NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041502

Metagenome / Metatranscriptome Family F041502

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041502
Family Type Metagenome / Metatranscriptome
Number of Sequences 160
Average Sequence Length 46 residues
Representative Sequence MRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Number of Associated Samples 130
Number of Associated Scaffolds 160

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.50 %
% of genes near scaffold ends (potentially truncated) 25.62 %
% of genes from short scaffolds (< 2000 bps) 88.12 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(34.375 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(40.625 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.48%    β-sheet: 0.00%    Coil/Unstructured: 53.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 160 Family Scaffolds
PF01795Methyltransf_5 53.12
PF02381MraZ 33.12
PF14279HNH_5 8.75
PF07726AAA_3 1.88
PF03717PBP_dimer 0.62
PF00478IMPDH 0.62
PF14579HHH_6 0.62
PF01844HNH 0.62
PF08245Mur_ligase_M 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 160 Family Scaffolds
COG027516S rRNA C1402 N4-methylase RsmHTranslation, ribosomal structure and biogenesis [J] 53.12
COG2001MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activityTranslation, ribosomal structure and biogenesis [J] 33.12
COG0768Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2)Cell cycle control, cell division, chromosome partitioning [D] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.50 %
UnclassifiedrootN/A2.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_176951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria833Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0849761All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300000443|F12B_10078509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2287Open in IMG/M
3300000550|F24TB_10930553All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300000858|JGI10213J12805_10581994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300000858|JGI10213J12805_10966396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300000955|JGI1027J12803_101988247All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300001431|F14TB_100116199Not Available514Open in IMG/M
3300004114|Ga0062593_102798526All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300004463|Ga0063356_106259681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300005161|Ga0066807_1001660All Organisms → cellular organisms → Bacteria1661Open in IMG/M
3300005406|Ga0070703_10126050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales935Open in IMG/M
3300005471|Ga0070698_100198827All Organisms → cellular organisms → Bacteria1940Open in IMG/M
3300006058|Ga0075432_10295448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300006572|Ga0074051_10014905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3602Open in IMG/M
3300006576|Ga0074047_12056480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300006844|Ga0075428_100274600All Organisms → cellular organisms → Bacteria1813Open in IMG/M
3300006845|Ga0075421_100020835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8241Open in IMG/M
3300006845|Ga0075421_102688134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300006847|Ga0075431_100219386All Organisms → cellular organisms → Bacteria1940Open in IMG/M
3300006853|Ga0075420_100485061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1068Open in IMG/M
3300006865|Ga0073934_10034625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4745Open in IMG/M
3300006880|Ga0075429_100247609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae1560Open in IMG/M
3300006880|Ga0075429_101039903All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300009100|Ga0075418_10027663All Organisms → cellular organisms → Bacteria6194Open in IMG/M
3300009146|Ga0105091_10063931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1650Open in IMG/M
3300009147|Ga0114129_11364409Not Available876Open in IMG/M
3300009157|Ga0105092_10544714All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300009157|Ga0105092_10629562All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300009168|Ga0105104_10052862All Organisms → cellular organisms → Bacteria2211Open in IMG/M
3300009168|Ga0105104_10286252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria904Open in IMG/M
3300009801|Ga0105056_1039908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300009804|Ga0105063_1039588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300009810|Ga0105088_1020182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M
