 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F042334 |
| Family Type | Metagenome |
| Number of Sequences | 158 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MIDEIKKLDKTELFKPKPKKKISIIDKILKILGYGKKR |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 62.50 % |
| % of genes near scaffold ends (potentially truncated) | 19.62 % |
| % of genes from short scaffolds (< 2000 bps) | 70.25 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (84.177 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (15.823 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.329 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.494 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF07432 | Hc1 | 23.42 |
| PF02086 | MethyltransfD12 | 10.13 |
| PF02357 | NusG | 4.43 |
| PF00004 | AAA | 1.90 |
| PF04545 | Sigma70_r4 | 1.27 |
| PF00574 | CLP_protease | 1.27 |
| PF00085 | Thioredoxin | 1.27 |
| PF13385 | Laminin_G_3 | 0.63 |
| PF01510 | Amidase_2 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 10.13 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 10.13 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 4.43 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.53 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 2.53 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 84.18 % |
| All Organisms | root | All Organisms | 15.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.82% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 15.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.70% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.70% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.70% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.80% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.90% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.63% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.63% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.63% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.63% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.63% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.63% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.63% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
| 3300001948 | Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009694 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG | Engineered | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020490 | Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020491 | Freshwater microbial communities from Lake Mendota, WI - 19JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020522 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027221 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM35_10875072 | 3300001844 | Marine Plankton | MKTIEEIKRLDKKEMFKPKPKNKISIISKILIILGYGKKR* |
| GOS2228_10236193 | 3300001948 | Marine | MIDEVMSLDKSKIFVPKPKKKVSFWNKMLIILGYGKKG* |
| B570J29032_1087652803 | 3300002408 | Freshwater | IDEIKKINKEELFKPKKKVSIIDKLLKILGYGKKG* |
| B570J40625_1008390061 | 3300002835 | Freshwater | HKNQTIQDLKKLDKNKMFVPKPKNKVSIISKLLTILGYGKKR* |
| JGI25921J50272_100021141 | 3300003430 | Freshwater Lake | KEKMIKEIKSLDKTKMFEKPEKPKISLFKKILLILGYGKKG* |
| Ga0007842_10015495 | 3300003798 | Freshwater | MKMIDEIKSLDKDKLFVQEQKNKVSIIDKLLKIFGYGKKR* |
| Ga0065166_101427301 | 3300004112 | Freshwater Lake | IQKKRMIDEIRKINKDELFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0049083_100503462 | 3300005580 | Freshwater Lentic | LIKELKQLDKSEMFKPEIKKKISIIDKILKILGYGKKR* |
| Ga0049083_101444282 | 3300005580 | Freshwater Lentic | MIDEVKSLDKNKMFQPKPKKRVSIIDKILKILGHGKKR* |
| Ga0049081_100426345 | 3300005581 | Freshwater Lentic | MIEEIKKLNKTDLFKPEKKVSIIDKILKILGYGKKR* |
| Ga0049080_100094165 | 3300005582 | Freshwater Lentic | MIDEVKSFDKSKIFVKKQKNKVSIIDKLLMIFGYGKKR* |
| Ga0049082_102292663 | 3300005584 | Freshwater Lentic | MIDEVKKINKDELFKPKKKVSIVDKLLKILGYGKKR* |
| Ga0078894_100160847 | 3300005662 | Freshwater Lake | MIEEVKKINKDELFKPKRKVSIIEKILKILGYGKKR* |
| Ga0078894_101402745 | 3300005662 | Freshwater Lake | MIDEIRKINKDELFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0078894_110350773 | 3300005662 | Freshwater Lake | MIKEIKSLDKTKMFEKPEKPKISLFKKILLILGYGKK |
| Ga0007876_11495152 | 3300006071 | Freshwater | MIEEIKKLDKSKIFQKEKISLWNKILKILGYDRKKG*YIKSVSND |
| Ga0070744_100490612 | 3300006484 | Estuarine | MIDEIKSLDKNKMFLEKPKKKVSIWDKVLIILGYGKKR* |
| Ga0070744_100751453 | 3300006484 | Estuarine | MIDEIKKINKDELFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0102861_10765831 | 3300007544 | Estuarine | MIEEIKNLDKTELFKPKPKKKISIIDKILKILGYGKKR* |
| Ga0102873_10062013 | 3300007545 | Estuarine | MIDEIKKINKEELFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0102874_12169441 | 3300007546 | Estuarine | MINEIKKINKEELFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0102880_11545893 | 3300007550 | Estuarine | EEIKKLDKTELFKPKPKKKISIIDKILKILGYGKKR* |
| Ga0102817_10421793 | 3300007555 | Estuarine | MIEEIKKLDKKKMFEEKPKNKVSIIDKVLKILGYGKKR* |
| Ga0102828_11862262 | 3300007559 | Estuarine | MIEEIKRIDRKKLFEEKPKNKISIMDKILKILGYGKKG* |
| Ga0102915_11202933 | 3300007562 | Estuarine | MIEEIKNLDKTKLFKPKPKKKISIIDKILKILGYGKKR* |
| Ga0102918_10222496 | 3300007593 | Estuarine | MIDEVKSLDKSKIFVPKPKKKVSFWNKMLIILGYGKKG* |
| Ga0102896_10675735 | 3300007618 | Estuarine | MIEEIKNLNKTEYIKPKPKKKISIIDKILKILGYGKKR* |
| Ga0102896_11459052 | 3300007618 | Estuarine | MIDEVKSLDKNKMFQPKPKKKVSIIDKILKILGHGKKR* |
| Ga0102872_10254712 | 3300007621 | Estuarine | MINEIKKINKEELFKPKKKVSIIHKLLKILGYGKKR* |
| Ga0102878_10759203 | 3300007624 | Estuarine | MIEEIKNLNKTELLKPKPKKKISIIDKILKILGYGKKR* |
| Ga0102870_11287423 | 3300007625 | Estuarine | MIEEIKNLDKTELFKPKTKKKISIIDKILKILGYGKKR* |
| Ga0102894_10112686 | 3300007632 | Estuarine | MIDEIKKINKEELFKPKKKVSIIDKLLKILGYGKKG* |
| Ga0102865_11134102 | 3300007639 | Estuarine | MIEEVKKINKDELFKPKKKVSIVDKLLKILGYGKKR* |
| Ga0102900_11108472 | 3300007651 | Estuarine | MIEEVKKLDKKEIFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0105736_10523461 | 3300007861 | Estuary Water | MIDEIKSLDKNKMFQPKPKKRVSIIDKILKILGHGKKR* |
| Ga0105736_10699242 | 3300007861 | Estuary Water | MIEEIKSLNKEEIFKLKPKNKVSIIDKILKILGYGKKR* |
| Ga0105745_12058702 | 3300007972 | Estuary Water | MIDEVKSLDKSKIFVPKPKKKVSFWNKMLIILGYGK |
| Ga0105746_10362824 | 3300007973 | Estuary Water | MIEDIKKLDKGKMFKEKPKKKVSIIDKLLKILGYGKKR* |
| Ga0105746_12127932 | 3300007973 | Estuary Water | MIDEVKTFDKSKIFVEKQKNKVSIIDKLLMIFGYGKKR* |
| Ga0105747_10838821 | 3300007974 | Estuary Water | EEIKNLDKTELFKPKPKKKISIIDKILKILGYGKKR* |
| Ga0114340_10254476 | 3300008107 | Freshwater, Plankton | MIKEIKSLDKMKMFEKPEKPKISLFKKILLILGYGKKG* |
| Ga0114343_10206648 | 3300008110 | Freshwater, Plankton | MINEIKSFDKKEMFVPKPKNKISIIDKILKILGYGKKR* |
| Ga0114343_11390843 | 3300008110 | Freshwater, Plankton | MIDEIKSLDKNKMFQPKPKKKVSIIDKILKILGHGKKR* |
| Ga0114343_11724643 | 3300008110 | Freshwater, Plankton | MIDEIKSLDKNKIFVEKPKKKISIWNKILIIFGYGKKG* |
| Ga0114344_11502323 | 3300008111 | Freshwater, Plankton | MIKEIKSLDKTKMFEKPEKPKISLFKKILLILGYGKKG* |
| Ga0114346_11615272 | 3300008113 | Freshwater, Plankton | MIKEIKSLDKTEMFKPKPKNKISIISKILKILGYGKKR* |
| Ga0114350_10190846 | 3300008116 | Freshwater, Plankton | MIEDIKKLDKNKLFEVKPKNKISIINKLITILGYGKKG* |
| Ga0114351_10886196 | 3300008117 | Freshwater, Plankton | MINEIKSFDKEEMFKPKPKNKISIIDKILKILGYGKKR* |
| Ga0114336_10297376 | 3300008261 | Freshwater, Plankton | MIDEIKKLDKTELFKPKPKKKISIIDKILKILGYGKKR* |
| Ga0114876_10555561 | 3300008448 | Freshwater Lake | EIKSLDKMKMFEKPEKPKISLFKKILLILGYGKKG* |
| Ga0102831_10204984 | 3300008996 | Estuarine | LINELKQLDKSEMFKPEIKKKISIIDKILKILGYGKKR* |
| Ga0102831_10404092 | 3300008996 | Estuarine | MIEEVKKLDKKEIFKPKKKVSIIDKLLKILGYGKKG* |
| Ga0102831_11187093 | 3300008996 | Estuarine | MIDEIKSLDKNKMFQPKPKKKVSIIDKVLKILGHGKKR* |
| Ga0102831_11581051 | 3300008996 | Estuarine | MIEDLKKLDRKKMFEEKPKNKISIIDKILKILGYGKKR* |
| Ga0102860_11614402 | 3300009056 | Estuarine | MINEIKEINKEELFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0114962_1001944110 | 3300009151 | Freshwater Lake | MIDEIKKINKEELFKPKKKVSIIDKILKILGYGKKR* |
| Ga0114962_100237374 | 3300009151 | Freshwater Lake | MIDEIKKFDKNEIFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0114962_100492866 | 3300009151 | Freshwater Lake | MIDEIKKFDKNEIFKPKKKVSIIDKLLKILGYGKKG* |
| Ga0114962_101133602 | 3300009151 | Freshwater Lake | MIDEIKKYKKEEMFKPKKVKKVSFLNKILAILGYGKKG* |
| Ga0114980_100738683 | 3300009152 | Freshwater Lake | MIEEIKKLDKSKMFVEKPKEKISIFNKILMILGYGKKR* |
| Ga0114977_100039555 | 3300009158 | Freshwater Lake | MIDEIKNLDKSVLFIQEPKSKISIIDKLLKILGYGKKR* |
| Ga0114977_107100592 | 3300009158 | Freshwater Lake | MIEEVKKINKDELFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0114978_105823382 | 3300009159 | Freshwater Lake | MIEDIKKLDKRKMFEEKPKKKVSIIDKILKILGYGKKG* |
| Ga0114981_107172192 | 3300009160 | Freshwater Lake | MIDEVKKINKDELFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0114969_101430342 | 3300009181 | Freshwater Lake | LIKEIKQLDKSEMFKPEIKKKISIIDKILKILGYGKKG* |
| Ga0114974_1000504312 | 3300009183 | Freshwater Lake | MIDEIKSLDKNKMFQPKPKNRVSIIDKILKILGLGKKR* |
| Ga0114974_101098521 | 3300009183 | Freshwater Lake | IKSLDKNKMFQPKPKKKVSIIDKILKILGYGKKG* |
| Ga0114976_101579344 | 3300009184 | Freshwater Lake | LIKELKQLDKSEMFKPEIKKKISIINKILKILGYGKKG* |
| Ga0114982_10543513 | 3300009419 | Deep Subsurface | MIDVIKKINKDELFKPKKKVSIIDKLLKILGYGKKR* |
| Ga0116170_100143423 | 3300009694 | Anaerobic Digestor Sludge | MTSKRSQIEEIKRLDRDEMFKPKKKEKISFFKKIGIIINGKKR* |
| Ga0129333_100526215 | 3300010354 | Freshwater To Marine Saline Gradient | MIDEIKQINKEEIFKKKEKNKISIIDKLFMILGYGKKR* |
| Ga0133913_107522166 | 3300010885 | Freshwater Lake | MIDEIKSLNKEEIFKVKPKNKVSIIDKILKILGYGKKR* |
| Ga0133913_124448933 | 3300010885 | Freshwater Lake | MINEIKSFDKSKMFQQKPKNKVSIIDKILKILGYGKKR* |
| Ga0153801_10330141 | 3300012017 | Freshwater | MEIVSNKKRLIEEIKSLDKNKMFQPKPKKKVSIIDKILKILGYGKKR* |
| Ga0157138_10014944 | 3300012352 | Freshwater | MIEELTKLDRKKMFEEKPKNKISIIDKILKILGYGKKR* |
| Ga0157138_10025761 | 3300012352 | Freshwater | MIEEIKKLDRKKMFEEKPKNKISIIDKILKILGYGKKR* |
| Ga0157203_100013816 | 3300012663 | Freshwater | LIDEIKSIDKDKMFVVKPKERISIFNKILITLGYGKKR* |
| Ga0164293_100004355 | 3300013004 | Freshwater | MINEIKKLDKTEMFKPKPKKRISIIEKILKILGYGKKR* |
| Ga0136642_11282611 | 3300013285 | Freshwater | KLKMINEIKSLDKSKLFVQEQKNKVSIIDKLLKIFGYGKKR* |
| Ga0181564_107641541 | 3300018876 | Salt Marsh | MIDEIKKIDKSELFVIKQEKKVSIIDKLLKIFGYGKKG |
| Ga0181359_10086907 | 3300019784 | Freshwater Lake | MIDKIKKLNKTDLFKPEKKVSIIDKILKILGYGKKR |
| Ga0181359_11364792 | 3300019784 | Freshwater Lake | MIEEMKKLDRKKMFEKKPKNKVSIIDKILKILGYGKKG |
| Ga0194113_1001145419 | 3300020074 | Freshwater Lake | MIDEIKKIDKEKIFQPKPKKKVSILDKILVILGYGKKR |
| Ga0211732_135626415 | 3300020141 | Freshwater | LIKELKQLDKSEMFKPEIKKKISIIDKILKILGYGKKR |
| Ga0211732_13883744 | 3300020141 | Freshwater | MIEEIKKLNKTDLFKPEKKVSIIDKILKILGYGKKR |
| Ga0211732_15532326 | 3300020141 | Freshwater | MIDEIKSLDKNKMFQPKPKKKVSIIDKILKILGHGKKR |
| Ga0211736_104508437 | 3300020151 | Freshwater | MIEEMKKLDRKKMFEKKPKNKVSIIDKILKILGYAKKG |
| Ga0211736_106934082 | 3300020151 | Freshwater | MINEIKKLDKTEMFKPKPKKRISIIEKILKILGYGKKR |
| Ga0211736_108770613 | 3300020151 | Freshwater | MIEEIKSLNKEEIFKPKPKNKVSIIDKILKILGYGKKR |
| Ga0211736_110327872 | 3300020151 | Freshwater | MIKEIKSLDKMKMFEKPEKPKISLFKKILLILGYGKKG |
| Ga0211734_100457876 | 3300020159 | Freshwater | MMIEEIKSLNKEEIFKPKPKNKVSIIDKILKILGYGKER |
| Ga0211734_101512926 | 3300020159 | Freshwater | MIEEIKKLDKKKMFEEKPKNKVSIIDKVLKILGYGKKR |
| Ga0211734_110840903 | 3300020159 | Freshwater | MIEEVKKLDRKKMFEEKPKNKISIMDKILKILGYGKER |
| Ga0211733_105787784 | 3300020160 | Freshwater | RMIDEIKKINKEELFKPKKKVSIIDKLLKILGYGKKR |
| Ga0211733_106484661 | 3300020160 | Freshwater | MIEEIKKLDKKKMFEEKPKNKVSIIDKVLKILGYGKKRXFIKPVSNY |
| Ga0211733_107822523 | 3300020160 | Freshwater | IKELKQLDKSEMFKPEIKKKISIIDKILKILGYGKKG |
| Ga0194118_103275453 | 3300020190 | Freshwater Lake | MEKDLRQVAIHKNQMIEEVKKIDKEKLFQPKKEKSIIKKILMILGYGKKG |
| Ga0211731_101066032 | 3300020205 | Freshwater | LIKELKQLDKSEMFKPEIKKKISIIDKILKILGYGKKG |
| Ga0208052_1080673 | 3300020490 | Freshwater | MIEEVKKINKDELFKPKRKVSIIEKILKILGYGKKR |
| Ga0208829_1159842 | 3300020491 | Freshwater | MIDEIRKINKDELFKPKKKVSIIDKMLKILGYGKKR |
| Ga0208327_10157183 | 3300020522 | Freshwater | MIEEIKNLDKTELFKPKPKKKISIIDKILKILGYGKKR |
| Ga0208601_10311372 | 3300020532 | Freshwater | MIKEIKSLDKTKMFEKPEKPKISLFKKILLILGYGKKG |
| Ga0208722_10416852 | 3300020537 | Freshwater | MIDEIKKINKEELFKPKKKVSIIDKLLKILGYGKKG |
| Ga0208856_10392781 | 3300020548 | Freshwater | KEKMIKEIKSLDKTKMFEKPEKPKISLFKKILLILGYGKKG |
| Ga0208486_10059331 | 3300020556 | Freshwater | SHKNQMIEEIKNLDKTELFKPKPKKKISIIDKILKILGYGKKR |
| Ga0208082_10149116 | 3300020563 | Freshwater | MIDEIKSLDKNKMFQPKPKKKVSIIDKVLKILGHGKKR |
| Ga0208082_10161533 | 3300020563 | Freshwater | LIDEIKSIDKDKMFVVKPKERISIFNKILITLGYGKKR |
| Ga0208719_10138344 | 3300020564 | Freshwater | MIEEIKKLDKRKMFEEKPKKKVSIIDKILKILGYGKKG |
| Ga0214163_11103253 | 3300021141 | Freshwater | MIDEIRKINKDELFKPKKKVSIIDKLLKILGYGKKR |
| Ga0222712_1000048542 | 3300021963 | Estuarine Water | MIDEVKSLDKTKIFVPKPKKKVSFWNKMLIILGYGKKG |
| Ga0181351_12779091 | 3300022407 | Freshwater Lake | MIEEIKNLDKTELFKPKPKKKISIIDKILKILGYGKKRXVTKSIG |
| Ga0214921_101447392 | 3300023174 | Freshwater | MIDEIKSLDKNKMFQPKPKKRVSIIDKILKILGHGKKR |
| Ga0214919_102384712 | 3300023184 | Freshwater | MIDEIKSLNKEEIFKVKPKNKVSIIDKILKILGYGKKR |
| Ga0214919_106591082 | 3300023184 | Freshwater | MIDEVKSFDKSKIFVKKQKNKVSIIDKLLMIFGYGKKR |
| Ga0244777_101623381 | 3300024343 | Estuarine | MIDEVKSLDKSKIFVPKPKKKVSFWNKMLIILGYGKKG |
| Ga0244775_1000440910 | 3300024346 | Estuarine | MKMIEEVKKLDKKEIFKPKKKVSIIDKLLKILGYGKKG |
| Ga0244775_1001543611 | 3300024346 | Estuarine | LINELKQLDKSEMFKPEIKKKISIIDKILKILGYGKKR |
| Ga0244775_100427215 | 3300024346 | Estuarine | MIDEVKSLDKNKMFQPKPKKRVSIIDKILKILGHGKKR |
| Ga0244775_103684643 | 3300024346 | Estuarine | MIDEIKSLDKNKMFLEKPKKKVSIWDKVLIILGYGKKR |
| Ga0244775_103916753 | 3300024346 | Estuarine | MINEIKKINKEELFKPKKKVSIIDKLLKILGYGKKR |
| Ga0244775_106907332 | 3300024346 | Estuarine | MIEEIKRIDRKKLFEEKPKNKISIMDKILKILGYGKKR |
| Ga0207957_10058996 | 3300025372 | Freshwater | MIDEIKSLDKDKLFVQEQKNKVSIIDKLLKIFGYGKKR |
| Ga0208443_10167414 | 3300027084 | Estuarine | MIDEIKKINKEELFKPKKKVSIIDKLLKILGYGKKR |
| Ga0208557_10814161 | 3300027221 | Estuarine | IDEIKKINKEELFKPKKKVSIIDKLLKILGYGKKR |
| Ga0208439_10243234 | 3300027278 | Estuarine | MIEEVKKLDKKEIFKPKKKVSIIDKLLKILGYGKKG |
| Ga0208966_11398712 | 3300027586 | Freshwater Lentic | MIDEVKKINKDELFKPKKKVSIVDKLLKILGYGKKR |
| Ga0208966_11939423 | 3300027586 | Freshwater Lentic | IDEVKSLDKNKMFQPKPKKRVSIIDKILKILGHGKKR |
| Ga0208133_11383053 | 3300027631 | Estuarine | KKRLIEEIKSLDKNKMFQPKPKKKVSIIDKILKILGYGKKR |
| Ga0209297_11599892 | 3300027733 | Freshwater Lake | MIDEIKNLDKSVLFIQEPKSKISIIDKLLKILGYGKKR |
| Ga0209084_10071225 | 3300027749 | Freshwater Lake | MKEVENHKTKMIDEIKKFDKNEIFKPKKKVSIIDKLLKILGYGKKR |
| Ga0209084_10648485 | 3300027749 | Freshwater Lake | MIDEIKKFDKNEIFKPKKKVSIIDKLLKILGYGKKG |
| Ga0209084_12904232 | 3300027749 | Freshwater Lake | MIDEIKKYKKEEMFKPKKVKKVSFLNKILAILGYGKKG |
| Ga0209296_10522355 | 3300027759 | Freshwater Lake | MIDEIKSLDKNKMFQPKPKKKVSIIDKILKILGYGKKG |
| Ga0209296_10976711 | 3300027759 | Freshwater Lake | QMIEEIKNLDKTELFKPKPKKKISIIDKILKILGYGKKR |
| Ga0209296_12656221 | 3300027759 | Freshwater Lake | IIDEIKNLDKSVLFIQEPKSKISIIDKLLKILGYGKKR |
| Ga0209768_102022012 | 3300027772 | Freshwater Lake | MIDKIKKLNKTDLFKPEKKVSIIDKILKILGYGKKG |
| Ga0209829_103523421 | 3300027777 | Freshwater Lake | MIEEVKKINKDELFKPKKKVSIVDKLLKILGYGKKR |
| Ga0209500_102703443 | 3300027782 | Freshwater Lake | MIEEVKKINKDELFKPKKKVSIIDKLLKILGYGKKR |
| Ga0209298_100428773 | 3300027973 | Freshwater Lake | MIEEIKKLDKSKMFVEKPKEKISIFNKILMILGYGKKR |
| Ga0119944_10246202 | 3300029930 | Aquatic | MIEDIKKIDKEKMFQPKPKKRVSILDKIMLILGYGKKR |
| Ga0315907_108401933 | 3300031758 | Freshwater | MISEIKSLDKTKMFEPKPKNKISIISKILKILGYGKKR |
| Ga0315900_103300643 | 3300031787 | Freshwater | MIDEIKSLDKNKIFVEKPKKKISIWNKILIIFGYGKKG |
| Ga0315906_104771734 | 3300032050 | Freshwater | EKMIKEIKSLDKTKMFEKPEKPKISLFKKILLILGYGKKG |
| Ga0315906_105675312 | 3300032050 | Freshwater | MINEIKSFDKEEMFKPKPKNKISIIDKILKILGYGKKR |
| Ga0315906_112246062 | 3300032050 | Freshwater | MIDEIRSLDKKEMFKPKPKKRISFLKKLMFILGYGKKGXIIKSISINIG |
| Ga0315905_100863786 | 3300032092 | Freshwater | MIEEIKKLDKTELFKPKPKKKISIIDKILKILGYGKKR |
| Ga0315902_109514872 | 3300032093 | Freshwater | MIKEIKSLDKTEMFKPKPKNKISIISKILKILGYGKKRXLIKSIS |
| Ga0334980_0290292_503_613 | 3300033816 | Freshwater | MIEEVKKINKEELFKPKKKVSIIDKLLKILGYGKKR |
| Ga0334992_0236685_3_113 | 3300033992 | Freshwater | MIEEVKKLDRKKMFEEKPKNKVSIIDKILKILGYGKK |
| Ga0335003_0206611_605_721 | 3300033995 | Freshwater | MIEEVKKLDRKKMFEEKPKNKVSIIDKILKILGYGKKR |
| Ga0334991_0084115_1048_1158 | 3300034013 | Freshwater | MIEEVKKINKDELFKPKKKVSVIEKILKILGYGKKR |
| Ga0310130_0031284_925_1041 | 3300034073 | Fracking Water | MIEEIKKLDKTKMFQPKPKVKISIIDKILMILGYAKKR |
| Ga0335029_0101387_1043_1159 | 3300034102 | Freshwater | MIDEIKSFDKKEMFVPKPKNKISIIDKILKILGYGKKR |
| Ga0335029_0104427_249_365 | 3300034102 | Freshwater | MIEEVKKLDRKKMFEEKPKNKISIIDKILKILGYGKKR |
| Ga0335031_0004597_3955_4071 | 3300034104 | Freshwater | MIDEIKKLDKTELFKPKPKNKISIIDKILKILGYGKKR |
| Ga0335033_0609161_1_105 | 3300034117 | Freshwater | MRMIDEIKKINKEELFKPKKKVSIIDKLLKILGYG |
| Ga0335016_0575926_281_391 | 3300034166 | Freshwater | MIEEVKKINKDELFKLKKKVSIIDKLLKILGYGKKR |
| Ga0335007_0136707_362_496 | 3300034283 | Freshwater | MDQKKRLINEIKSLDKNKMFLEKPKKKISIWNKILIILGYGKKG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |