Basic Information | |
---|---|
Family ID | F041823 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 159 |
Average Sequence Length | 41 residues |
Representative Sequence | KTVYTNKAITDIRKLVTEGYIKIERQTQDVEIATEKATI |
Number of Associated Samples | 139 |
Number of Associated Scaffolds | 159 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.37 % |
% of genes from short scaffolds (< 2000 bps) | 93.71 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.132 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (22.013 % of family members) |
Environment Ontology (ENVO) | Unclassified (65.409 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.019 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 159 Family Scaffolds |
---|---|---|
PF08722 | Tn7_TnsA-like_N | 33.33 |
PF03237 | Terminase_6N | 0.63 |
PF00462 | Glutaredoxin | 0.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.31 % |
Unclassified | root | N/A | 10.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000116|DelMOSpr2010_c10157568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 770 | Open in IMG/M |
3300001354|JGI20155J14468_10125070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 860 | Open in IMG/M |
3300001450|JGI24006J15134_10169526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 695 | Open in IMG/M |
3300001748|JGI11772J19994_1031739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 690 | Open in IMG/M |
3300001947|GOS2218_1000684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1641 | Open in IMG/M |
3300001948|GOS2228_1039282 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
3300002040|GOScombined01_100900099 | Not Available | 1533 | Open in IMG/M |
3300003185|JGI26064J46334_1027521 | Not Available | 1110 | Open in IMG/M |
3300003540|FS896DNA_10283931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 504 | Open in IMG/M |
3300003540|FS896DNA_10434307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 613 | Open in IMG/M |
3300004097|Ga0055584_101600552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 674 | Open in IMG/M |
3300005239|Ga0073579_1534569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 816 | Open in IMG/M |
3300005423|Ga0066828_10144450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 805 | Open in IMG/M |
3300005523|Ga0066865_10416616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 511 | Open in IMG/M |
3300005913|Ga0075108_10133271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 895 | Open in IMG/M |
3300006025|Ga0075474_10051605 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
3300006027|Ga0075462_10145658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 725 | Open in IMG/M |
3300006310|Ga0068471_1069586 | All Organisms → cellular organisms → Bacteria | 2348 | Open in IMG/M |
3300006735|Ga0098038_1106457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 963 | Open in IMG/M |
3300006735|Ga0098038_1232670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 587 | Open in IMG/M |
3300006867|Ga0075476_10214007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 697 | Open in IMG/M |
3300006874|Ga0075475_10071070 | Not Available | 1607 | Open in IMG/M |
3300006874|Ga0075475_10121827 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
3300006900|Ga0066376_10293837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 950 | Open in IMG/M |
3300006919|Ga0070746_10320315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 708 | Open in IMG/M |
3300006919|Ga0070746_10491839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 540 | Open in IMG/M |
3300007116|Ga0101667_1047359 | Not Available | 767 | Open in IMG/M |
3300007116|Ga0101667_1074696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 618 | Open in IMG/M |
3300007236|Ga0075463_10061368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1214 | Open in IMG/M |
3300007509|Ga0105012_1080148 | Not Available | 1415 | Open in IMG/M |
3300007538|Ga0099851_1364972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 502 | Open in IMG/M |
3300009076|Ga0115550_1291395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 526 | Open in IMG/M |
3300009077|Ga0115552_1062052 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
3300009173|Ga0114996_10821292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 671 | Open in IMG/M |
3300009409|Ga0114993_11227106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 527 | Open in IMG/M |
3300009420|Ga0114994_10450592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 850 | Open in IMG/M |
3300009422|Ga0114998_10565711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 534 | Open in IMG/M |
3300009425|Ga0114997_10052718 | All Organisms → cellular organisms → Bacteria | 2608 | Open in IMG/M |
3300009437|Ga0115556_1161793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 821 | Open in IMG/M |
3300009467|Ga0115565_10537649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 524 | Open in IMG/M |
3300009498|Ga0115568_10386347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 607 | Open in IMG/M |
3300009703|Ga0114933_10178605 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
3300009703|Ga0114933_10368787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 944 | Open in IMG/M |
3300009705|Ga0115000_10208405 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
3300009706|Ga0115002_10326323 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
3300009786|Ga0114999_11167809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 550 | Open in IMG/M |
3300010149|Ga0098049_1014409 | All Organisms → cellular organisms → Bacteria | 2645 | Open in IMG/M |
3300010149|Ga0098049_1242965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 548 | Open in IMG/M |
3300010299|Ga0129342_1118572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 983 | Open in IMG/M |
3300011013|Ga0114934_10236757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 836 | Open in IMG/M |
3300011013|Ga0114934_10408199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 604 | Open in IMG/M |
3300012936|Ga0163109_11101521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 580 | Open in IMG/M |
3300012953|Ga0163179_11071496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 706 | Open in IMG/M |
3300012954|Ga0163111_11791606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 614 | Open in IMG/M |
3300013115|Ga0171651_1095097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 964 | Open in IMG/M |
3300016797|Ga0182090_1758494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1748 | Open in IMG/M |
3300017697|Ga0180120_10256092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 710 | Open in IMG/M |
3300017703|Ga0181367_1072842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 595 | Open in IMG/M |
3300017710|Ga0181403_1078046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 688 | Open in IMG/M |
3300017727|Ga0181401_1151677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 565 | Open in IMG/M |
3300017755|Ga0181411_1126758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 744 | Open in IMG/M |
3300017763|Ga0181410_1193932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 558 | Open in IMG/M |
3300017775|Ga0181432_1074981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 981 | Open in IMG/M |
3300017781|Ga0181423_1343299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 544 | Open in IMG/M |
3300017818|Ga0181565_10919075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 545 | Open in IMG/M |
3300017952|Ga0181583_10092006 | Not Available | 2085 | Open in IMG/M |
3300017957|Ga0181571_10512432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 732 | Open in IMG/M |
3300017967|Ga0181590_11136872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 502 | Open in IMG/M |
3300017969|Ga0181585_10941600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 553 | Open in IMG/M |
3300018416|Ga0181553_10334332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 836 | Open in IMG/M |
3300018420|Ga0181563_10137187 | Not Available | 1554 | Open in IMG/M |
3300018421|Ga0181592_10399760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 970 | Open in IMG/M |
3300018421|Ga0181592_10506585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 833 | Open in IMG/M |
3300018424|Ga0181591_11020529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 561 | Open in IMG/M |
3300018426|Ga0181566_11114306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 528 | Open in IMG/M |
3300020054|Ga0181594_10480417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 507 | Open in IMG/M |
3300020165|Ga0206125_10175514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 848 | Open in IMG/M |
3300020173|Ga0181602_10155451 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
3300020189|Ga0181578_10469114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 530 | Open in IMG/M |
3300020276|Ga0211509_1063961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 854 | Open in IMG/M |
3300020281|Ga0211483_10272350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 562 | Open in IMG/M |
3300020342|Ga0211604_1052174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 828 | Open in IMG/M |
3300020361|Ga0211531_1021745 | Not Available | 2013 | Open in IMG/M |
3300020365|Ga0211506_1235395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 506 | Open in IMG/M |
3300020378|Ga0211527_10218900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 527 | Open in IMG/M |
3300020400|Ga0211636_10056322 | Not Available | 1659 | Open in IMG/M |
3300020401|Ga0211617_10065800 | Not Available | 1517 | Open in IMG/M |
3300020401|Ga0211617_10117588 | Not Available | 1109 | Open in IMG/M |
3300020405|Ga0211496_10008083 | All Organisms → cellular organisms → Bacteria | 3789 | Open in IMG/M |
3300020414|Ga0211523_10412990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 545 | Open in IMG/M |
3300020417|Ga0211528_10265629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 647 | Open in IMG/M |
3300020428|Ga0211521_10507038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 517 | Open in IMG/M |
3300020437|Ga0211539_10320661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 643 | Open in IMG/M |
3300020440|Ga0211518_10246026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 862 | Open in IMG/M |
3300020446|Ga0211574_10489264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 528 | Open in IMG/M |
3300020448|Ga0211638_10201215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 913 | Open in IMG/M |
3300020451|Ga0211473_10531722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 598 | Open in IMG/M |
3300020454|Ga0211548_10647728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 515 | Open in IMG/M |
3300020455|Ga0211664_10126393 | Not Available | 1197 | Open in IMG/M |
3300020455|Ga0211664_10410372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 623 | Open in IMG/M |
3300020460|Ga0211486_10247942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 772 | Open in IMG/M |
3300020463|Ga0211676_10144060 | Not Available | 1507 | Open in IMG/M |
3300021356|Ga0213858_10419906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 626 | Open in IMG/M |
3300021356|Ga0213858_10531683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 540 | Open in IMG/M |
3300021958|Ga0222718_10159675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1265 | Open in IMG/M |
3300021958|Ga0222718_10559123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 543 | Open in IMG/M |
3300021959|Ga0222716_10405898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 790 | Open in IMG/M |
3300021964|Ga0222719_10017731 | All Organisms → Viruses | 5716 | Open in IMG/M |
3300022198|Ga0196905_1072312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 949 | Open in IMG/M |
3300022822|Ga0222646_131827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 502 | Open in IMG/M |
3300022837|Ga0222711_1045166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 502 | Open in IMG/M |
3300022923|Ga0255783_10379806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 538 | Open in IMG/M |
3300023081|Ga0255764_10501976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 501 | Open in IMG/M |
3300023105|Ga0255782_10431438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 581 | Open in IMG/M |
3300023172|Ga0255766_10262160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 902 | Open in IMG/M |
3300023172|Ga0255766_10306645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 806 | Open in IMG/M |
3300023176|Ga0255772_10403893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 687 | Open in IMG/M |
3300023180|Ga0255768_10539015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 580 | Open in IMG/M |
3300023235|Ga0222634_1047154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 637 | Open in IMG/M |
3300024344|Ga0209992_10265488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 709 | Open in IMG/M |
3300025086|Ga0208157_1045095 | Not Available | 1207 | Open in IMG/M |
3300025151|Ga0209645_1087784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1025 | Open in IMG/M |
3300025168|Ga0209337_1205677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 795 | Open in IMG/M |
3300025168|Ga0209337_1267495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 642 | Open in IMG/M |
3300025168|Ga0209337_1351127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 505 | Open in IMG/M |
3300025266|Ga0208032_1069096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 761 | Open in IMG/M |
3300025425|Ga0208646_1041178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 922 | Open in IMG/M |
3300025601|Ga0208768_1073107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 995 | Open in IMG/M |
3300025630|Ga0208004_1150879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 502 | Open in IMG/M |
3300025652|Ga0208134_1100149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 803 | Open in IMG/M |
3300025704|Ga0209602_1200393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 594 | Open in IMG/M |
3300025770|Ga0209362_1037701 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
3300025810|Ga0208543_1054962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 977 | Open in IMG/M |
3300025892|Ga0209630_10124916 | Not Available | 1343 | Open in IMG/M |
3300026183|Ga0209932_1116181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 579 | Open in IMG/M |
3300026189|Ga0208405_1072953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 500 | Open in IMG/M |
3300026204|Ga0208521_1122199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 680 | Open in IMG/M |
3300027687|Ga0209710_1278069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 528 | Open in IMG/M |
3300027714|Ga0209815_1126588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 831 | Open in IMG/M |
3300027788|Ga0209711_10080127 | Not Available | 1701 | Open in IMG/M |
3300027830|Ga0209359_10077065 | Not Available | 1361 | Open in IMG/M |
3300027830|Ga0209359_10322580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 709 | Open in IMG/M |
3300027830|Ga0209359_10372770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 658 | Open in IMG/M |
3300027844|Ga0209501_10278852 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
3300028190|Ga0257108_1122551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 763 | Open in IMG/M |
3300028194|Ga0257106_1183904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 723 | Open in IMG/M |
3300028194|Ga0257106_1224256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 637 | Open in IMG/M |
3300031143|Ga0308025_1030154 | All Organisms → Viruses → Predicted Viral | 2136 | Open in IMG/M |
3300031519|Ga0307488_10714705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 565 | Open in IMG/M |
3300031596|Ga0302134_10057669 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
3300031596|Ga0302134_10369736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 530 | Open in IMG/M |
3300031597|Ga0302116_1239708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 526 | Open in IMG/M |
3300031637|Ga0302138_10022340 | All Organisms → Viruses → Predicted Viral | 2633 | Open in IMG/M |
3300031687|Ga0308008_1073634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 803 | Open in IMG/M |
3300031695|Ga0308016_10355322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 527 | Open in IMG/M |
3300031696|Ga0307995_1046878 | All Organisms → Viruses → Predicted Viral | 1821 | Open in IMG/M |
3300031800|Ga0310122_10351414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 638 | Open in IMG/M |
3300032011|Ga0315316_10628789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 895 | Open in IMG/M |
3300032278|Ga0310345_10186559 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.01% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.09% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 13.84% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.18% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.77% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.77% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.14% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.14% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.52% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.52% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.52% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.89% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.89% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.89% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.26% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.26% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.26% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.26% |
Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 1.26% |
Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 1.26% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.63% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.63% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.63% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.63% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.63% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.63% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.63% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.63% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.63% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
3300001948 | Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012 | Environmental | Open in IMG/M |
3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
3300003185 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV | Environmental | Open in IMG/M |
3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300005423 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47 | Environmental | Open in IMG/M |
3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300007116 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3 | Environmental | Open in IMG/M |
3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007509 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300013115 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020054 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020276 | Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289007-ERR315858) | Environmental | Open in IMG/M |
3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
3300020342 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556117-ERR599036) | Environmental | Open in IMG/M |
3300020361 | Marine microbial communities from Tara Oceans - TARA_B100000071 (ERX556078-ERR599167) | Environmental | Open in IMG/M |
3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
3300022837 | Saline water microbial communities from Ace Lake, Antarctica - #1699 | Environmental | Open in IMG/M |
3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
3300025601 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026189 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes) | Environmental | Open in IMG/M |
3300026204 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47 (SPAdes) | Environmental | Open in IMG/M |
3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031596 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCM | Environmental | Open in IMG/M |
3300031597 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCM | Environmental | Open in IMG/M |
3300031637 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1 | Environmental | Open in IMG/M |
3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010_101575681 | 3300000116 | Marine | VKRVYRNKAITDIRKLVTEGYLKIDRTSQDVSISVEKAVL* |
JGI20155J14468_101250703 | 3300001354 | Pelagic Marine | YAASSDNVKNVYSNKAITDTRKLVTEGYIKIARGTQDVQIVAEKAGL* |
JGI24006J15134_101695263 | 3300001450 | Marine | NVKNVYTSKAITDIRKLVTEGYIKITRQTQDVEIATEKATI* |
JGI11772J19994_10317391 | 3300001748 | Saline Water And Sediment | TGSSATVQNVYTNKAITDIRKLVTEGYIKIERTNLDVEIVTEKANI* |
GOS2218_10006843 | 3300001947 | Marine | KTVYTNKAITDIRKLVTEGYIKIERQTQDVEIATEKATI* |
GOS2228_10392821 | 3300001948 | Marine | NVKNVYSNKVITDIRKLITEGYIKIERQSLDVEIATERATV* |
GOScombined01_1009000994 | 3300002040 | Marine | YSNKAITDVRKLVTEGYIRIPRNSKDVQIVVEKATI* |
JGI26064J46334_10275211 | 3300003185 | Marine | SVKTVYRNKAITDIRNLVTEGYIKIERDTLNVSVATEKAEL* |
FS896DNA_102839311 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | STKIIYRSKSISNIRKLVTEGYIKINRASQDVTLATEKATI* |
FS896DNA_104343072 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | TTKTVYRNKAITDIRKLVTEGYIKIDRATQDVNIATEKVGL* |
Ga0055584_1016005523 | 3300004097 | Pelagic Marine | TVKTVYRNKAITDIRKLTTEGLIKINRSTQDVAINIEKAGL* |
Ga0073579_15345691 | 3300005239 | Marine | SDNVKTVYTSKVSTDIRKLVTEGYIKIERGTQDVSIATEKAGL* |
Ga0066828_101444503 | 3300005423 | Marine | DTTKTVYRNKAITDIRKLVTEGYIKISRETQNVSIVTEKAGL* |
Ga0066865_104166162 | 3300005523 | Marine | YTNKAVTDIRKLVTEGYIKISRETQDVEVATEKESL* |
Ga0075108_101332711 | 3300005913 | Saline Lake | YTSKAISDVRKLVTEGYVKVERRSQDVEIATEKAAL* |
Ga0075474_100516051 | 3300006025 | Aqueous | ADNIKNVYTSKAITDVRKLVTEGYIKIERQTQDVEIATEKTTI* |
Ga0075462_101456581 | 3300006027 | Aqueous | NKAITDIRRLVTEGYLKIDRTLQNVSIATEKAAL* |
Ga0068471_10695866 | 3300006310 | Marine | TTKTVYRNKAVTNVRKLVTEGYLKINRTTQDVSIATEKAGL* |
Ga0098038_11064571 | 3300006735 | Marine | ADNIKNVYSNKAITDIRKLVTEGYVKIERQTQDVEIATEKATI* |
Ga0098038_12326703 | 3300006735 | Marine | TSKAITDIRKLVTEGYIKIERQTLDVEVATEKATL* |
Ga0075476_102140073 | 3300006867 | Aqueous | NVKNVYESKAITDVRKLVTEGYIKIERQTQNVEIATEKATL* |
Ga0075475_100710705 | 3300006874 | Aqueous | TTTKTVYRNKAITDIRKLITEGYIKIDRTTQDVSIATEKAAI* |
Ga0075475_101218271 | 3300006874 | Aqueous | SDNVKNVYSNKVITDIRKLVTEGYIKIERQSQDVEIATERATV* |
Ga0066376_102938374 | 3300006900 | Marine | TASTDTTKTVYRNKTITDIRKLVTEGYIKINRETQDVSIATEKVGL* |
Ga0070746_103203151 | 3300006919 | Aqueous | NVKNVYTNKAITDIRKLVTEGYIKITRQTQDVEVATEKANI* |
Ga0070746_104918391 | 3300006919 | Aqueous | STNVKNVYSNKVITDIRKLITEGYIKIERQSQDVEIATERATV* |
Ga0101667_10473591 | 3300007116 | Volcanic Co2 Seep Seawater | YNNSSSTTKTVYRNKAITDIRKLVNEGYIQIARENQDVTVVSEKANL* |
Ga0101667_10746963 | 3300007116 | Volcanic Co2 Seep Seawater | NIKNVYTSKAITDIRKLVTEGYIKIERQTQDVEIATEKANI* |
Ga0075463_100613681 | 3300007236 | Aqueous | RNKAITDIRKLVTEGIIKINRSTQDVAINVEKAGL* |
Ga0105012_10801481 | 3300007509 | Marine | IEYSGSLDTTKTVYRAKANTDIRKLVTEGYIKINRDTQNVSIITEKANL* |
Ga0099851_13649721 | 3300007538 | Aqueous | IKTVYRNKAITDIRKLVVQGYIKINRATQNVSVATEKAVL* |
Ga0115550_12913952 | 3300009076 | Pelagic Marine | DNIKNVYTSKAITDVRKLVTEGYIKIERQTQDVEIATEKATI* |
Ga0115552_10620521 | 3300009077 | Pelagic Marine | NVYTSKAITDVRKLVTEGYIKIERQTQDVEIATEKATI* |
Ga0114996_108212923 | 3300009173 | Marine | YTGKAISDVRKLVTEGYVKVERQSQDVEIATEKAAL* |
Ga0114993_112271062 | 3300009409 | Marine | KIVYTSKVSTDIRKLVTEGYIKISRSSQDVSIATEKANL* |
Ga0114994_104505921 | 3300009420 | Marine | EASSENIKNVYTSKAISDVRKLVTEGYVKVDRQSQDVEIATEKAAL* |
Ga0114998_105657111 | 3300009422 | Marine | GSSDNVRTVYTNKVITDIRKLVTEGYIKIRRTSQDVQISTEKVGL* |
Ga0114997_100527181 | 3300009425 | Marine | NVYTSKAVTDVRRLCTEGYIKIERQTLDVEIQIEKLEI* |
Ga0115556_11617933 | 3300009437 | Pelagic Marine | YTSKAITDVRKLVTEGYIKIERQTQDVEIATEKTTI* |
Ga0115565_105376491 | 3300009467 | Pelagic Marine | ASSDNVKNVYSNKAITDTRKLVTEGYIKIARGTQDVQIVAEKAGL* |
Ga0115568_103863473 | 3300009498 | Pelagic Marine | VKNVYRSKSITDIRKLVTEGYIKIERQKQDVEIATEKATL* |
Ga0114933_101786054 | 3300009703 | Deep Subsurface | TSAIASTKSVYRSKAITNIRKLVTEGYIRITRNTQDVSIVTEKANL* |
Ga0114933_103687871 | 3300009703 | Deep Subsurface | VKTVYTNKAITDIRKLVTEGYVRIQRQSQDVEIVTEKAEL* |
Ga0115000_102084051 | 3300009705 | Marine | NIKNVYTSKAITDTRKLVTEGYIKITRQTQDVEIATEKAAL* |
Ga0115002_103263234 | 3300009706 | Marine | VYTSKVATDIRKLVTEGYIKIERQTLDVQVATEKAGL* |
Ga0114999_111678091 | 3300009786 | Marine | NVKTVYTSKVSTDIRKLVTEGYIKIERGTQDVSIATEKAGL* |
Ga0098049_10144091 | 3300010149 | Marine | DNIKNVYTNKAITDVRKLVTEGYVKIERQTKDVEIATEKATL* |
Ga0098049_12429651 | 3300010149 | Marine | SDNVKNIYRSKAITDIRKLVTEGYIKIERQTQDVEIATEKATI* |
Ga0129342_11185721 | 3300010299 | Freshwater To Marine Saline Gradient | NVYESKAITDVRKLATEGYIKIERQTQNVEIATEKATL* |
Ga0114934_102367571 | 3300011013 | Deep Subsurface | SKETAKTVNRKKAITNVRKLVTKDKIKIDRQTQAVSIATEKATL* |
Ga0114934_104081993 | 3300011013 | Deep Subsurface | VKNVYKSKAVTNIRKLVTEGYIKIERANQNVSITTEKANL* |
Ga0163109_111015211 | 3300012936 | Surface Seawater | ATNIKNVYTSKAITDIRKLVTEGYIKIERQTQDVEIATEKANI* |
Ga0163179_110714961 | 3300012953 | Seawater | EYAGSSATTKTVYRNKAITDIRKLTTDGFVRINRTTQDVSVSAEKVGL* |
Ga0163111_117916061 | 3300012954 | Surface Seawater | KDVYRSKAITNIRQLVTEGYIKVDRANQNVSITTEKANL* |
Ga0171651_10950971 | 3300013115 | Marine | AKVVYRNKAITNIRKLVTEGYIKINRETQDVSIITEKANI* |
Ga0182090_17584941 | 3300016797 | Salt Marsh | TNKSITDIRKLVTEGYIRIERASQNVAIATEKGNL |
Ga0180120_102560921 | 3300017697 | Freshwater To Marine Saline Gradient | DSVKNVYRSKSITDIRKLVTEGYIKIERQTQDVEIATEKATI |
Ga0181367_10728423 | 3300017703 | Marine | NVYRSKAITNIRKLVTEGYTKINRTTQDVSIATEKAVL |
Ga0181403_10780461 | 3300017710 | Seawater | YRSKAITDIRKLVTEGYVKIERGTQDVEVVTEKAEL |
Ga0181401_11516771 | 3300017727 | Seawater | RGDSVKTVYRSKAITDIRKLVTEGYVKIERGTQDVEVVTEKAEL |
Ga0181411_11267581 | 3300017755 | Seawater | KNVYSNKAITDVRRLVTEGYIKIERQTQDVEIATEKATI |
Ga0181410_11939321 | 3300017763 | Seawater | IKNVYTSKAISNVRKLVTEGYLKIERQTQDVEIAIEKATL |
Ga0181432_10749813 | 3300017775 | Seawater | DTTKTVYRAKANTDIRKLVTEGYIKINRDTQNVSITTEKANL |
Ga0181423_13432992 | 3300017781 | Seawater | YTNKAITDIRKLVTDGYIKISRESQDVEVATEKVGI |
Ga0181565_109190751 | 3300017818 | Salt Marsh | DNIKNVYTSKAITDVRKLVTEGYIKIERQTQDVEIATEKATI |
Ga0181583_100920061 | 3300017952 | Salt Marsh | SSASATVKTVYRNKAITEIRKLTTEGLIKINRSTQDVAINVEKAGL |
Ga0181571_105124321 | 3300017957 | Salt Marsh | YAGANATTKTVYRNKAITDVRKLVTEGYVKINRTTQNVSVAIEKAAL |
Ga0181590_111368721 | 3300017967 | Salt Marsh | TNVKNVYESKAITDVRKLVTEGYIKIERQTQNVEIATEKATL |
Ga0181585_109416002 | 3300017969 | Salt Marsh | RNKAVTDIRKLITEGYIKIDRTSQDVSIAVEKASL |
Ga0181553_103343321 | 3300018416 | Salt Marsh | NVYRSKAVTDIRKLITEGYIKIQRQTQDVEIATEKAAL |
Ga0181563_101371874 | 3300018420 | Salt Marsh | EASADNIKNVYTSKAITDVRKLVTEGYIKIERQTQDVEIATEKATI |
Ga0181592_103997601 | 3300018421 | Salt Marsh | YTGSSDNVKNVYSNKVITDIRKLVTEGYIKIERQSQDVEIATERATV |
Ga0181592_105065851 | 3300018421 | Salt Marsh | GTTTKTVYRNKAITDIRKLITEGYIKIDRTTQDVSIATEKAAI |
Ga0181591_110205291 | 3300018424 | Salt Marsh | TKTVYRNKAITNVRKLVTEGYIKIDRTTQNVSVATEKAAL |
Ga0181566_111143062 | 3300018426 | Salt Marsh | YNASSDSTKTVYESKVVTDIRKLITEGYIKIERQTQDVQINIEKATL |
Ga0181594_104804171 | 3300020054 | Salt Marsh | RNKAITDIRKLITEGYLKINRSTQEVSVATEKAGL |
Ga0206125_101755143 | 3300020165 | Seawater | IKNVYTSKAITDIRKLVTEGYIKIERQSQDVEIATEKATI |
Ga0181602_101554511 | 3300020173 | Salt Marsh | ASADNIKNVYTSKAITDVRKLVTEGYIKIERQTQDVEIATEKATI |
Ga0181578_104691141 | 3300020189 | Salt Marsh | VYTNKAITDIRKLVTEGYIRIDRATLDVAITTEKAAL |
Ga0211509_10639611 | 3300020276 | Marine | NVKTVYTNKAITDIRKLVTEGYIKIQRQSLNVEIATERATL |
Ga0211483_102723501 | 3300020281 | Marine | KTVYRNKAVTNIRKLVTEGYLKINRQTQDVSIAVEKATL |
Ga0211604_10521741 | 3300020342 | Marine | RSKAITDIRKLVTEGYIKIQRQTQDVTIATEKATL |
Ga0211531_10217451 | 3300020361 | Marine | TSKAITDIRKLVTEGYIKIDRQTQDVSIATEKVGL |
Ga0211506_12353952 | 3300020365 | Marine | YTAKAITDIRKLVTEGYIKIERQSQDVEVAVEKVTI |
Ga0211527_102189001 | 3300020378 | Marine | EASSDSVKTVYTSKAITDVRKLVTEGYIKIERQTSDVEIATEKVTL |
Ga0211636_100563225 | 3300020400 | Marine | TSKAITDVRKLVTEGYIKILRQTQDVEIATEKANI |
Ga0211617_100658001 | 3300020401 | Marine | DVAYAGASDRVKTVYNNKAQTDIRKLVTEGYIKISRETQDVEIATEKATL |
Ga0211617_101175881 | 3300020401 | Marine | EGSSDTVKTVYRNKAITDIRNLVTEGYIKIERDTLNVSVATEKADL |
Ga0211496_100080837 | 3300020405 | Marine | KTVYTNKTLTDIRKLVTEGYVKISRENNDVNIDTEKANL |
Ga0211523_104129901 | 3300020414 | Marine | AITSTKSVYRSKAITNIRKLVTEGYIKITRDTQDVNIVTEKANL |
Ga0211528_102656293 | 3300020417 | Marine | TAKAITDIRKLVTEGYIKIERQSQDVEVAVEKVTI |
Ga0211521_105070381 | 3300020428 | Marine | NVYTNKAITDIRKLVTDGYIKISRESQDVEVATEKVGI |
Ga0211539_103206613 | 3300020437 | Marine | VYTSKAITDIRKLVTEGYIKIERQTQDVEIATEKASL |
Ga0211518_102460261 | 3300020440 | Marine | GSSDNIKNVYTSKAITDVRKLVTEGYIKIERQSQDVEVAVEKATI |
Ga0211574_104892642 | 3300020446 | Marine | RNKAITDIRKLVTEGYIKISRGTQDVSITVEKAAL |
Ga0211638_102012153 | 3300020448 | Marine | TSKAITDVRKLVTEGYIRIPRQTKDVEVVVEKVNI |
Ga0211473_105317223 | 3300020451 | Marine | FESSSDSIKNVYTSKAITDIRKLVTEGYIKIERQSQDVEIATEKALL |
Ga0211548_106477281 | 3300020454 | Marine | YTNKAITDIRKLVTEGYIQINRQTQNVEIATEKASL |
Ga0211664_101263934 | 3300020455 | Marine | DSVKTVYRTKVTTDIRKLVNKGYIKVGRDNQNVTVATEKASITT |
Ga0211664_104103721 | 3300020455 | Marine | QSKAVTDVRKLVTEGYLKIDRTNQDVSITAEKATL |
Ga0211486_102479423 | 3300020460 | Marine | TSAIASTKSVYRSKAITNIRKLVTEGYIRITRGTQDVSIVTEKANL |
Ga0211676_101440604 | 3300020463 | Marine | SSDSVKTVYTNKVITDIRKLVTEGYITISRQTLNVEIATEKASL |
Ga0213858_104199063 | 3300021356 | Seawater | TNKAITDIRKLVTEGYIKIERQTLDVEVATEKASL |
Ga0213858_105316832 | 3300021356 | Seawater | ESSTDNVKNVYTSKAITDIRKLVTEGYIKIERQTQDVEIATEKATI |
Ga0222718_101596754 | 3300021958 | Estuarine Water | TVYRNKAITDIRKLVTEGYIKIDRTTQNVSVATEKAAL |
Ga0222718_105591232 | 3300021958 | Estuarine Water | TSKAISDVRKLVTEGYIKIERQSQNVEIATEKATL |
Ga0222716_104058983 | 3300021959 | Estuarine Water | GASDTVKSVYTNKAITDVRKLVTEGYLKIERATQDVEIATEKATL |
Ga0222719_100177318 | 3300021964 | Estuarine Water | YTNKAITDIRKLVTEGYIKIDRATQDVAIATEKAAL |
Ga0196905_10723123 | 3300022198 | Aqueous | IKTVYRNKAITDIRKLVTEGYVRVERATQNVALATEKGNL |
Ga0222646_1318272 | 3300022822 | Saline Water | TSKAVTDVRKLVTEGYIKITRQSQDVEIATEKATI |
Ga0222711_10451661 | 3300022837 | Saline Water | VYTSKAISDVRKLVTEGYIKVERQSQDVEIATEKAAL |
Ga0255783_103798062 | 3300022923 | Salt Marsh | KNVYTSKAITDIRKLVTEGYIKIQRQTLDVEIATEKATL |
Ga0255764_105019761 | 3300023081 | Salt Marsh | YEASADNIKNVYTSKAITDVRKLVTEGYIKIERQTQDVEIATEKATI |
Ga0255782_104314382 | 3300023105 | Salt Marsh | NVYRSKSITDIRKLVTEGYIKIERQTQDVEIATEKATL |
Ga0255766_102621603 | 3300023172 | Salt Marsh | YTGSSATVQNVYTNKAITDIRKLVTEGYIKIERTNLDVEIVTEKANT |
Ga0255766_103066453 | 3300023172 | Salt Marsh | ANTTVKTVYRNKAITDIRKLTTEGLIKINRSTQDVAINVEKARL |
Ga0255772_104038933 | 3300023176 | Salt Marsh | RNKAITDIRKLTTEGLIKINRSTQDVAINVEKARL |
Ga0255768_105390153 | 3300023180 | Salt Marsh | RNKAITNVRKLVTEGYIKIDRTTQNVSVATEKAAL |
Ga0222634_10471543 | 3300023235 | Saline Water | SSDNIKNVYTSKAISDVRKLVTEGYIKIERQSQDVEIATEKAAL |
Ga0209992_102654881 | 3300024344 | Deep Subsurface | YTNKAITDIRKLVTEGYIKIQRQSLNVEIATERATL |
Ga0208157_10450951 | 3300025086 | Marine | KNVYTSKAITDIRKLVTEGYIKIERQTLDVEVATEKATL |
Ga0209645_10877843 | 3300025151 | Marine | SIKNVYTSKAITNVRKLVTEGYIKIERQSQDVEIAIEKASI |
Ga0209337_12056773 | 3300025168 | Marine | SSDNVKNVYTSKAITDTRKLVTEGYIKITRQTQDVEIATEKATI |
Ga0209337_12674953 | 3300025168 | Marine | NVKNVYTSKAVTDVRRLCTEGYIKIERQTLDVEIQIEKLEI |
Ga0209337_13511271 | 3300025168 | Marine | YTNKAITDIRKLVTEGYIKITRQTQNVEIATEKASL |
Ga0208032_10690961 | 3300025266 | Deep Ocean | VKTVYTSKVSTDVRKLVTEGYITIARGTQDVSIATEKAGL |
Ga0208646_10411781 | 3300025425 | Saline Lake | YTSKAISDARKLVTEGYIKIDRRSQDVEIATEKAAL |
Ga0208768_10731073 | 3300025601 | Saline Lake | YTSKAVTDVRKLVTEGYIKITRQSQDVEIATEKATI |
Ga0208004_11508792 | 3300025630 | Aqueous | YSGASATVKTVYRNKAITDIRKLVTEGIIKINRSTQDVAINVEKAGL |
Ga0208134_11001493 | 3300025652 | Aqueous | TNVKGVYSNKAITDVRKLVTEGYIKIPRNSKDVQIVVEKATI |
Ga0209602_12003931 | 3300025704 | Pelagic Marine | SNNVKTVYTSKAISDVRKLVTEGYIKIERQSQNVEIATEKATL |
Ga0209362_10377015 | 3300025770 | Marine | NVYSNKAITDIRKLVTEGYVKIERQTQDVEIATEKATI |
Ga0208543_10549623 | 3300025810 | Aqueous | RNKAITDIRKLVTEGIIKINRSTQDVAINVEKAGL |
Ga0209630_101249164 | 3300025892 | Pelagic Marine | YTNKATTDIRKLVTEGYIKIQRATQDVEVATEKAGL |
Ga0209932_11161811 | 3300026183 | Pond Water | ASSTNVKNVYTNKAITDVRRLVTEGYIKIERQTQDVEIATEKATL |
Ga0208405_10729532 | 3300026189 | Marine | NATATTKTVYRNKVITDIRKLVNEGYVKIARENQDVAIVTEKANI |
Ga0208521_11221991 | 3300026204 | Marine | DTTKTVYRNKAITDIRKLVTEGYIKISRETQNVSIVTEKAGL |
Ga0209710_12780691 | 3300027687 | Marine | VYTNKATTDIRKLVTEGYIKVQRATQDVEISIEKAGL |
Ga0209815_11265883 | 3300027714 | Marine | TSKVSTDVRRLVTEGYITIARGTQDVSIATEKAGL |
Ga0209711_100801275 | 3300027788 | Marine | YTAKVSTDIRKLVTEGYIKVNRGTQDVSIATEKAGL |
Ga0209359_100770654 | 3300027830 | Marine | SVKTVYRNKAITDIRNLVTEGYIKIERDTLNVSVATEKAEL |
Ga0209359_103225801 | 3300027830 | Marine | EYTGSSDSVKTVYENKVITDIRKLVTEGYIKIVRQTQDVVIATEKASL |
Ga0209359_103727703 | 3300027830 | Marine | YAGSSDRVKNVYNNKAQTDIRKLVTEGYIKISRTTQDVEIAVEKATL |
Ga0209501_102788523 | 3300027844 | Marine | YGASSDNVKTVYTSKVSTDVRKLVTEGYIKIERGTQDVSIATEKAGL |
Ga0257108_11225511 | 3300028190 | Marine | GSSDTVKNVYTSKAITDIRKLVTEGYIKINKTTQDVTIATEKANL |
Ga0257106_11839041 | 3300028194 | Marine | YSGSSDNVKTVYTSKVITDIRKLVTEGYIKIARQSLDVEIATEKATL |
Ga0257106_12242562 | 3300028194 | Marine | DSTKTVYTSKAITNVRKLVIEGYVKITRDTQDVEIATEKATL |
Ga0308025_10301545 | 3300031143 | Marine | TDNVKTVYTSKVSTDVRRLVTEGYITIARGTQDVSIATEKAGL |
Ga0307488_107147052 | 3300031519 | Sackhole Brine | SDNIKNVYTSKAISDVRKLVTEGYIKIERQSQDVEIATEKAAL |
Ga0302134_100576695 | 3300031596 | Marine | SDNVKTVYTSKVSTDIRKLVTEGYIKIERGTQDVSIATEKAGL |
Ga0302134_103697362 | 3300031596 | Marine | KTVYTAKVSTDIRKLVTEGYIKVNRGTQDVSIATEKAGL |
Ga0302116_12397081 | 3300031597 | Marine | KNVYTSKAISDIRKLVTEGYIKIERQTQDVEIAIEKAAL |
Ga0302138_100223401 | 3300031637 | Marine | DNVKTVYTSKVSTDIRKLVTEGYIKIERGTQDVSIATEKAGL |
Ga0308008_10736341 | 3300031687 | Marine | VYTSKVSTDVRKLVTEGYITIARGTQDVSIATEKAGL |
Ga0308016_103553221 | 3300031695 | Marine | SSDNIKNVYTSKAITDTRKLVTEGYIKITRQTQDVELATEKATI |
Ga0307995_10468785 | 3300031696 | Marine | KTVYTSKVSTDVRRLVTEGYITIARGTQDVSIATEKAGL |
Ga0310122_103514143 | 3300031800 | Marine | TTKTVYRNKAITNIRKLITEEYIKINRTTQDVSIATEKVGL |
Ga0315316_106287893 | 3300032011 | Seawater | YTSKVNTDIRKLVTEGYIKIDRQTLDVEVATEKASL |
Ga0310345_101865595 | 3300032278 | Seawater | YSGSLDTTKTVYRAKANTDIRKLVTEGYIKINRDTQNVSITTEKANL |
⦗Top⦘ |