Metagenome Family F041777

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F041777
Family Type	Metagenome
Number of Sequences	159
Average Sequence Length	38 residues
Representative Sequence	MKKTLLYIALLFAGMLIAGTIDEQTRQLEQQPNHTTK
Number of Associated Samples	104
Number of Associated Scaffolds	159

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	1.26 %
% of genes near scaffold ends (potentially truncated)	11.32 %
% of genes from short scaffolds (< 2000 bps)	59.75 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (86.792 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (12.579 % of family members)
Environment Ontology (ENVO)	Unclassified (51.572 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (61.006 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 159 Family Scaffolds
PF08774	VRR_NUC	30.19
PF08299	Bac_DnaA_C	6.92
PF14550	Peptidase_S78_2	1.89
PF01555	N6_N4_Mtase	1.26
PF03237	Terminase_6N	1.26
PF00145	DNA_methylase	0.63
PF00959	Phage_lysozyme	0.63
PF13392	HNH_3	0.63
PF02195	ParBc	0.63
PF04860	Phage_portal	0.63
PF08282	Hydrolase_3	0.63

COG ID	Name	Functional Category	% Frequency in 159 Family Scaffolds
COG0593	Chromosomal replication initiation ATPase DnaA	Replication, recombination and repair [L]	6.92
COG0863	DNA modification methylase	Replication, recombination and repair [L]	1.26
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	1.26
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	1.26
COG0270	DNA-cytosine methylase	Replication, recombination and repair [L]	0.63
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	0.63
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	0.63
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	0.63
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.63
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	0.63

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.11 %
Unclassified	root	N/A	1.89 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	98.11 %
Unclassified	root	N/A	1.89 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	86.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.32 %
Unclassified	root	N/A	1.89 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	86.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.32 %
Unclassified	root	N/A	1.89 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	86.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.32 %
Unclassified	root	N/A	1.89 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	86.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.32 %
Unclassified	root	N/A	1.89 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	86.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.32 %
Unclassified	root	N/A	1.89 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	86.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.32 %
Unclassified	root	N/A	1.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352004\|2199904109	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	801	Open in IMG/M
3300001266\|B570J13884_100076	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11178	Open in IMG/M
3300001266\|B570J13884_103677	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1021	Open in IMG/M
3300001266\|B570J13884_104296	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	936	Open in IMG/M
3300001282\|B570J14230_10019991	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2457	Open in IMG/M
3300002161\|JGI24766J26685_10001627	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6651	Open in IMG/M
3300002269\|B570J29577_103512	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	878	Open in IMG/M
3300002408\|B570J29032_109627819	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	958	Open in IMG/M
3300002408\|B570J29032_109925415	All Organisms → Viruses → Predicted Viral	2831	Open in IMG/M
3300005581\|Ga0049081_10002984	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6386	Open in IMG/M
3300005581\|Ga0049081_10062283	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1404	Open in IMG/M
3300005582\|Ga0049080_10125174	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	867	Open in IMG/M
3300006484\|Ga0070744_10006990	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3384	Open in IMG/M
3300006484\|Ga0070744_10076735	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	969	Open in IMG/M
3300006802\|Ga0070749_10670905	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	555	Open in IMG/M
3300006805\|Ga0075464_10000229	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	24130	Open in IMG/M
3300006805\|Ga0075464_10012558	All Organisms → Viruses → Predicted Viral	4211	Open in IMG/M
3300006805\|Ga0075464_10057535	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2162	Open in IMG/M
3300006805\|Ga0075464_10074883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1912	Open in IMG/M
3300006805\|Ga0075464_10085907	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1791	Open in IMG/M
3300006920\|Ga0070748_1113527	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1026	Open in IMG/M
3300007555\|Ga0102817_1010972	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2060	Open in IMG/M
3300007708\|Ga0102859_1034081	All Organisms → Viruses → Predicted Viral	1377	Open in IMG/M
3300007708\|Ga0102859_1045814	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1204	Open in IMG/M
3300008107\|Ga0114340_1058562	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1661	Open in IMG/M
3300008113\|Ga0114346_1075689	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1601	Open in IMG/M
3300008113\|Ga0114346_1132602	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1091	Open in IMG/M
3300008261\|Ga0114336_1339455	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	544	Open in IMG/M
3300008262\|Ga0114337_1061296	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2666	Open in IMG/M
3300008266\|Ga0114363_1086536	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1155	Open in IMG/M
3300008267\|Ga0114364_1091483	All Organisms → Viruses → Predicted Viral	2129	Open in IMG/M
3300008448\|Ga0114876_1033171	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2500	Open in IMG/M
3300008448\|Ga0114876_1060105	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1667	Open in IMG/M
3300008448\|Ga0114876_1088327	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1267	Open in IMG/M
3300008448\|Ga0114876_1170983	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	769	Open in IMG/M
3300008450\|Ga0114880_1004201	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7788	Open in IMG/M
3300009068\|Ga0114973_10033655	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3090	Open in IMG/M
3300009082\|Ga0105099_10022645	All Organisms → Viruses → Predicted Viral	3217	Open in IMG/M
3300009082\|Ga0105099_10167129	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1246	Open in IMG/M
3300009152\|Ga0114980_10017603	All Organisms → Viruses → Predicted Viral	4492	Open in IMG/M
3300009152\|Ga0114980_10033368	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3176	Open in IMG/M
3300009155\|Ga0114968_10065534	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2291	Open in IMG/M
3300009155\|Ga0114968_10463827	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	684	Open in IMG/M
3300009158\|Ga0114977_10007883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6759	Open in IMG/M
3300009158\|Ga0114977_10101267	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1746	Open in IMG/M
3300009158\|Ga0114977_10236792	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1058	Open in IMG/M
3300009160\|Ga0114981_10629016	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	569	Open in IMG/M
3300009163\|Ga0114970_10012898	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5798	Open in IMG/M
3300009165\|Ga0105102_10133390	All Organisms → Viruses → Predicted Viral	1196	Open in IMG/M
3300009169\|Ga0105097_10000748	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	15125	Open in IMG/M
3300009169\|Ga0105097_10434122	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	731	Open in IMG/M
3300009183\|Ga0114974_10072335	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2260	Open in IMG/M
3300009185\|Ga0114971_10104957	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1725	Open in IMG/M
3300009194\|Ga0114983_1013816	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2273	Open in IMG/M
3300011334\|Ga0153697_1085	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30857	Open in IMG/M
3300011334\|Ga0153697_1161	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	23212	Open in IMG/M
3300011335\|Ga0153698_1180	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30608	Open in IMG/M
3300011338\|Ga0153699_1294	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	20378	Open in IMG/M
3300011339\|Ga0153700_11144	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11821	Open in IMG/M
3300012013\|Ga0153805_1022878	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1064	Open in IMG/M
3300012345\|Ga0157139_1000026	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6159	Open in IMG/M
3300012345\|Ga0157139_1001714	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1042	Open in IMG/M
3300012345\|Ga0157139_1011259	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	559	Open in IMG/M
3300012663\|Ga0157203_1042680	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	620	Open in IMG/M
3300012665\|Ga0157210_1001060	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9226	Open in IMG/M
3300012665\|Ga0157210_1004567	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2933	Open in IMG/M
3300012665\|Ga0157210_1005043	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2731	Open in IMG/M
3300012665\|Ga0157210_1009146	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1795	Open in IMG/M
3300012665\|Ga0157210_1027537	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	897	Open in IMG/M
3300012666\|Ga0157498_1047944	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	655	Open in IMG/M
3300012667\|Ga0157208_10000084	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31349	Open in IMG/M
3300013004\|Ga0164293_11043637	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	508	Open in IMG/M
3300013006\|Ga0164294_10002446	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16756	Open in IMG/M
3300017701\|Ga0181364_1060636	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	585	Open in IMG/M
3300017707\|Ga0181363_1044320	Not Available	810	Open in IMG/M
3300017707\|Ga0181363_1058197	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	682	Open in IMG/M
3300017716\|Ga0181350_1105718	Not Available	688	Open in IMG/M
3300017736\|Ga0181365_1044051	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1120	Open in IMG/M
3300017747\|Ga0181352_1005081	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4485	Open in IMG/M
3300017777\|Ga0181357_1079475	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1256	Open in IMG/M
3300017784\|Ga0181348_1151984	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	866	Open in IMG/M
3300017784\|Ga0181348_1152667	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	863	Open in IMG/M
3300017785\|Ga0181355_1262732	Not Available	659	Open in IMG/M
3300019781\|Ga0181360_100338	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3077	Open in IMG/M
3300019781\|Ga0181360_108540	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	860	Open in IMG/M
3300019781\|Ga0181360_120359	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	537	Open in IMG/M
3300019784\|Ga0181359_1000715	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7862	Open in IMG/M
3300019784\|Ga0181359_1053892	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1549	Open in IMG/M
3300019784\|Ga0181359_1063197	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1414	Open in IMG/M
3300019784\|Ga0181359_1153898	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	786	Open in IMG/M
3300019784\|Ga0181359_1194032	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	659	Open in IMG/M
3300019784\|Ga0181359_1206917	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	628	Open in IMG/M
3300020162\|Ga0211735_10389936	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	681	Open in IMG/M
3300020205\|Ga0211731_10477176	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1828	Open in IMG/M
3300020205\|Ga0211731_11275626	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	26664	Open in IMG/M
3300020492\|Ga0208483_1005389	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1737	Open in IMG/M
3300020528\|Ga0208224_1005312	All Organisms → Viruses → Predicted Viral	2148	Open in IMG/M
3300020548\|Ga0208856_1056629	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	503	Open in IMG/M
3300020572\|Ga0207909_1020940	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1178	Open in IMG/M
3300020572\|Ga0207909_1022613	All Organisms → Viruses → Predicted Viral	1121	Open in IMG/M
3300020572\|Ga0207909_1022853	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1113	Open in IMG/M
3300020573\|Ga0208485_1048803	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	760	Open in IMG/M
3300020575\|Ga0208053_1032461	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1005	Open in IMG/M
3300021962\|Ga0222713_10027412	All Organisms → Viruses → Predicted Viral	4655	Open in IMG/M
3300021962\|Ga0222713_10596411	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	645	Open in IMG/M
3300021963\|Ga0222712_10036909	All Organisms → Viruses → Predicted Viral	3785	Open in IMG/M
3300021963\|Ga0222712_10158408	All Organisms → Viruses → Predicted Viral	1520	Open in IMG/M
3300022179\|Ga0181353_1007805	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2613	Open in IMG/M
3300024346\|Ga0244775_10023499	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5560	Open in IMG/M
3300024346\|Ga0244775_10034950	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4451	Open in IMG/M
3300025896\|Ga0208916_10034861	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2033	Open in IMG/M
3300025896\|Ga0208916_10070231	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1456	Open in IMG/M
3300025896\|Ga0208916_10175820	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	924	Open in IMG/M
3300027365\|Ga0209300_1013695	All Organisms → Viruses → Predicted Viral	2047	Open in IMG/M
3300027608\|Ga0208974_1070015	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	975	Open in IMG/M
3300027721\|Ga0209492_1167411	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	763	Open in IMG/M
3300027733\|Ga0209297_1000354	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30028	Open in IMG/M
3300027733\|Ga0209297_1063904	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1636	Open in IMG/M
3300027736\|Ga0209190_1010001	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5702	Open in IMG/M
3300027746\|Ga0209597_1291335	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	629	Open in IMG/M
3300027759\|Ga0209296_1187196	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	898	Open in IMG/M
3300027763\|Ga0209088_10004205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8426	Open in IMG/M
3300027805\|Ga0209229_10250743	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	787	Open in IMG/M
3300027805\|Ga0209229_10432629	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	568	Open in IMG/M
3300027900\|Ga0209253_10472348	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	940	Open in IMG/M
3300027963\|Ga0209400_1001802	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16761	Open in IMG/M
3300027973\|Ga0209298_10000951	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19261	Open in IMG/M
3300028025\|Ga0247723_1000353	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31566	Open in IMG/M
3300028025\|Ga0247723_1015712	All Organisms → Viruses → Predicted Viral	2703	Open in IMG/M
3300031707\|Ga0315291_11179692	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	628	Open in IMG/M
3300031707\|Ga0315291_11483701	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	535	Open in IMG/M
3300031772\|Ga0315288_10741764	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	918	Open in IMG/M
3300031784\|Ga0315899_10007566	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11669	Open in IMG/M
3300031784\|Ga0315899_11324799	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	615	Open in IMG/M
3300031787\|Ga0315900_11069265	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	523	Open in IMG/M
3300031857\|Ga0315909_10191244	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1633	Open in IMG/M
3300031885\|Ga0315285_10227214	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1462	Open in IMG/M
3300031885\|Ga0315285_10443148	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	912	Open in IMG/M
3300031951\|Ga0315904_10052049	All Organisms → Viruses → Predicted Viral	4558	Open in IMG/M
3300031952\|Ga0315294_10604036	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	981	Open in IMG/M
3300031952\|Ga0315294_11606217	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	503	Open in IMG/M
3300031963\|Ga0315901_10916572	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	622	Open in IMG/M
3300031999\|Ga0315274_10558678	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1276	Open in IMG/M
3300032046\|Ga0315289_10217045	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2068	Open in IMG/M
3300032053\|Ga0315284_12060617	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	575	Open in IMG/M
3300032092\|Ga0315905_10635449	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	958	Open in IMG/M
3300032116\|Ga0315903_10632880	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	814	Open in IMG/M
3300032397\|Ga0315287_11334874	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	819	Open in IMG/M
3300032516\|Ga0315273_11439409	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	851	Open in IMG/M
3300033995\|Ga0335003_0016017	All Organisms → Viruses → Predicted Viral	3999	Open in IMG/M
3300033996\|Ga0334979_0000492	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30099	Open in IMG/M
3300034019\|Ga0334998_0025068	All Organisms → Viruses → Predicted Viral	4340	Open in IMG/M
3300034064\|Ga0335001_0011877	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5149	Open in IMG/M
3300034064\|Ga0335001_0049610	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2434	Open in IMG/M
3300034104\|Ga0335031_0041384	All Organisms → Viruses → Predicted Viral	3340	Open in IMG/M
3300034104\|Ga0335031_0206968	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1325	Open in IMG/M
3300034104\|Ga0335031_0338229	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	966	Open in IMG/M
3300034104\|Ga0335031_0757640	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	549	Open in IMG/M
3300034167\|Ga0335017_0003801	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7906	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	97.48%
Terrestrial	Environmental → Terrestrial	2.52%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	84.28%
Marine	Environmental → Aquatic → Marine	13.21%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.52%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	37.74%
Lentic	Environmental → Aquatic → Freshwater → Lentic	27.67%
Lotic	Environmental → Aquatic → Freshwater → Lotic	9.43%
Coastal	Environmental → Aquatic → Marine → Coastal	6.29%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	5.03%
Unclassified	Environmental → Aquatic → Marine → Unclassified	5.03%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.77%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.52%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.89%
Ice	Environmental → Aquatic → Freshwater → Ice	0.63%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	30.19%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	19.50%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	9.43%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	7.55%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	7.55%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	6.29%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	5.03%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	5.03%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.77%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.52%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.89%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.63%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.63%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	12.58%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	12.58%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	9.43%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	7.55%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	7.55%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	7.55%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	6.29%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	5.03%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	4.40%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	3.77%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	3.14%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	2.52%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.52%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.52%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	2.52%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.89%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.89%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.89%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.26%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	1.26%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.63%
Freshwater, Surface Ice	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice	0.63%
Surface Ice	Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice	0.63%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352004	Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion	Environmental	Open in IMG/M
3300001266	Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion	Environmental	Open in IMG/M
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300002269	Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006920	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12	Environmental	Open in IMG/M
3300007555	Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555	Environmental	Open in IMG/M
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008262	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009185	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG	Environmental	Open in IMG/M
3300009194	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT	Environmental	Open in IMG/M
3300011334	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung	Environmental	Open in IMG/M
3300011335	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman	Environmental	Open in IMG/M
3300011338	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Haengju	Environmental	Open in IMG/M
3300011339	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam	Environmental	Open in IMG/M
3300012013	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice	Environmental	Open in IMG/M
3300012345	Freshwater microbial communities from Burnt River, Ontario, Canada - S22	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300012666	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2	Environmental	Open in IMG/M
3300012667	Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300019781	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020492	Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020528	Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020548	Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020572	Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020573	Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020575	Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027365	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027973	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300031707	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20	Environmental	Open in IMG/M
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032046	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033995	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034019	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049	Environmental	Open in IMG/M
3300034064	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034167	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2200081745	2199352004	Freshwater	MKKTLLFIAMLFAGMLIAGTIDESTRQLESQPNHTTK
B570J13884_10007613	3300001266	Freshwater	VAGNISKQLNPNNQMKKTLLFIAMLFLGMLIAGTIDESTKQLEQQPNTTNK*
B570J13884_1036773	3300001266	Freshwater	MKKQLLYIALLFGAMLIAGTIDEQTRQLEQTPNTTNK*
B570J13884_1042963	3300001266	Freshwater	MKKQLLYIALLFAAMLIAGTIDEQTRQLEQTPNHTTK*
B570J14230_100199916	3300001282	Freshwater	MKKQLLYIAILFAGMLIAGTIDEQTRQLEQTPNHTTK*
JGI24766J26685_100016275	3300002161	Freshwater And Sediment	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQQPNHTTK*
B570J29577_1035122	3300002269	Freshwater	MKKTLLFIALLFGAMLIAGTIDEQTRQLEQTPNHTTKK
B570J29032_1096278193	3300002408	Freshwater	MKKTLLFIALVFGAMLIAGTIDEQTRQLEQQPNHTTKVNL
B570J29032_1099254158	3300002408	Freshwater	MKKQLLYIALLFGAMLIAGTIDEQTRQLEQQPNHYTK*
Ga0049081_100029845	3300005581	Freshwater Lentic	MKKTLLYIAILFAGMLIAGTIDEQTRILEQQPNTTNK*
Ga0049081_100622834	3300005581	Freshwater Lentic	MKKQLLFIFMLIAGMLIAGTIDEQTRILEQTPNHTTK*
Ga0049080_101251744	3300005582	Freshwater Lentic	LKPNNQMKKQLLYIALLFAAMLIAGTIDEQTRILEQQPNTINK*
Ga0070744_100069903	3300006484	Estuarine	MKKTLLYIALLFAGMLIAGTIDEQTRQLEQQPNHTTK*
Ga0070744_100767352	3300006484	Estuarine	MKKQLLYIALLFGAMLIAGTIDEQTRILEQQPNTTNK*
Ga0070749_106709051	3300006802	Aqueous	NNQMKKTLLFIAMLFLGMLIAGSIDESTRQLEQQPNTINK*
Ga0075464_1000022922	3300006805	Aqueous	MKKTLLFIALLFGAMLIAGTIDEQTRQLEQQPNHYTK*
Ga0075464_100125582	3300006805	Aqueous	MKKTLLYIALLFGAMLIAGTIDEQTRILEQQPNHTIK*
Ga0075464_100575353	3300006805	Aqueous	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQTPNHTTK*
Ga0075464_100748834	3300006805	Aqueous	MKKTLLYIALLFGAMLIAGTIDEQTRQLEQTPNTISK*
Ga0075464_100859075	3300006805	Aqueous	MKKTLLYIALLFGAMLIAGTIDEQTRILEQQPNTTNK*
Ga0070748_11135272	3300006920	Aqueous	MKKTLLFIALLFGAMLIAGTIDESTRILEQQPNHTTK*
Ga0102817_10109723	3300007555	Estuarine	MKKQLLYIALLFGAMLIAGTIDEQTRQLEQQPNHTTK*
Ga0102859_10340815	3300007708	Estuarine	MKKTLLYIALLFGAMLIAGTIDEQTRQLEQQPNHTTK*
Ga0102859_10458143	3300007708	Estuarine	MKKQLLYIALLFAAMLIAGTIDEQTRILEQTPNHTNK*
Ga0114340_10585625	3300008107	Freshwater, Plankton	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQQPNHISK*
Ga0114346_10756892	3300008113	Freshwater, Plankton	MKKTLLFIAMLFLGMLIAGSIDEQTRQLEQTSNHTTK*
Ga0114346_11326022	3300008113	Freshwater, Plankton	MKKTLLFIALLFGAMLIAGTIDEQTRQLEQQPNHTTK*
Ga0114336_13394553	3300008261	Freshwater, Plankton	KKQLLFIFMLIAGMLIAGTIDEQTRQLEQQPNHYSK*
Ga0114337_10612965	3300008262	Freshwater, Plankton	MKKTLLFIALLFAGMLIAGSIDESTRQLEQTPNHTTK*
Ga0114363_10865363	3300008266	Freshwater, Plankton	MKTNNQMKKTLLFIALLFGAMLIAGTIDEQTRQLEQQPNHTTK*
Ga0114364_10914834	3300008267	Freshwater, Plankton	MKKQLLFIFMLIAGMLIAGTIDEQTRQLEQQPNHYSK*
Ga0114876_10331713	3300008448	Freshwater Lake	MKKTLLFIAMLFAAMLIAGTIDEQTRQLEQQPNHISK*
Ga0114876_10601053	3300008448	Freshwater Lake	VAGNKLKQLKPNNQMKKTLLFIALLFGAMLIAGTIDEQTRILEQQPNHIIK*
Ga0114876_10883272	3300008448	Freshwater Lake	MKKTLLFIALLFAGMLIAGTIDEQTRQLEQQPNHTTK*
Ga0114876_11709833	3300008448	Freshwater Lake	MKTNNQMKKTLLYIALLFGAMLIAGTIDEQTRQLEQQPNHYSK*
Ga0114880_100420110	3300008450	Freshwater Lake	MKKTLLFIALLFGAMLIAGTIDESTRQLEQTPNTTNK*
Ga0114973_100336553	3300009068	Freshwater Lake	MKKQLLYIALLFGAMLIAGTIDEQTRILEQTPNHTTK*
Ga0105099_100226451	3300009082	Freshwater Sediment	NSMKKTLLFIALLFAGMLIAGTIDESTRQLEQQPNHTSK*
Ga0105099_101671291	3300009082	Freshwater Sediment	MKKTLLFIAMLFAAMLIAGTIDEQTRQLESQPNTINK*
Ga0114980_1001760310	3300009152	Freshwater Lake	MKKTLLYIAILFAGMLIAGTIDESTRQLEQQPNNTISK*
Ga0114980_100333688	3300009152	Freshwater Lake	MKKTLLYIAILFAGMLIAGTIDEQTRQLEQTPKHINK*
Ga0114968_100655343	3300009155	Freshwater Lake	MKKQLLYIAILFAGMLIAGTIDESTRQLEQQPNTTNK*
Ga0114968_104638272	3300009155	Freshwater Lake	MKKQLLYIALLFAGMLIAGTIDEQTRQLEQQPNHTTK*
Ga0114977_100078835	3300009158	Freshwater Lake	MKKQLLYIALLFAAMLIAGTIDEQTRQLEQQPNHYTK*
Ga0114977_101012673	3300009158	Freshwater Lake	MKKTLLYIALLFGAMLIAGTIDEQTRQLEQQPNHINK*
Ga0114977_102367922	3300009158	Freshwater Lake	MKKTLLFIAMLFAGMLIGGTIDEQTRQLEQQPNTTNK*
Ga0114981_106290163	3300009160	Freshwater Lake	SKSFNTLNQMKKTLLFIAMLFAGMLIGGTIDEQTRQLEQQPNHYTK*
Ga0114970_1001289811	3300009163	Freshwater Lake	MKKTLLFIALLFGAMLIAGTIDEQTRILEQQPNTINK*
Ga0105102_101333902	3300009165	Freshwater Sediment	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQTPNTINK*
Ga0105097_1000074818	3300009169	Freshwater Sediment	MKKTLLFIALLFGAMLIAGSIDESTRQLEQTPNHTTK*
Ga0105097_104341223	3300009169	Freshwater Sediment	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQTPNHISK*
Ga0114974_100723354	3300009183	Freshwater Lake	MKKTIIYIAILFAGMLIAGTIDESTRQLEQTPNHTTK*
Ga0114971_101049574	3300009185	Freshwater Lake	MKKTLLYIAILFAAMLIAGTIDEQTRQLEQQPNTTNK*
Ga0114983_10138162	3300009194	Deep Subsurface	MKKTLLFIALLFAGMLIAGTIDESTRQLEQTPNHTTK*
Ga0153697_108520	3300011334	Freshwater	MKKQLLYIALLFGAMLIAGTIDEQTRQLEQTPNHTTK*
Ga0153697_116114	3300011334	Freshwater	MKKTLLFIAMLFAGMLIAGTIDESTRQLEQTPNTINK*
Ga0153698_118017	3300011335	Freshwater	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQTPNTTNK*
Ga0153699_129435	3300011338	Freshwater	MKKTLLYIALLFAAMLIAGTIDEQTRQLEQQPNHISK*
Ga0153700_1114412	3300011339	Freshwater	MKKTLLFIAMLFAGMLIAGTIDESTRQLEQTPNHTTK*
Ga0153805_10228782	3300012013	Surface Ice	MKKQLLYIAILFAGMLIAGTIDEQTRILEQQPNTTNK*
Ga0157139_10000269	3300012345	Freshwater	MKKTLLFIALLFGAMLIAGTIDESTRQLEQQPNTTK*
Ga0157139_10017143	3300012345	Freshwater	MKKTLLFIAMLFGAMLIAGTIDEQTRQLEQQPNTINK*
Ga0157139_10112592	3300012345	Freshwater	INQMKKTLLFIALLFGAMLIAGTIDESTRQLESQPNHISE*
Ga0157203_10426803	3300012663	Freshwater	MKKTLLFIALLFGAMLIAGTIDESTRQLEQQPNTINK*
Ga0157210_100106012	3300012665	Freshwater	MKKTLIYIAILFAAMLIAGTIDESTRQLEQTPNHTTNK*
Ga0157210_10045675	3300012665	Freshwater	MKKTLLFIAMLFAGMLIAGTIDESTRQLEQTPNTISK*
Ga0157210_10050436	3300012665	Freshwater	MKKTLLFIAMLFGAMLIAGTIDESTRQLEQQPNTINK*
Ga0157210_10091464	3300012665	Freshwater	MKKTLLFIALLFGAMLIAGTIDEQTRQLEQQPNTINK*
Ga0157210_10275373	3300012665	Freshwater	MKKTLLFIAMIFAGMLIAGTIDEQTRILEQQPNTINK*
Ga0157498_10479442	3300012666	Freshwater, Surface Ice	MKKTLLYIALLFGAMLIAGTIDEQTRQLEQQPNHYSK*
Ga0157208_1000008415	3300012667	Freshwater	MKKTLLFIAMLFAGMLIAGTIDESTRQLEQQPNHTTK*
Ga0164293_110436371	3300013004	Freshwater	MKPNNQMKKQLLYIALLFGAMLIAGTIDEQTRILEQQPNTTNK*
Ga0164294_1000244613	3300013006	Freshwater	MKKTLLYIAILFAGMLIAGTIDEQTRILEQTPNTTNK*
Ga0181364_10606361	3300017701	Freshwater Lake	MKKTLLYIAILFAGMLIAGTIDEQTRQLEQTPNHTTK
Ga0181363_10443202	3300017707	Freshwater Lake	MKKQLLYIALLFGAMLIAGTIDEQTRQLEQQPNTINK
Ga0181363_10581973	3300017707	Freshwater Lake	MKKTLFFIAALFAGMLIAGTIDESTRQLEQQPNTTNK
Ga0181350_11057182	3300017716	Freshwater Lake	MKKQLLYIAILFAAMLIAGTIDEQTRILEQQPNTTNK
Ga0181365_10440512	3300017736	Freshwater Lake	MKKQLLYIAILFAGMLIAGTIDEQTRILEQQPNTTNK
Ga0181352_10050814	3300017747	Freshwater Lake	MKKTLLFIAMLFAGMLIAGSIDESTRQLEQQLNTINK
Ga0181357_10794754	3300017777	Freshwater Lake	MKKQLLYIAILFAGMLIAGTIDEQTRILEQQPNTINK
Ga0181348_11519844	3300017784	Freshwater Lake	MKKTLLYIAILFAGMLSAGTIDEQTRILEQQPNTTNK
Ga0181348_11526674	3300017784	Freshwater Lake	MKKQLLYIAILFAGMLIAGTIDESTRQLEQKPNHYTK
Ga0181355_12627323	3300017785	Freshwater Lake	MKKQLLYIAILFAGMLIAGTIDEQTRILEQQPNTT
Ga0181360_1003384	3300019781	Freshwater Lake	MKKTLLYIAILFAGMLIAGTIDEQTRQLEQQPNTTNK
Ga0181360_1085402	3300019781	Freshwater Lake	MKKTLLYIAILFAGMLIAGTIDEQTRILEQTPNTTNK
Ga0181360_1203591	3300019781	Freshwater Lake	MKKTLLYIAILFAAMLIAGTIDEQTRILEQQPNTTNK
Ga0181359_100071518	3300019784	Freshwater Lake	MKKQLLYIAILFAAMLIAGTIDEQTRILEQTPNTTNK
Ga0181359_10538923	3300019784	Freshwater Lake	MKKTLLYIAILFAGMLIAGTIDEQTRQLEQQPNTINK
Ga0181359_10631971	3300019784	Freshwater Lake	MKKTLLYIAILFAGMLIAGTIDEQTRQLEQQPNHYTK
Ga0181359_11538981	3300019784	Freshwater Lake	MKKTLLYIAILFAGMLIAGTIDEQTRILEQQPNTTNK
Ga0181359_11940322	3300019784	Freshwater Lake	MKKQLLYIAILFAAMLIAGTIDEQTRQLEQTPNTTNK
Ga0181359_12069172	3300019784	Freshwater Lake	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQTPNHISK
Ga0211735_103899362	3300020162	Freshwater	MKKTLLFIAMLFAGMLIAGTIDESTRQLEQTPNNTTK
Ga0211731_104771761	3300020205	Freshwater	MKKTLLYIALLFGAMLIAGTIDESTRQLEQQPNHYTK
Ga0211731_1127562629	3300020205	Freshwater	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQTPKHINK
Ga0208483_10053894	3300020492	Freshwater	MKKTLLFIALVFGAMLIAGTIDEQTRQLEQQPNHTTK
Ga0208224_10053123	3300020528	Freshwater	MKKTLLFIALLFGAMLIAGTIDEQTRQLESQPNTINK
Ga0208856_10566291	3300020548	Freshwater	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQTPNHTTK
Ga0207909_10209403	3300020572	Freshwater	MKKQLLYIALLFGAMLIAGTIDEQTRQLEQTPNTTNK
Ga0207909_10226134	3300020572	Freshwater	MKKQLLYIALLFAAMLIAGTIDEQTRQLEQTPNHTTK
Ga0207909_10228534	3300020572	Freshwater	MKKTLIYIALLFAAMLIAGTIDESTRQLEQTPNHTTK
Ga0208485_10488032	3300020573	Freshwater	MKKQLLYIALLFGAMLIAGTIDEQTRQLEQQPNHYSK
Ga0208053_10324612	3300020575	Freshwater	MKKQLLYIAILFAGMLIAGTIDEQTRQLEQTPNHTTK
Ga0222713_100274124	3300021962	Estuarine Water	MKKQLLYIALLFAAMLIAGTIDEQTRILEQQPNTINK
Ga0222713_105964111	3300021962	Estuarine Water	SKSYKSIINQMKKTLLFIAMLFAAMLIAGTIDEQTRQLEQQPNHISK
Ga0222712_1003690910	3300021963	Estuarine Water	MKKTLLFIAMLFAAMLIAGTIDEQTRQLEQQPNHTTK
Ga0222712_101584085	3300021963	Estuarine Water	MKKTLLFIAMLFAAMLIAGTIDEQTRQLEQQPNHISK
Ga0181353_10078053	3300022179	Freshwater Lake	MKKTLLYIALLFAGMLIAGTIDEQTRQLEQTPNHTTK
Ga0244775_100234998	3300024346	Estuarine	MKKTLLYIALLFAGMLIAGTIDEQTRQLEQQPNHTTK
Ga0244775_100349506	3300024346	Estuarine	MKKQLLYIALLFGAMLIAGTIDEQTRILEQQPNTTNK
Ga0208916_100348615	3300025896	Aqueous	LNSNNQMKKTLLYIALLFGAMLIAGTIDEQTRILEQQPNHTIK
Ga0208916_100702314	3300025896	Aqueous	MKKTLLYIALLFGAMLIAGTIDEQTRILEQQPNTTNK
Ga0208916_101758203	3300025896	Aqueous	MKKTLLYIALLFGAMLIAGTIDEQTRQLEQTPNTISK
Ga0209300_10136956	3300027365	Deep Subsurface	TLNTMKKTLLFIALLFAGMLIAGTIDESTRQLEQTPNHTTK
Ga0208974_10700153	3300027608	Freshwater Lentic	MKKQLLFIFMLIAGMLIAGTIDEQTRILEQTPNHTTK
Ga0209492_11674113	3300027721	Freshwater Sediment	MKKTLLFIAMLFAGMLIAGTIDEQTRQLEQTPNTINK
Ga0209297_100035426	3300027733	Freshwater Lake	MKKQLLYIALLFAAMLIAGTIDEQTRQLEQQPNHYTK
Ga0209297_10639043	3300027733	Freshwater Lake	MKKTLLYIALLFGAMLIAGTIDEQTRQLEQQPNHINK
Ga0209190_10100015	3300027736	Freshwater Lake	MKKTLLFIALLFGAMLIAGTIDEQTRILEQQPNTINK
Ga0209597_12913352	3300027746	Freshwater Lake	MKKTLLYIAILFAAMLIAGTIDEQTRQLEQQPNTTNK
Ga0209296_11871963	3300027759	Freshwater Lake	MKKTIIYIAILFAGMLIAGTIDESTRQLEQTPNHTTK
Ga0209088_100042054	3300027763	Freshwater Lake	MKKTLLFIAMLFAGMLIGGTIDEQTRQLEQQPNTTNK
Ga0209229_102507433	3300027805	Freshwater And Sediment	MKKQLLYIAILFAGMLIAGTIDESTRQLEQTPNTTNK
Ga0209229_104326292	3300027805	Freshwater And Sediment	MKKTLLFIAALFAGMLIAGTIDEQTRQLEQQPNTINK
Ga0209253_104723482	3300027900	Freshwater Lake Sediment	MKKQLLYIALLFGAMLIAGTIDEQTRILEQQPNTINK
Ga0209400_100180219	3300027963	Freshwater Lake	MKKQLLYIAILFAGMLIAGTIDESTRQLEQQPNTTNK
Ga0209298_100009513	3300027973	Freshwater Lake	MKKTLLYIAILFAGMLIAGTIDESTRQLEQQPNNTISK
Ga0247723_100035323	3300028025	Deep Subsurface Sediment	MKTNNQMKKTLLFIALLFGAMLIAGTIDEQTRQLEQQPNTINK
Ga0247723_10157126	3300028025	Deep Subsurface Sediment	MKKTLLYIALLFGAMLIAGTIDEQTRQLEQQPNHYTK
Ga0315291_111796923	3300031707	Sediment	KALLYIALLFAAMLIAGTIDEQTRQLEQQPNTINK
Ga0315291_114837012	3300031707	Sediment	MKKQLLYIALLFAAMLIAGTIDEQTRQLEQQPNTTNK
Ga0315288_107417643	3300031772	Sediment	MKKALLYIALLFAAMLIAGTIDEQTRQLEQQPNTINK
Ga0315899_1000756616	3300031784	Freshwater	MKKTLLFIAMLFAGMLIAGSIDESTRQLEQTPNHTTK
Ga0315899_113247992	3300031784	Freshwater	MKTNNQMKKQLLFIFMLIAGMLIAGTIDEQTRQLEQQPNHYSK
Ga0315900_110692652	3300031787	Freshwater	MKKTLLFIALLFGAMLIAGTIDEQTRQLEQQPNHTTKXTQE
Ga0315909_101912444	3300031857	Freshwater	MKKTLLFIAMLFLGMLIAGSIDEQTRQLEQTSNHTTK
Ga0315285_102272145	3300031885	Sediment	MKKTLLYIALLFAAMLIAGTIDEQTRQLEQQPNTINK
Ga0315285_104431481	3300031885	Sediment	KMKKTLIYIALLFGAMLIAGTIDEQTRQLEQTPNHYSK
Ga0315904_100520494	3300031951	Freshwater	MKKTLLFIAMLFAGMLIAGTIDESTRQLEQTPNTISK
Ga0315294_106040362	3300031952	Sediment	MKKALLYIALLFAAMLIAGTIDEQTRILEQQPNTINK
Ga0315294_116062172	3300031952	Sediment	MKKQLLYIAILFAGMLIAGTIDEQTRQLEQQPNTINK
Ga0315901_109165721	3300031963	Freshwater	PNNQMKKTLLFIAMLFAGMLIAGTIDEQTRQLEQQPNHISK
Ga0315274_105586784	3300031999	Sediment	MKKALLYIALLFGAMLIAGTIDEQTRQLEQQPNTINK
Ga0315289_102170454	3300032046	Sediment	MKKTLIYIALLFGAMLIAGTIDEQTRILEQQPNTINK
Ga0315284_120606173	3300032053	Sediment	MKKQLLYIALLFAAMLIAGTIDEQTRQLEQQPNTI
Ga0315905_106354492	3300032092	Freshwater	MKKTLLFIALLFGAMLIAGTIDESTRQLEQTPNTTNK
Ga0315903_106328802	3300032116	Freshwater	MKTNNQMKKTLLFIALLFGAMLIAGTIDEQTRQLEQQPNHTTK
Ga0315287_113348741	3300032397	Sediment	KKTLLYIAILFAGMLIAGTIDEQTRILEQTPNHTTK
Ga0315273_114394094	3300032516	Sediment	PKQNVSSNKNSMKKQLLYIALLFGAMLIAGTIDEQTRILEQQPNTINK
Ga0335003_0016017_3_134	3300033995	Freshwater	QITNNKMKKTLLYIALLFGAMLIAGTIDEQTRQLEQQPNHYTK
Ga0334979_0000492_10824_10955	3300033996	Freshwater	MKPNNQMKKQLLYIALLFGAMLIAGTIDEQTRQLEQQPNHYSK
Ga0334998_0025068_3756_3869	3300034019	Freshwater	MKKTLLFIALLFAGMLIAGTIDEQTRILEQQPNHISK
Ga0335001_0011877_2097_2210	3300034064	Freshwater	MKKTLLYIAILFAGMLIAGTIDEQTRQLEQQPNHYSK
Ga0335001_0049610_537_650	3300034064	Freshwater	MKKTLLFIALLFGAMLIAGTIDEQTRQLEQQPNTINK
Ga0335031_0041384_765_878	3300034104	Freshwater	MKKTLLFIALLFGAMLIAGTIDESTRQLEQQPNTTNK
Ga0335031_0206968_682_795	3300034104	Freshwater	MKKTLLFIAMLFLGMLIAGTIDESTRQLEQTPKHTTK
Ga0335031_0338229_74_187	3300034104	Freshwater	MKKTLLFIALLFGAMLIAGTIDEQTRILEQQPNHISK
Ga0335031_0757640_327_440	3300034104	Freshwater	MKKTLLFIALLFGAMLIAGTIDESTRQLEQTPKHINK
Ga0335017_0003801_970_1080	3300034167	Freshwater	MKKTLIYIAILFAGMLIAGTIDEQTRQLEQQPNTTK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F041777

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences