054479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae787Open in IMG/M
3300025498|Ga0208819_1048767All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae989Open in IMG/M
3300026215|Ga0209849_1083106Not Available565Open in IMG/M
3300026467|Ga0257154_1084776Not Available507Open in IMG/M
3300027117|Ga0209732_1018724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1171Open in IMG/M
3300027173|Ga0208097_1013203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae908Open in IMG/M
3300027432|Ga0209421_1093159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae614Open in IMG/M
3300027767|Ga0209655_10096344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae984Open in IMG/M
3300027853|Ga0209274_10753217Not Available502Open in IMG/M
3300027855|Ga0209693_10202316All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae977Open in IMG/M
3300027867|Ga0209167_10257291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales938Open in IMG/M
3300027879|Ga0209169_10116384All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300027879|Ga0209169_10479791Not Available653Open in IMG/M
3300027884|Ga0209275_10347254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae831Open in IMG/M
3300027889|Ga0209380_10770985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae547Open in IMG/M
3300027895|Ga0209624_10349325All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes986Open in IMG/M
3300027895|Ga0209624_11006727All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae540Open in IMG/M
3300027905|Ga0209415_10150204Not Available2344Open in IMG/M
3300027905|Ga0209415_10552058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae869Open in IMG/M
3300027905|Ga0209415_10567113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae852Open in IMG/M
3300027908|Ga0209006_10007911All Organisms → cellular organisms → Bacteria9596Open in IMG/M
3300027908|Ga0209006_10081429All Organisms → cellular organisms → Bacteria2880Open in IMG/M
3300027908|Ga0209006_10351631Not Available1248Open in IMG/M
3300028776|Ga0302303_10242998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae615Open in IMG/M
3300028863|Ga0302218_10152699All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae732Open in IMG/M
3300028906|Ga0308309_10070198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2609Open in IMG/M
3300028906|Ga0308309_10595847All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300028909|Ga0302200_10323438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae733Open in IMG/M
3300029817|Ga0247275_1167264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae546Open in IMG/M
3300029911|Ga0311361_11504086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae507Open in IMG/M
3300029939|Ga0311328_10470633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae888Open in IMG/M
3300029943|Ga0311340_10647073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae915Open in IMG/M
3300029943|Ga0311340_11120257Not Available638Open in IMG/M
3300029945|Ga0311330_10537982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae932Open in IMG/M
3300030020|Ga0311344_11393938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae515Open in IMG/M
3300030041|Ga0302274_10204473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae972Open in IMG/M
3300030044|Ga0302281_10234104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae756Open in IMG/M
3300030053|Ga0302177_10162972All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300030054|Ga0302182_10111729All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300030057|Ga0302176_10412402Not Available545Open in IMG/M
3300030509|Ga0302183_10434869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae501Open in IMG/M
3300030618|Ga0311354_10814936Not Available879Open in IMG/M
3300030646|Ga0302316_10224794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae767Open in IMG/M
3300030688|Ga0311345_10619490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales893Open in IMG/M
3300030707|Ga0310038_10382391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae616Open in IMG/M
3300030862|Ga0265753_1118819Not Available553Open in IMG/M
3300031057|Ga0170834_100633329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae560Open in IMG/M
3300031128|Ga0170823_14510756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae785Open in IMG/M
3300031231|Ga0170824_114346152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1431Open in IMG/M
3300031233|Ga0302307_10120378All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300031233|Ga0302307_10295366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae829Open in IMG/M
3300031261|Ga0302140_10723380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae723Open in IMG/M
3300031708|Ga0310686_104672588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1178Open in IMG/M
3300031718|Ga0307474_10117177All Organisms → cellular organisms → Bacteria1997Open in IMG/M
3300031718|Ga0307474_10415068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales1049Open in IMG/M
3300031962|Ga0307479_11698132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae585Open in IMG/M
3300032119|Ga0316051_1022498All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae586Open in IMG/M
3300032805|Ga0335078_12285479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae567Open in IMG/M
3300032898|Ga0335072_10196846All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2395Open in IMG/M
3300032898|Ga0335072_10974891All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300032954|Ga0335083_10370991Not Available1232Open in IMG/M
3300033983|Ga0371488_0465641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae576Open in IMG/M
3300034163|Ga0370515_0071764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1507Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.29%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.13%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil8.23%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.59%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil6.33%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.33%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.06%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.43%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.43%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.16%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.53%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.90%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.27%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.27%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.63%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.63%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.63%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.63%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.63%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.63%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.63%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027173Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032119Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10163280913300002245Forest SoilMVDAPGRKTVFSDEVLQDPYPTYARLHEEGPLHFVDVGSKWAV
JGIcombinedJ26739_10180855813300002245Forest SoilVKAIAPGKKVVFSDEILQDPYSTYTRLLEEGPLHYVDVGSKWAVWSVFSHAECSLIAKDPRCSAK
Ga0062384_10004062513300004082Bog Forest SoilLPKVIVPTKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWALWSIVSHAECSS
Ga0062384_10022832913300004082Bog Forest SoilLSKVIAPDKKTVFSDEVRQDPYPTYARLHEEGPLHYLDVDGK
Ga0062387_10112861113300004091Bog Forest SoilLAKPPVTSERKVVFSDEILQDPYPTYARMLEEGPLHFVDMGGQWAVWAVFGHAECS
Ga0062387_10122032823300004091Bog Forest SoilLPNVSPQGRKIVFSGEVLQDPYPTYAHLHREGPLHYLDVGGNGAAAWAIFN
Ga0062389_10026539833300004092Bog Forest SoilLSKMGATGKKVLFSDEILQDPYPTYARMHEEGPLHYVEVAGKWAVWSIFS
Ga0062389_10038922333300004092Bog Forest SoilLAKVIVPKKKILFTDEILQDPYPAYARLHEEGPLHYLDVDGKWA
Ga0062389_10458707923300004092Bog Forest SoilLSQINAPGKKVVFSDEILQDPYPTYARMHEEGPLHYVDVGSKWAVWSIFSHAECSSIAKD
Ga0062388_10000283883300004635Bog Forest SoilLPKVIVPKKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWA
Ga0062388_10028156533300004635Bog Forest SoilLAKVIVPKKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWA
Ga0070733_1039478033300005541Surface SoilLSKASAPGKKVVFSDEILQDPYPTYARMHEEGPLHYVEVADKWAVWS
Ga0070733_1075978213300005541Surface SoilMVIASGKKIVFSDEIVQDPYPTYARMHEEGPLHYVEVASKWAV
Ga0070763_1098824023300005610SoilLSIAPDKKVVFNDEVLQDPYPTYTRLLEEGPLHYVHVGSKWAVWSVFGH
Ga0070766_1116157423300005921SoilLTKVIAPVVFSDEIQQDPYPTYARLHETGSVHYLDVGSKWAVWSIVSHAECSSIAKDPR
Ga0080026_1007192913300005952Permafrost SoilMVTVPAKKVVFSDEVVQNPYPTYARMHEEGPLHYVEVASKWAVWSIFSHPEC
Ga0080027_1038710923300005993Prmafrost SoilLSEVTGPVKKVLFSDEILQDPYPAYARLHEEGPLHYVDVGKWAVWSIFSHAECSSIAKDP
Ga0066790_1040346823300005995SoilVSKDIASVKKAVFSDEILQDPYPTYARLHEEGPLHYVEVGKWAV
Ga0070765_10074895913300006176SoilLFKITAAGKKVVFSDEILQDPYPTYARMHEEGPLHYVDVDGKWAVWAIFSHAECSSI
Ga0070765_10138129923300006176SoilLPKVIVPKKKVLFTDEILQDPYPAYACLHEEGPLHYLDVDGKWALWSI
Ga0070765_10224697223300006176SoilVKVLKATAPRKKEVFSDETLQDPYPTYTRLLEEGPLHYVDAGSKWAVWSVFSHAECSSIAKDP
Ga0073928_1002428073300006893Iron-Sulfur Acid SpringMVTAPDKKVVFSDEILQDPYPTYARMHEEGPLHYVDVGSKWAVWSIFSH
Ga0116220_1008642833300009525Peatlands SoilMDSAPTRKLLFSDEILQDPYPTYARLHEEGPLHYVQVGSKWAVWSIFS
Ga0116105_101671913300009624PeatlandLSNVSGLGKKVVFSDEILQDPYPTYARMHEEGPLHYVDA
Ga0116115_105205533300009631PeatlandLSNVSAPGKKILFGDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSVFS
Ga0116121_110283233300009644PeatlandLPNVIAPDKKVVFSDEILQDPYPTYARMHEEGPLH
Ga0116132_114512423300009646PeatlandLSNVSAPGKKILFSDEILQDPYPTYARLHEEGPLHYVDVG
Ga0123355_1199532223300009826Termite GutLPSLIAPERKALFTDEVLEDPYPTYARMHREGPIHYVEVAGKWAVWSIFS
Ga0116223_1004395613300009839Peatlands SoilLSQLIAKNKKVLFSDEILQDPYPTYARLHEEGPLHYVEVAGKWAVWSIFSHAECSSI
Ga0074046_1064741023300010339Bog Forest SoilLSKVIAPDKKNIFSDEILQDPYPTYARLHEEGPLHYLAVGRDMGVWSIFSHAEI
Ga0074044_1072051313300010343Bog Forest SoilVLSKVTIPDKKILFSEEILQNPYPAYARLHEEGPLH
Ga0126378_1190357113300010361Tropical Forest SoilVNVSASNKKIVFSDETLQDPYPTYTRLLEEGPLHYVDVGSNWPV
Ga0136449_10312357113300010379Peatlands SoilLSNVSAPGKKVVFSDAILQDPYPTYARMHEEGPLHF
Ga0157372_1031452443300013307Corn RhizosphereVKAIGPVKKAVFDDKVLQDPYPTYARLLEDGALHYVDVGSKWAVWSLFGH
Ga0181523_1002837043300014165BogLSKVIAPVKKVLFSDEILQDPYPTYARMHEEGPLHYVNVGSKWAVWSVFSHAECS
Ga0181523_1039346013300014165BogLSKVCAPVKKVLFSDEILQDPYPTYARLHEEGPLHYVDVGSKW
Ga0181528_1033725813300014167BogLIEGGRLSIALGKKVVFSDEILQDPYPTYARMHEEGPLHY
Ga0181526_1013479113300014200BogLSEIVSPSKKVVFTSEILQNPYPTYARLLEEGPLHYIDVGGQWAVWSVVSHADCSSIA
Ga0181526_1085717623300014200BogLSNVSGLGKKVVFSDEILQDPYPTYARMHEEGPLHYVDAGGKWAVWAIFSHA
Ga0182015_1024389723300014495PalsaMVIASGKKVVFSDEILQDPYPTYARLHEEGPLHYLDVGS
Ga0182024_1004782713300014501PermafrostLSIAPQRKIVFSDEIPQDPYPTYARLHEEGPLHYLDVGSKWAVWSIV
Ga0182024_1060185733300014501PermafrostLSKVTGPSKKVVFSDEILQDPYPTYARLHEEGPLHYLDVGSKWAVWSIISHAECSSIA
Ga0181536_1020132233300014638BogLSNVSAPGKKILFSDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSVFS
Ga0181522_1032103233300014657BogVSIASVKKAVFSDEILQDPYPTYARLHEEGPLHYIEVG
Ga0181522_1060120923300014657BogMDKKVLFNDAILADPYPTYARLHEEGPIHYLDVGGKWAVWSVFSHGECSSIAKDPR
Ga0181522_1089618513300014657BogLSKVIARDKKVVFNDEVLQDPYPTYARLHEEGPLHHLEV
Ga0181519_1099816413300014658BogLSKLTANEKKILFSDEILQDPYPTYARLHEEGPLHYVEVGGKWAVWSI
Ga0187807_133513323300017926Freshwater SedimentLSKATAPPIKVVFSDEFLQDPYPTYARLHEEGPLHFLDVGSKWGVWSIVSHAECSSIA
Ga0187803_1004492533300017934Freshwater SedimentLSKVTAPVKKVVFNDEILQDPYPTYARLHEEGPLHHLDVGSKFAVWSIISHA
Ga0187803_1033452513300017934Freshwater SedimentLSKVTAPVKKVVFSDEIRQDPYPTYARLHEEGPLHHLDVGSKFAVWSIISHA
Ga0187854_1013255913300017938PeatlandLSKVGAPVKKVLFSDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSVFSHAECSSI
Ga0187853_1028289223300017940PeatlandLSNVSAPGKKVVFNDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSIFSHAECS
Ga0187850_1032525823300017941PeatlandMVDAPDRKVVFSDDVLQDPYPTYARLHEEGPLHFLDVGKWAVWSIFSHAE
Ga0187783_1047322613300017970Tropical PeatlandLSKVIAPDRKVVFSDEVLQNPYPTYARMHEEGPLHYLDVG
Ga0187781_1001878813300017972Tropical PeatlandVNVIAPSKKEIFSDEILQDPYPTYTRLLEEGPLHYVDVGSKWAVWSVFSHAE
Ga0187805_1013738613300018007Freshwater SedimentMALKTVAPVVFNDETLQDPYPTYARLLEEGPLHYVDVGSKWP
Ga0187888_131281123300018008PeatlandDAPDRKVVFSDDVLQDPYPTYARLHEEGPLHFLDVGKWAVWSIFSHAECA
Ga0187884_1018784933300018009PeatlandLSKVGAPVKKVLFSDEILQDPYPTYARLHEEGPLHYVD
Ga0187885_1057156213300018025PeatlandVKVIAPSKKFLFSDEILQDPYPTYARMLEEGPLHYV
Ga0187857_1057773123300018026PeatlandLSKVCAPVKKVLFSDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSVFSH
Ga0187867_1041243623300018033PeatlandLAIAPGKKVVFSDEILQNPYPTYALLHKEGPLHYLDVGNKWAVWSIFS
Ga0187863_1074779313300018034PeatlandLSKVGAPVKKVLFSDEILQDPYPTYARLHEEGPLHYVDVGSKW
Ga0187875_1013693733300018035PeatlandLSKVIAPVKKVLFSDEILQDPYPTYARMHEEGPLHYVNVGSKW
Ga0187862_1055698513300018040PeatlandLSKVIAPVKKVLFSDEILQDPYPTYARMHEEGPLHYVNVGSKWAVWSV
Ga0187887_1006828613300018043PeatlandLSKVIAPVKKVLFSDEILQDPYPTYARMHEEGPLHYV
Ga0187887_1014658533300018043PeatlandLSNVSGLGKKVVFSDEILQDPYPTYARMYEEGPLHYVDAGGKWAVWAIFS
Ga0187859_1025393913300018047PeatlandLPKVIVPTKKVLFTDEILQDPYPAYARLHEEGPLHYL
Ga0187859_1074237623300018047PeatlandLSKVTARDKKVVFNNEILQDPYPTYARMHEEGPLHFVDVGSKWAVWSIFS
Ga0187784_1051445033300018062Tropical PeatlandLKAIAPAKKVVFNDEILQDPYPTYTRLLEEAPLHYV
Ga0187784_1168011623300018062Tropical PeatlandMVIAPDKKVVFSNEVLQDPYPTYARLHEEGPLHYLAVGSEMAAWAIISHAEISA
Ga0187772_1143346523300018085Tropical PeatlandVNVSAPSKRVVFSDEALQDPYPTYSRLLDEGPLHYVDVGSKW
Ga0187852_122736513300019082PeatlandLSNVSAPGKKILFSDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSVFSH
Ga0210407_1013214443300020579SoilLSKAIAPGKKTLFSDEILQDPYPTYARLHEEGPLHYVDAGSKWSVWSIFSHAECASI
Ga0210403_1045198113300020580SoilLSKVIVPPKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWALWSIVSLAECSSAA
Ga0210404_1006038013300021088SoilLSKVIAPGKKTLFSDEILQDPYPTYARLHEEGPLHYVDAGSKW
Ga0210400_1012496013300021170SoilLSKEIVSGKKVVFSDEILQDPYPTYARMHEEGPLHYVDVGSKWAVWSV
Ga0210388_1049858333300021181SoilVKVLKATAPRKKEVFSDETLQDPYPTYTRLLEEGPLHYVD
Ga0210385_1027227613300021402SoilLKTIAPSKKVVFSDETLQDPYPTYTRLLEEGPLHYVDVGSKWAVWS
Ga0210385_1094267513300021402SoilMPPIGSERKVVFSDEVLQDPYPTYARMLEEGPLHFVD
Ga0210397_1120383823300021403SoilVSKDIASVKKAVFSDEILQDPYPTYARLHEEGPLHYVEVGKWAVWSIFSHAE
Ga0210387_1059605013300021405SoilVSKDIASVKKAVFSDEILQDPYPTYARLHEEGPLHYVEVGKWAVWSI
Ga0210387_1096670723300021405SoilMVTAPDKKVVFSDEILQDPYPTYARMHEEGPLHYVDVGSKWAVW
Ga0210383_1047175113300021407SoilLPKVIVPKKKVLFTDEILQDPYPAYARLHEEGPLHYLDV
Ga0210383_1161474513300021407SoilLSKVIAASKKTVFSDEILQDPYPTYARMHEEGPLHYVDVGKWAVWSVFSHAECSAIAKDP
Ga0210390_1028687333300021474SoilVSIASVKKAVFSDEILQDPYPTYARLHEEGPLHYIEV
Ga0210390_1039839833300021474SoilLSKVIVPPKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWALWSMVSH
Ga0210390_1075530513300021474SoilMVTAPAKKVVFSDEVVQNPYPTYGRMHEEGPLHYVEVASKWAVSS
Ga0210398_1003916413300021477SoilLSKVIVPPKKVLFTDEILQDPYPAYARLHEEGPLHYLDVD
Ga0210402_1199395823300021478SoilLPKVIVPPKKAIFSDEILQDPYPTYARLHQEGPLHYLDVDGKWALWSIISHAECSSAAKD
Ga0210402_1203738713300021478SoilLSIALGKTVVFSNEILQNPYPTYARLHEEGPLHYLDVGNKWAVWSIFSHAECSS
Ga0210410_1141134723300021479SoilMVTAPDKKVVFSDEILQDPYPTYARMHEKGPLHYVDVGSKWAVWSIF
Ga0242677_107526613300022713SoilMVTAPAKKVVFSDEVVQNPYPTYARMHEEGPLHYVEVASKWAVWSI
Ga0224572_108745623300024225RhizosphereMVDAPDRKTVFSDEVLQDPYPTYARLHEEGPLHFVDVGSKWAVWSIFS
Ga0224564_101786223300024271SoilLSKVIAPGRKVVFSDEILQDPYPTYSRMHEEGPLHYLDVGGKWAVWSIFSH
Ga0208036_105213323300025419PeatlandLSKVGAPVKKVLFSDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSIFSHAECSSVA
Ga0208192_105447913300025477PeatlandLSKVGAPVKKVLFSDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSIFSHAECSS
Ga0208819_104876713300025498PeatlandLSNVSAPGKKILFSDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSVFSHAECSSIA
Ga0209849_108310613300026215SoilLAKPPLASERKIVFSDEVLQDPYPTYARMLEEGPLHFVDM
Ga0257154_108477623300026467SoilLSKVIAPVKKILFSDEIVQDPYPTYARMHEEGPLHYVEVANK
Ga0209732_101872423300027117Forest SoilMVIASGKKVVFSDEILQDPYPTYARLHEEGPLHYLDVGSKWAVWSIVSHA
Ga0208097_101320333300027173Forest SoilLSIAPKGSIVFNDEVLQNPYPTYARLHEEGPLHYLDVG
Ga0209421_109315923300027432Forest SoilLSNVGAPGKKVVFSDAILQDPYPTYARMHEEGPLH
Ga0209655_1009634413300027767Bog Forest SoilVIAPDKKTVFSDEVRQDPYPTYARLHEEGPLHYLDVDGK
Ga0209274_1075321723300027853SoilLSKVIAPDRKVVFSDEVLQNPYPTYARMHEEGPLHYLDVGSKWAVWSVIGHAECSS
Ga0209693_1020231623300027855SoilLPKVIVPTKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWALWSI
Ga0209167_1025729133300027867Surface SoilLSKASAPGKKVVFSDEILQDPYPTYARMHEEGPLHYVEVADKWAVWSIFSHA
Ga0209169_1011638413300027879SoilLSTAPGEKIVFSGEVLQDPYPTYARLHKEGPLHYLDIGSKWP
Ga0209169_1047979113300027879SoilMDSAPTRKLLFSDEILQDPYPTYARLHEEGPLHYVQV
Ga0209275_1034725423300027884SoilMVIASGKKVVFSDETLQDPYPTYTRLLDEGPLHYVDVGSKWAVWSVFSHAECSL
Ga0209380_1077098513300027889SoilVSIASVKKAVFSDETLQDPYPAYARLHEEGPLHLVEVGKWAVWSIFSHAECAAIAKDPRL
Ga0209624_1034932523300027895Forest SoilLSKVIAPGKKIVFSDEVLQDPYPTYARMHEEGPLHYVD
Ga0209624_1100672723300027895Forest SoilLPKVIVPKKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWALW
Ga0209415_1015020413300027905Peatlands SoilLSKVIAPVKKVLFSDEIVQDPYPTYARMHEEGPLHYVEVANKWA
Ga0209415_1055205813300027905Peatlands SoilVSNVGAPVKRAIFSGESLQNPYPMYARMHEEGPLHYVEAGN
Ga0209415_1056711323300027905Peatlands SoilVSNVGAPVKRSIFSGESLQNPYPMYARMHEEGPLHYVEAGN
Ga0209006_1000791113300027908Forest SoilLAKVIAPKKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWALWSIVSHAEC
Ga0209006_1008142943300027908Forest SoilLSKVIVPKKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWALWSIVSHAEC
Ga0209006_1035163113300027908Forest SoilLSKDIAAGKKVLFSDEILQDPYPTYARLHEGGPLHYVDVGGKWAVWSVFSHA
Ga0302303_1024299813300028776PalsaLSKVIAQAKKAIFTEEILQDPYPTYSRLHEEGPLHYVDVGGKWAVWSVFSHA
Ga0302218_1015269913300028863PalsaMVDAPGRKVVFSDEVLQDPYPTYARLHEEGPLHFLDV
Ga0308309_1007019813300028906SoilLSKVISSGNEFVFNDEILQNPYPTYARLHQEGPLHYLEVGSKWPVWSIVSH
Ga0308309_1059584713300028906SoilLFKITAAGKKVVFSDEILQDPYPTYARMHEEGPLHYVDVGSKWAVWSIF
Ga0302200_1032343813300028909BogMDKPPTRKLLFSDEILQDPYPTYARLHEEGPLHYVQVGEKWA
Ga0247275_116726423300029817SoilLSNVSAPGKKVVFNDEILQDPYPTYARLLEEGPLHYVDVGSKWAVWSVFSHAE
Ga0311361_1150408623300029911BogVKVISPSKKEVFSDEILQDPYPTYTRLLEEGPLHYVDVGSKWAVW
Ga0311328_1047063313300029939BogMATAPTRKLLFSDEILQDPYPTYARLHEEGPLHYVQVGAKWAVWSIFSYAECSSIA
Ga0311340_1064707313300029943PalsaLSKVIAQAKKAIFTDEILQDPYPTYARLHEEGPLHYVDVGGKWA
Ga0311340_1112025723300029943PalsaLSKLIVPDKKVVFSDEILQDPYPIYAHLHEEGPLHYLDVGNKWAVWSIFSHAE
Ga0311330_1053798213300029945BogMVDAPDRKVVFSDDVLQDPYPTYARLHEEGPLHFLDVGKWAVWSIFSHAECASIA
Ga0311344_1139393813300030020BogLSIALGKKVVFSDEILQDPYPTYARLHEEGPLHYLDMGN
Ga0302274_1020447313300030041BogMDKPPTRKLLFSDEILQDPYPTYARLHEEGPLHYVQVGEKWAV
Ga0302281_1023410423300030044FenMVDAPDRKVVFSDDVLQDPYPTYARLHEEGPLHFLDVG
Ga0302177_1016297233300030053PalsaLPKGIAPDKKLVFTDEILQDPYPTYARLHEEGPLHYLDVGSKW
Ga0302182_1011172933300030054PalsaLPKGIAPDKKLVFTDEILQDPYPTYARLHEEGPLHYLDVGSKWAVWSIISH
Ga0302176_1041240213300030057PalsaLSKLIVPDKKVVFSDEILQDPYPIYAHLHEEGPLHYLDVGNKWAVWSI
Ga0302183_1043486913300030509PalsaLSKVIAPGKKVVFSDEILQDPYPTYARLHEEGPLHYLDVGNKWAVWSI
Ga0311354_1081493613300030618PalsaLAKPPLASERKIVFSDEVLQDPYPTYARMLEEGPLHFV
Ga0302316_1022479423300030646PalsaLPKGIAPDKKLVFTDEILQDPYPTYARLHEEGPLHYLDVGSKWAG
Ga0311345_1061949013300030688BogVIEGGRLSIALGKKVVFSDEILQDPYPTYARLHEEGPLH
Ga0310038_1038239123300030707Peatlands SoilVSNVGAPVKRSIFSGESLQNPYPMYARMHEEGPLHYVEAGNKWGVWAIFS
Ga0265753_111881913300030862SoilVFSDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSIFSHAEC
Ga0170834_10063332913300031057Forest SoilMVIASGKKVVFSDETLQDPYPTYTRLLDEGPLHYVDVGSKWAVWSVFS
Ga0170823_1451075613300031128Forest SoilLSKASAPDKKVVFDDEVHQDPYPTYARLHREGPLHYLHVGSKWAVWSLV
Ga0170824_11434615223300031231Forest SoilLSKASAPDKKVVFDDEVHQDPYPTYARLHREGPLHYLHVGSKWAVWSLVSHA
Ga0302307_1012037813300031233PalsaLPKGIAPDKKLVFTDEILQDPYPTYARLHEEGPLHYLDVGSKWAVWSIISHAE
Ga0302307_1029536613300031233PalsaLSKVIAPGKKVVFSDEILQDPYPTYTRLHEEGPLHYLDVGNKWAVWSI
Ga0302140_1072338023300031261BogMVDAPDRKALFSDDVLQDPYPTYARLHEEGPLHFLDVGKWAVWS
Ga0310686_10467258833300031708SoilVKVIPPKKKVVFSDEILQDPYPTYARLHEEGPLHYVDVGSKWAVWSIFSHAECSSIAKD
Ga0307474_1011717713300031718Hardwood Forest SoilMVTAPAKKVVFSDEVVQNPYPTYARMHEEGPLHYVEVASKWA
Ga0307474_1041506833300031718Hardwood Forest SoilLSKVIVPRKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWALWSIVSHA
Ga0307479_1169813213300031962Hardwood Forest SoilLSKVIVPRKKVLFTDEILQDPYPAYARLHEEGPLHYLD
Ga0316051_102249813300032119SoilLPKVIVPKKKVLFTDEILQDPYPAYARLHEEGPLHYLDVDGKWALWSIVSHAECSS
Ga0335078_1228547913300032805SoilVNVSAPGKKIVFSEETLQDPYPTYTRLLEEGPLHYVDVGSNWPVWSVFSHNE
Ga0335072_1019684653300032898SoilLSKAIAGGQKSIFSDEIRQNPYPTYARLHEEGPLHYLDAGGKWGVWSIFSHSECASIAKDPRL
Ga0335072_1097489123300032898SoilLPKLSTAQKKVVFSDDILQDPYPTYARLHEEGPLHYIDVGGKWAVW
Ga0335083_1037099113300032954SoilLSKVTAGGQKFIFSDEIRQDPYPTYARLHEEGPLH
Ga0371488_0465641_472_5763300033983Peat SoilMSKDIAAGKKVVFTDEILQDPYSTYARLHEEGPLH
Ga0370515_0071764_2_1123300034163Untreated Peat SoilMSNPNAVDKKVLFNDAILANPYPTYARLHEEGPLHYL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.