3300009810|Ga0105088_1022598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium990Open in IMG/M
3300009811|Ga0105084_1004812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1875Open in IMG/M
3300009811|Ga0105084_1093502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300009814|Ga0105082_1024590Not Available931Open in IMG/M
3300009816|Ga0105076_1073405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300009817|Ga0105062_1007030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1690Open in IMG/M
3300009818|Ga0105072_1006529All Organisms → cellular organisms → Bacteria1992Open in IMG/M
3300009823|Ga0105078_1002782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1602Open in IMG/M
3300010029|Ga0105074_1034913Not Available865Open in IMG/M
3300010041|Ga0126312_10716182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300010166|Ga0126306_10464527All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300010375|Ga0105239_10749316All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300011000|Ga0138513_100006953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1323Open in IMG/M
3300011405|Ga0137340_1114462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300011439|Ga0137432_1148391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M
3300011444|Ga0137463_1105997All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300012159|Ga0137344_1027214All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300012204|Ga0137374_10240810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1524Open in IMG/M
3300012204|Ga0137374_10624494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium819Open in IMG/M
3300012353|Ga0137367_11093036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300012355|Ga0137369_10106170All Organisms → cellular organisms → Bacteria2295Open in IMG/M
3300012355|Ga0137369_10165711All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300012360|Ga0137375_10919238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria694Open in IMG/M
3300012532|Ga0137373_10307964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1257Open in IMG/M
3300012937|Ga0162653_100021352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria875Open in IMG/M
3300015258|Ga0180093_1132751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300017965|Ga0190266_10175889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium994Open in IMG/M
3300017997|Ga0184610_1023900All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300017997|Ga0184610_1031104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1498Open in IMG/M
3300017997|Ga0184610_1071587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300018028|Ga0184608_10000255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13690Open in IMG/M
3300018028|Ga0184608_10501904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300018031|Ga0184634_10049720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1729Open in IMG/M
3300018031|Ga0184634_10067410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1514Open in IMG/M
3300018051|Ga0184620_10022843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1574Open in IMG/M
3300018052|Ga0184638_1229156All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300018056|Ga0184623_10068994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1625Open in IMG/M
3300018063|Ga0184637_10109661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1700Open in IMG/M
3300018071|Ga0184618_10048227All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300018072|Ga0184635_10036183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1873Open in IMG/M
3300018072|Ga0184635_10099197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1151Open in IMG/M
3300018073|Ga0184624_10045198All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300018073|Ga0184624_10380579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300018074|Ga0184640_10062879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1557Open in IMG/M
3300018076|Ga0184609_10103174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1283Open in IMG/M
3300018078|Ga0184612_10503330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300018079|Ga0184627_10031210All Organisms → cellular organisms → Bacteria2687Open in IMG/M
3300018081|Ga0184625_10078415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1688Open in IMG/M
3300018081|Ga0184625_10304710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria832Open in IMG/M
3300018081|Ga0184625_10344662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium775Open in IMG/M
3300018084|Ga0184629_10096630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1439Open in IMG/M
3300018465|Ga0190269_10065667All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300018465|Ga0190269_10073982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1615Open in IMG/M
3300018465|Ga0190269_10825576All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300018466|Ga0190268_11700331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300018469|Ga0190270_10142673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1929Open in IMG/M
3300018469|Ga0190270_10260492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1516Open in IMG/M
3300018469|Ga0190270_10542211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1120Open in IMG/M
3300018469|Ga0190270_11064813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium839Open in IMG/M
3300018469|Ga0190270_12751817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300018476|Ga0190274_11969448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300018481|Ga0190271_10563611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1256Open in IMG/M
3300019259|Ga0184646_1054436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300019259|Ga0184646_1386043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300019263|Ga0184647_1347758All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300019884|Ga0193741_1051145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1066Open in IMG/M
3300020003|Ga0193739_1015184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2013Open in IMG/M
3300020003|Ga0193739_1016681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1915Open in IMG/M
3300020005|Ga0193697_1026885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1435Open in IMG/M
3300020005|Ga0193697_1147659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300020009|Ga0193740_1053897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300020016|Ga0193696_1018343All Organisms → cellular organisms → Bacteria1882Open in IMG/M
3300020020|Ga0193738_1013328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2653Open in IMG/M
3300020020|Ga0193738_1100938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium824Open in IMG/M
3300021412|Ga0193736_1066075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300021972|Ga0193737_1007601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1460Open in IMG/M
3300022195|Ga0222625_1612926All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300022534|Ga0224452_1187940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300022694|Ga0222623_10028624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2106Open in IMG/M
3300025310|Ga0209172_10114596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1524Open in IMG/M
3300025310|Ga0209172_10163666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1206Open in IMG/M
3300025910|Ga0207684_10505312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1036Open in IMG/M
3300025925|Ga0207650_10059052All Organisms → cellular organisms → Bacteria2858Open in IMG/M
3300025961|Ga0207712_11565468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300026535|Ga0256867_10244861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300026763|Ga0207568_105082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300027006|Ga0209896_1006886All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300027056|Ga0209879_1043284All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300027277|Ga0209846_1001633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3932Open in IMG/M
3300027324|Ga0209845_1010923All Organisms → cellular organisms → Bacteria1528Open in IMG/M
3300027379|Ga0209842_1078150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300027523|Ga0208890_1000002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria26757Open in IMG/M
3300027577|Ga0209874_1041913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1216Open in IMG/M
3300027650|Ga0256866_1007253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2736Open in IMG/M
3300027657|Ga0256865_1162321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300027675|Ga0209077_1068414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium974Open in IMG/M
3300027695|Ga0209966_1122802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300027722|Ga0209819_10205923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300027743|Ga0209593_10037196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1906Open in IMG/M
3300027909|Ga0209382_10528385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1295Open in IMG/M
3300027961|Ga0209853_1006714All Organisms → cellular organisms → Bacteria3569Open in IMG/M
3300028380|Ga0268265_12591276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300028596|Ga0247821_10743179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300028707|Ga0307291_1042132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1088Open in IMG/M
3300028715|Ga0307313_10076784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1002Open in IMG/M
3300028717|Ga0307298_10178979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300028771|Ga0307320_10018075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2537Open in IMG/M
3300028771|Ga0307320_10478334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300028784|Ga0307282_10638339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300028791|Ga0307290_10224062All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300028799|Ga0307284_10166683All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300028878|Ga0307278_10089823All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300030006|Ga0299907_10000340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria21846Open in IMG/M
3300030336|Ga0247826_11607079All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300030592|Ga0247612_1149391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300030600|Ga0247659_1144882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300031114|Ga0308187_10396235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300031170|Ga0307498_10332405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300031198|Ga0307500_10140541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300031854|Ga0310904_11074150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300031892|Ga0310893_10092502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1095Open in IMG/M
3300032012|Ga0310902_10257383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1055Open in IMG/M
3300034113|Ga0364937_011184All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300034115|Ga0364945_0182078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300034115|Ga0364945_0236994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300034643|Ga0370545_063942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment15.00%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand11.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.38%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.12%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.50%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.88%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.25%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.25%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.25%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009823Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021412Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1EnvironmentalOpen in IMG/M
3300021972Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026763Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027324Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027657Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeqEnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030592Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030600Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_030074502199352025SoilMSKEGLRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
ICChiseqgaiiDRAFT_084976123300000033SoilMKPRASKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG*
F12B_1007850923300000443SoilMTPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLAAHLLG*
F24TB_1093055323300000550SoilMNKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG*
JGI10213J12805_1058199423300000858SoilMSQGMKQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
JGI10213J12805_1096639623300000858SoilMKRGTSKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG*
JGI1027J12803_10198824723300000955SoilMKPRASKEALRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG*
F14TB_10011619923300001431SoilMTPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG*
Ga0062593_10279852623300004114SoilMKRGTSKEALRGEFRQSLSLIAMTAAAAATFLGFGLLTAHLLG*
Ga0063356_10625968123300004463Arabidopsis Thaliana RhizosphereMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG*
Ga0066807_100166033300005161SoilMKQRASKKALRGELRQSLSLIAMTAATAATFLGLGLLTAHLLG*
Ga0070703_1012605023300005406Corn, Switchgrass And Miscanthus RhizosphereMTPRASKESLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG*
Ga0070698_10019882723300005471Corn, Switchgrass And Miscanthus RhizosphereMKPRASKGPLRAELRQRLSLISMTAVTAATFHGLGLLTAHLLG*
Ga0075432_1029544813300006058Populus RhizosphereKPMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG*
Ga0074051_1001490523300006572SoilMKQRASKEALRGELRQSLSLIAMTAATAATFLGLGLLTAHLLG*
Ga0074047_1205648023300006576SoilMKQMASREGLRGELRQSLSLITMTAVTAATFLGLGLLTAHLLG*
Ga0075428_10027460013300006844Populus RhizosphereGRLPGRHARTGGQGMSQGMSQGMSQGMSQGMSQGMRQRTTKGTLRGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0075421_10002083523300006845Populus RhizosphereMSQGMSQGMSQGTSHMTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0075421_10268813423300006845Populus RhizosphereMKPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLAAHLLG*
Ga0075431_10021938623300006847Populus RhizosphereMSQGMSQGMRQRTTKGTLRGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0075420_10048506133300006853Populus RhizosphereMSQGTSHMTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0073934_1003462563300006865Hot Spring SedimentMSQGMSQGMSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0075429_10024760923300006880Populus RhizosphereMSQGMRQRTTKGTLPGELRQSLQLIAMTALTAATFLGLGLFTAHLLG*
Ga0075429_10103990323300006880Populus RhizosphereMKPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLVTAHLLG*
Ga0075418_1002766363300009100Populus RhizosphereMTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0105091_1006393113300009146Freshwater SedimentGQGMSQGMSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0114129_1136440923300009147Populus RhizosphereQGMRQRTTKGTLPGELRQSLQLIAMTALTAATFLGLGLFTAHLLS*
Ga0105092_1054471423300009157Freshwater SedimentMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0105092_1062956223300009157Freshwater SedimentMRQRTTKGTLSGELRQSLSLIAMTALTAATFLGLGLITARLLG*
Ga0105104_1005286223300009168Freshwater SedimentMRQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0105104_1028625223300009168Freshwater SedimentMKPRASKEPLRGELRQSLSLIAMTAMTAATFLGLGLLTAHLLG*
Ga0105056_103990823300009801Groundwater SandMKPRASKEALRGELRQSLSLIAMTAVTAATFLGLGLLAAHLLG*
Ga0105063_103958823300009804Groundwater SandMNQRRTKGTLPGELRQSLALIAMTALTAASFLGLGLITAHLLG*
Ga0105088_102018233300009810Groundwater SandMRQRMTKGTLPGELRQSLSMIAMTALTAATFLGLGLITAHLLG*
Ga0105088_102259823300009810Groundwater SandKHAVRGGLGRTLSPIAMTAVTASVFLGLGPLTAHLPG*
Ga0105084_100481233300009811Groundwater SandMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAQLLG*
Ga0105084_109350223300009811Groundwater SandMKRTSKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG*
Ga0105082_102459013300009814Groundwater SandGRNARTGGQGMSQGMNQRRTKGTLPGELRQSLSLIAMTALTAASFPGLGLITAHLLG*
Ga0105076_107340523300009816Groundwater SandMRQRMTKGTLPGELRQSLSLIAMTALTAASFPGLGLITAHLLG*
Ga0105062_100703033300009817Groundwater SandMKRGTSKEAQRSELRQSLSLIAMTAAAVIAFLGFGPLTAHLLG*
Ga0105072_100652923300009818Groundwater SandMSQGTTKGTLPGELRQSLSLIAMTALTAASFLGLGLITAHLLG*
Ga0105078_100278223300009823Groundwater SandMKPRASKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG*
Ga0105074_103491313300010029Groundwater SandSQEMSQEMSQETRQRMTKGTLSGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0126312_1071618223300010041Serpentine SoilMNQGMGTGTTQAPLRGELRQSLSLIAMTAVTAATFLGLGLITAHLLG*
Ga0126306_1046452723300010166Serpentine SoilMSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0105239_1074931623300010375Corn RhizosphereMSKEALRGELRQSLSLIVMTAVTAAMFLGLGLLTAHLLG*
Ga0138513_10000695343300011000SoilMKPRASKEPLRGELCQSLSLIAMTAVTAATFLGLGLLTAHLLG*
Ga0137340_111446223300011405SoilMSQGTKQRMREGTLPGELRQSLSLIAMTALAAATFLGLGLITAHLLG*
Ga0137432_114839123300011439SoilMEQRMRQGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0137463_110599723300011444SoilMSKEALRGELRQSLSLIVMTAVTAATFLGIGLLTAHLLG*
Ga0137344_102721413300012159SoilGTKQRMREGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0137374_1024081023300012204Vadose Zone SoilMKPGASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG*
Ga0137374_1062449413300012204Vadose Zone SoilMKQKVCKEALRGELRRSLSLIRMTAVTVATFLGLGVLTAHVLG*
Ga0137367_1109303623300012353Vadose Zone SoilMKQKVCKEALRGELRQSLSLIGMTAVTAATFLGLGVLTAHLLG*
Ga0137369_1010617043300012355Vadose Zone SoilMSKEALRGELRQSLSLIVVTAATAATFLGLGLLTAHLLG*
Ga0137369_1016571123300012355Vadose Zone SoilMKPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG*
Ga0137375_1091923823300012360Vadose Zone SoilMSREALRGELRQSLSLIVVTAATAATFLGLGLLTAHLLG
Ga0137373_1030796423300012532Vadose Zone SoilMKQKVSKEALRGELRQSLSLIGMTAVTAATFLGLGVLTAHLLG*
Ga0162653_10002135223300012937SoilMKRGTSKEALHGEPRQSLSLIAMAAVTAATFLGFGLLTARLLG*
Ga0180093_113275113300015258SoilGMSQRMTKVTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG*
Ga0190266_1017588913300017965SoilMSQGMSQGMSQGMSQGMSQGMSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184610_102390033300017997Groundwater SedimentMKPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0184610_103110423300017997Groundwater SedimentMSQGMQQRMTKGTLPGELSQSLSLIAMTALTAATFLGLGLISAQLLG
Ga0184610_107158723300017997Groundwater SedimentMSQGTKQRMREGTLPGELRQSLSLIAMTAMTAATFLGLGLITAHLLG
Ga0184608_1000025533300018028Groundwater SedimentMSQGMSQGMSQGMSQGVSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184608_1050190423300018028Groundwater SedimentMKRGTSKEALRGELRQSLSLIAMTAAAAATFLGFGLLTA
Ga0184634_1004972033300018031Groundwater SedimentLSQEVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184634_1006741033300018031Groundwater SedimentMKPGASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0184620_1002284333300018051Groundwater SedimentMKPRASKEPLRGELRQSLSLIAMAAVTAATFLGFGLLTARLLG
Ga0184638_122915623300018052Groundwater SedimentMSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAAMFLGLGLITAHLLG
Ga0184623_1006899433300018056Groundwater SedimentMSQGMQQRMTKGTLPGELSQGLSLIAMTALTAATFLGLGLISAQLLG
Ga0184637_1010966123300018063Groundwater SedimentMSQGMSQGMSQGMSQGMSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184618_1004822723300018071Groundwater SedimentMKPGASKEALRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0184635_1003618323300018072Groundwater SedimentMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184635_1009919713300018072Groundwater SedimentMKPGASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHL
Ga0184624_1004519823300018073Groundwater SedimentMKRGTSKEALHGEPRQSLSLIAMAAVTAATFLGFGLLTARLLG
Ga0184624_1038057923300018073Groundwater SedimentMSKEALRGELRQSLSLIVMTAVTAATFLGFGLLTARLLG
Ga0184640_1006287933300018074Groundwater SedimentMSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184609_1010317423300018076Groundwater SedimentMKPGASKAPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0184612_1050333023300018078Groundwater SedimentMSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184627_1003121043300018079Groundwater SedimentMSQGTKQRMRKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184625_1007841523300018081Groundwater SedimentMKQRGTSKEALHGEPRQSLSLIAMAAVTAATFLGFGLLTARLLG
Ga0184625_1030471013300018081Groundwater SedimentMSQGMSQGIGMRQRMTKGTLPGELSQSLSLIAMTALTADTFLGLGLISAQLL
Ga0184625_1034466213300018081Groundwater SedimentQGMSQGMQQRIPKGTLPGELSQSLSLIAMTAATFLGLGLISAQLLG
Ga0184629_1009663023300018084Groundwater SedimentMSQGMSQGMSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0190269_1006566723300018465SoilMSEGMQERMTKGTLSGELRQSLSLIAMTALTAGTFLGLGLITAQLLG
Ga0190269_1007398223300018465SoilMKRRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0190269_1082557623300018465SoilMKRGTSKEAQRGELRQSLSLIAMTAAAAATFLGFGPLTAHLLG
Ga0190268_1170033123300018466SoilMKERTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0190270_1014267323300018469SoilMKPSASKEPLRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0190270_1026049233300018469SoilMSQGTSQGMSQGTSQGTSQGTSQGMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG
Ga0190270_1054221113300018469SoilMSQGMSQGMSQGMTKGTLPGELRQSLSLIAMTALTAATFMGLGLITARMLR
Ga0190270_1106481323300018469SoilMTKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAYLLG
Ga0190270_1275181723300018469SoilMSEGMQERMTKGTLSGELRQSLSLIAMTALTAGTFLGLGLTTAQLLG
Ga0190274_1196944823300018476SoilMSQGMSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG
Ga0190271_1056361123300018481SoilMSQGMSQGMSQGMRQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184646_105443623300019259Groundwater SedimentQGMSQGMSQGMRQRMTKGTLPRELGQSLSLIAMTGLTAATFLGLGLITAHLLG
Ga0184646_138604313300019259Groundwater SedimentMSQGMSQGMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0184647_134775823300019263Groundwater SedimentMNKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0193741_105114523300019884SoilEPRDEPRDEGMKGRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0193739_101518423300020003SoilMSQGMSQGMSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLL
Ga0193739_101668123300020003SoilMSQGMKQRMTNRTLPGELRQSFSLIAMTALTAATFLGLGLITAHLLG
Ga0193697_102688513300020005SoilARTGGQGMSQGMQQRMTKGTLAGELSQSLSLIAMTALTAATFLGLGLISAQLLG
Ga0193697_114765913300020005SoilARTGGKGMKRGTSKEALHGEPRQSLSLIAMAAVTAATFLGFGLLTARLLG
Ga0193740_105389713300020009SoilTKGTLPRELGQSLSLIAMTGLTAATFLGLGLITAHLLG
Ga0193696_101834323300020016SoilMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0193738_101332843300020020SoilMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0193738_110093813300020020SoilHARTGGQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG
Ga0193736_106607523300021412SoilMSQGMSQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARL
Ga0193737_100760133300021972SoilQGIGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG
Ga0222625_161292623300022195Groundwater SedimentMSQGMSQKMTNGRLPRELGQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0224452_118794023300022534Groundwater SedimentMSQGMSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0222623_1002862423300022694Groundwater SedimentMSQGMQQRIPKGTLPGELSQSLSLIAMTALTAATFLGLGLISAQLLG
Ga0209172_1011459623300025310Hot Spring SedimentVKGSLSTEVRQSLSLIAMTAVATATYLGLALLLAHVLG
Ga0209172_1016366623300025310Hot Spring SedimentMSQGMSQGMSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0207684_1050531223300025910Corn, Switchgrass And Miscanthus RhizosphereEGKPMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0207650_1005905223300025925Switchgrass RhizosphereMTPRASKESLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0207712_1156546823300025961Switchgrass RhizosphereMKPRASKEPLHGELRQSLSLIAMTAVTAATFLGLGLLAAHLLG
Ga0256867_1024486123300026535SoilMSQGMSQGMKGRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0207568_10508213300026763SoilMKPRASKEPLRGELRQSLSLIAMTAMTAATFLGLGLLTAHLLG
Ga0209896_100688623300027006Groundwater SandMKPRASKEALRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0209879_104328423300027056Groundwater SandMKRTSKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG
Ga0209846_100163353300027277Groundwater SandMSQGMRQRMTKGTLPGELRQSLSMIAMTALTAATFLGLGLITAHLLG
Ga0209845_101092323300027324Groundwater SandMTKGTLPGELRQSLSMIAMTALTAATFLGLGLITAHLLG
Ga0209842_107815023300027379Groundwater SandMKRGTSKEAQRSELRQSLSLIAMTAAAAAAFLGFGPLTAHLLG
Ga0208890_1000002173300027523SoilMKQRASKEALRGELRQSLSLIAMTAATAATFLGLGLLTAHLLG
Ga0209874_104191313300027577Groundwater SandMSQGMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHL
Ga0256866_100725343300027650SoilMSQGMKGRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0256865_116232123300027657SoilMSQGMSQGMSQGMSQRMTKGTLPRELGQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0209077_106841413300027675Freshwater SedimentGQGMSQGMSQGMSQGMSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0209966_112280213300027695Arabidopsis Thaliana RhizosphereMKPRAGKEALRGELRQSLSLIAMTAVTAATFLGLGLVTAHLL
Ga0209819_1020592323300027722Freshwater SedimentMKRGTSKEALRGELRQSLWLIAMTAATAATFLGFGLLTAHLLG
Ga0209593_1003719643300027743Freshwater SedimentMSQGMSQGMSQGMSQGMSQGMRQRTTKGTLPGELRQSLSLIAVIALTAATFLGLGLITAHLLG
Ga0209382_1052838533300027909Populus RhizosphereMSQGMSQGMRQRTTKGTLRGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0209853_100671423300027961Groundwater SandMRRRVSKHAVRGGLRRTLSPIAMTAVTASVFLGLGPLTAHLLG
Ga0268265_1259127623300028380Switchgrass RhizosphereALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0247821_1074317923300028596SoilMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAYLLG
Ga0307291_104213223300028707SoilGMKPGASKAPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0307313_1007678423300028715SoilKPRASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0307298_1017897913300028717SoilASKEPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0307320_1001807523300028771SoilMKQKASREALSGELRQSLSLIAVTAVTASTFLGLGLLTAHLLG
Ga0307320_1047833413300028771SoilMSQGMSQGMSQGMSQGVSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFL
Ga0307282_1063833923300028784SoilMSKEALRGELRQSLSLIVMTAVTAATFLGIGLLTAHLLG
Ga0307290_1022406223300028791SoilMSQGMSQGVRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHL
Ga0307284_1016668323300028799SoilMKQRASKEALRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0307278_1008982323300028878SoilMKPRASKAPLRGELRQSLSLIAMTAVTAATFLGLGLLTAHLLG
Ga0299907_10000340193300030006SoilMSQGMSQGMSQGMKGRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0247826_1160707923300030336SoilMKPRASKEALRGELRQSLSLIAMTAVTAATFLGLGLVTAHLLG
Ga0247612_114939123300030592SoilTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0247659_114488223300030600SoilGMSQGMSQRTTKGTLPGELRQSLSLIAMTALTAATFLGLGLITARLLG
Ga0308187_1039623513300031114SoilMKPGASKAPLRGELRQSLSLIAMTAVTAATFLGLG
Ga0307498_1033240523300031170SoilRDEGMPMNKGALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0307500_1014054113300031198SoilRPMNKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0310904_1107415013300031854SoilRSHPEPRDRPRDEPRDEPRDEEEAMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0310893_1009250213300031892SoilKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0310902_1025738323300032012SoilAMSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG
Ga0364937_011184_908_10393300034113SedimentMRQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0364945_0182078_313_5163300034115SedimentMSEGMSEGMSQGMSEGMSEGMSQGMSQRMTKGTLPGELRQSLSLIAMTALTAATFLGLGLITAHLLG
Ga0364945_0236994_105_2363300034115SedimentMRQRMTKGTLPGELRQSLSLIAITALTAATFLGLGLITAHLLG
Ga0370545_063942_151_2703300034643SoilVSKEALRGELRQSLSLIVMTAVTAATFLGLGLLTAHLLG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.