NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041414

Metagenome / Metatranscriptome Family F041414

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041414
Family Type Metagenome / Metatranscriptome
Number of Sequences 160
Average Sequence Length 44 residues
Representative Sequence LVNTILDGFLAVTREEIQAAAKKYLRNEKRAIVFRTPVKAGAKEAA
Number of Associated Samples 139
Number of Associated Scaffolds 160

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.63 %
% of genes near scaffold ends (potentially truncated) 96.88 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.750 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.250 % of family members)
Environment Ontology (ENVO) Unclassified
(28.125 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.875 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.08%    β-sheet: 0.00%    Coil/Unstructured: 68.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 160 Family Scaffolds
PF05193Peptidase_M16_C 38.12
PF00675Peptidase_M16 23.75
PF12836HHH_3 3.12
PF00926DHBP_synthase 1.25
PF02574S-methyl_trans 0.62
PF00118Cpn60_TCP1 0.62
PF02899Phage_int_SAM_1 0.62
PF05016ParE_toxin 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 160 Family Scaffolds
COG01083,4-dihydroxy-2-butanone 4-phosphate synthaseCoenzyme transport and metabolism [H] 1.25
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.62
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.62
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.62
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.62
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.75 %
UnclassifiedrootN/A1.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_103765557All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300000955|JGI1027J12803_108950242All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300001356|JGI12269J14319_10087030All Organisms → cellular organisms → Bacteria → Acidobacteria1614Open in IMG/M
3300002245|JGIcombinedJ26739_100787249All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300002917|JGI25616J43925_10292849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300004092|Ga0062389_103713960All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300004114|Ga0062593_100419972All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300004635|Ga0062388_100606486All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300005434|Ga0070709_11369608All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005526|Ga0073909_10553734All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005534|Ga0070735_10422933All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300005537|Ga0070730_11072371All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005538|Ga0070731_10067917All Organisms → cellular organisms → Bacteria → Acidobacteria2365Open in IMG/M
3300005538|Ga0070731_10808762All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005554|Ga0066661_10864563All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005591|Ga0070761_11098020All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005602|Ga0070762_10170537All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300005615|Ga0070702_100846321All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005764|Ga0066903_100529221All Organisms → cellular organisms → Bacteria2011Open in IMG/M
3300005921|Ga0070766_10060918All Organisms → cellular organisms → Bacteria2147Open in IMG/M
3300006028|Ga0070717_11260586All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300006172|Ga0075018_10135760All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300006174|Ga0075014_100668226All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300006176|Ga0070765_100173955All Organisms → cellular organisms → Bacteria1938Open in IMG/M
3300006176|Ga0070765_101930846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas553Open in IMG/M
3300006791|Ga0066653_10423305All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300006804|Ga0079221_10692169All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300006939|Ga0081244_1499170All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300009038|Ga0099829_11722607All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300009088|Ga0099830_10649099All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300009088|Ga0099830_11089751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300009089|Ga0099828_10165996All Organisms → cellular organisms → Bacteria → Acidobacteria1959Open in IMG/M
3300009545|Ga0105237_10922035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium880Open in IMG/M
3300009698|Ga0116216_10345176All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300009698|Ga0116216_10949785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300010046|Ga0126384_10015407All Organisms → cellular organisms → Bacteria4843Open in IMG/M
3300010048|Ga0126373_12049097All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300010326|Ga0134065_10016145All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300010337|Ga0134062_10747444All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300010364|Ga0134066_10108234All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6818Open in IMG/M
3300010366|Ga0126379_10909166All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium983Open in IMG/M
3300010376|Ga0126381_101172748All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1110Open in IMG/M
3300010877|Ga0126356_10750035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300011269|Ga0137392_11252220All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300011270|Ga0137391_11462334All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300012096|Ga0137389_11598773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300012096|Ga0137389_11739725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300012349|Ga0137387_11296098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300012351|Ga0137386_10581269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6806Open in IMG/M
3300012361|Ga0137360_10856373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300012362|Ga0137361_11378663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300012683|Ga0137398_10556211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300012918|Ga0137396_11186259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300012925|Ga0137419_11217502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300012944|Ga0137410_10698727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium845Open in IMG/M
3300012944|Ga0137410_11503665All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300012971|Ga0126369_11422400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300013296|Ga0157374_11151327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300014153|Ga0181527_1035856All Organisms → cellular organisms → Bacteria → Acidobacteria2864Open in IMG/M
3300014201|Ga0181537_10593766All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300015167|Ga0167661_1065698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300016270|Ga0182036_11874662All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300016422|Ga0182039_10204293All Organisms → cellular organisms → Bacteria → Acidobacteria1578Open in IMG/M
3300016422|Ga0182039_11747597All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300016445|Ga0182038_10013170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4749Open in IMG/M
3300016750|Ga0181505_11008693All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium935Open in IMG/M
3300017656|Ga0134112_10145431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300017924|Ga0187820_1263028All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300018062|Ga0187784_11366606All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300018085|Ga0187772_10094725All Organisms → cellular organisms → Bacteria1915Open in IMG/M
3300018088|Ga0187771_11247340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300019788|Ga0182028_1317336All Organisms → cellular organisms → Bacteria2515Open in IMG/M
3300020034|Ga0193753_10158729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1070Open in IMG/M
3300020579|Ga0210407_11021380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300020581|Ga0210399_10963153All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300020583|Ga0210401_10801949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300021046|Ga0215015_10502878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1145Open in IMG/M
3300021046|Ga0215015_10725774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1256Open in IMG/M
3300021168|Ga0210406_10879839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300021171|Ga0210405_10041179All Organisms → cellular organisms → Bacteria3674Open in IMG/M
3300021178|Ga0210408_10719879All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium785Open in IMG/M
3300021178|Ga0210408_11218720All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300021181|Ga0210388_10050615All Organisms → cellular organisms → Bacteria → Acidobacteria3463Open in IMG/M
3300021403|Ga0210397_10428169All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium993Open in IMG/M
3300021403|Ga0210397_10751338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300021403|Ga0210397_11311265All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300021407|Ga0210383_11117232All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300021420|Ga0210394_10373718All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1253Open in IMG/M
3300021432|Ga0210384_10630804All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium961Open in IMG/M
3300021474|Ga0210390_11549297All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300021475|Ga0210392_11171261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300021478|Ga0210402_11359123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300021559|Ga0210409_10031533All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5093Open in IMG/M
3300021559|Ga0210409_10588255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium981Open in IMG/M
3300021861|Ga0213853_10532646All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1231Open in IMG/M
3300022726|Ga0242654_10278379All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300024251|Ga0247679_1072990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300024325|Ga0247678_1009279All Organisms → cellular organisms → Bacteria → Acidobacteria1414Open in IMG/M
3300024330|Ga0137417_1170626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1300Open in IMG/M
3300024330|Ga0137417_1394245All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium913Open in IMG/M
3300026297|Ga0209237_1076074All Organisms → cellular organisms → Bacteria → Acidobacteria1558Open in IMG/M
3300026523|Ga0209808_1058224All Organisms → cellular organisms → Bacteria → Acidobacteria1732Open in IMG/M
3300026524|Ga0209690_1099774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1190Open in IMG/M
3300026524|Ga0209690_1250450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300026890|Ga0207781_1017299All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300027460|Ga0207506_1000957All Organisms → cellular organisms → Bacteria2033Open in IMG/M
3300027480|Ga0208993_1036443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria879Open in IMG/M
3300027568|Ga0208042_1126839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300027610|Ga0209528_1018456All Organisms → cellular organisms → Bacteria → Acidobacteria1531Open in IMG/M
3300027629|Ga0209422_1006444All Organisms → cellular organisms → Bacteria → Acidobacteria2890Open in IMG/M
3300027635|Ga0209625_1145281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300027701|Ga0209447_10126548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300027825|Ga0209039_10408392All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300027846|Ga0209180_10238490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1047Open in IMG/M
3300027854|Ga0209517_10710149All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300027862|Ga0209701_10176740All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1287Open in IMG/M
3300027862|Ga0209701_10342888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300027867|Ga0209167_10145078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1242Open in IMG/M
3300027875|Ga0209283_10093636All Organisms → cellular organisms → Bacteria → Acidobacteria1959Open in IMG/M
3300028138|Ga0247684_1035289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300028536|Ga0137415_10708333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium819Open in IMG/M
3300028906|Ga0308309_11531165All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300030580|Ga0311355_10029034All Organisms → cellular organisms → Bacteria → Acidobacteria6773Open in IMG/M
3300031057|Ga0170834_108498785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300031226|Ga0307497_10292965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300031240|Ga0265320_10272308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300031247|Ga0265340_10478572All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300031573|Ga0310915_10520928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium844Open in IMG/M
3300031668|Ga0318542_10448054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300031680|Ga0318574_10937022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300031681|Ga0318572_10342924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium886Open in IMG/M
3300031708|Ga0310686_108338706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300031720|Ga0307469_11580333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300031736|Ga0318501_10003977All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia5022Open in IMG/M
3300031744|Ga0306918_10211239All Organisms → cellular organisms → Bacteria → Acidobacteria1467Open in IMG/M
3300031754|Ga0307475_10424547All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1069Open in IMG/M
3300031754|Ga0307475_11366985All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300031797|Ga0318550_10205814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium953Open in IMG/M
3300031820|Ga0307473_10604975All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300031823|Ga0307478_11010867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300031896|Ga0318551_10019954All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales → Hydrogenophilaceae → unclassified Hydrogenophilaceae → Hydrogenophilaceae bacterium3102Open in IMG/M
3300031942|Ga0310916_11572876All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300031954|Ga0306926_10487808All Organisms → cellular organisms → Bacteria → Acidobacteria1515Open in IMG/M
3300031962|Ga0307479_10619705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1063Open in IMG/M
3300032060|Ga0318505_10458243All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300032066|Ga0318514_10461974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300032076|Ga0306924_10798187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1052Open in IMG/M
3300032180|Ga0307471_100030787All Organisms → cellular organisms → Bacteria4132Open in IMG/M
3300032180|Ga0307471_100361169All Organisms → cellular organisms → Bacteria → Acidobacteria1566Open in IMG/M
3300032180|Ga0307471_100696103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1180Open in IMG/M
3300032180|Ga0307471_101373350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300032180|Ga0307471_102721656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300032205|Ga0307472_101181793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300032805|Ga0335078_10032464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7756Open in IMG/M
3300032828|Ga0335080_10982221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium861Open in IMG/M
3300032895|Ga0335074_11353946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300032954|Ga0335083_10247651All Organisms → cellular organisms → Bacteria → Acidobacteria1596Open in IMG/M
3300032954|Ga0335083_10781834All Organisms → cellular organisms → Bacteria767Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.25%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.12%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.12%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.12%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.75%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.88%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.25%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.25%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.25%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.25%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.62%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.62%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.62%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.62%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.62%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.62%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006939Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300015167Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026359Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-AEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026890Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes)EnvironmentalOpen in IMG/M
3300027460Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10376555723300000364SoilEPHLVNSILDGFDAVKPAEIQSVAQKYLRPENRAIVFRKPAAGKKEAA*
JGI1027J12803_10895024223300000955SoilQLVNTILDGFLAVTRSQLQEVAKKYLRPENRAIVFRMPAKSEVKEAA*
JGI12269J14319_1008703023300001356Peatlands SoilKREEIQGAAQKYLRAENRAIVFRTPVKSVAKEAA*
JGIcombinedJ26739_10078724913300002245Forest SoilQLVNSILGGFLAVKREEIQAVAKKYLHPANRAVVFRTPIKAAAKEAA*
JGI25616J43925_1029284913300002917Grasslands SoilTILDGFIAVTREEIQAAAKKYLRNEKRAIVFRTPVKANAKEAA*
Ga0062389_10371396013300004092Bog Forest SoilVNSILDGFLAVKREEIQAVAKKYLHPANRAVVFRTPITAAAKEAA*
Ga0062593_10041997213300004114SoilEPQLVNTVLDGFLSVTRDEILAAANKYLRKEKRAIVFRRPAAAGVKEAA*
Ga0062388_10060648613300004635Bog Forest SoilDREPELVNTILEGFLAVTREDVQAAAKKYLVDARRAIVFRTPVAAGAKEAA*
Ga0070709_1136960813300005434Corn, Switchgrass And Miscanthus RhizosphereSILDGFLAVKREEVQQVAKKVLQPQNRAIVFRKPVTKKEAA*
Ga0073909_1055373413300005526Surface SoilQLVNSILDGFLAVTREDVQAAAKKYLRNEKRAIVFRTPVNAGAKEAA*
Ga0070735_1042293323300005534Surface SoilNKPEMVNSILDGFLAVKREDVQAVAKKYLRAENRAIVFRTPVKSSEKEAA*
Ga0070730_1107237113300005537Surface SoilVNTVLDGFLSVKQDEILAAANKYLRKEKRAIVFRRPAAAGVKEAA*
Ga0070731_1006791743300005538Surface SoilDGFLTVKREDVLAAAKKYLLREKRAIVFRLPVTAGVKEAA*
Ga0070731_1080876223300005538Surface SoilDNKPELVNSILDGFLAVKKQDVQAVAKKYLRAENRAIVFRTPVKAGEKEAA*
Ga0066661_1086456323300005554SoilFDNEPQLVNTILDGFFAVTPEQVHSVAGKYLRKEKRAIVFRVPASAGVKEAA*
Ga0070761_1109802013300005591SoilDNEPQLVNTIMDGFLAVKREEIRAVARRYLRAENRAIVFRAPVMKNETEVA*
Ga0070762_1017053723300005602SoilLFDNQPQLVNSILDGFLAVKSEEIQAVAKKYLHPTNRAVVFRTPIKAAAKEAA*
Ga0070702_10084632113300005615Corn, Switchgrass And Miscanthus RhizosphereTLFDNEPQLVNSILDGFLAVKREEIQGVAKRVLRPENRAIVFRKPVAKKEAA*
Ga0066903_10052922143300005764Tropical Forest SoilLVNTILDGFLAVTCAQVQEVAKKYLRPENRAIVFRMPAKSEVKEAA*
Ga0070766_1006091813300005921SoilVNSILDGFLAVKREEIQAVAKKYLHPANRAVVFRTPIKAAAKEAA*
Ga0070717_1126058623300006028Corn, Switchgrass And Miscanthus RhizosphereSILDGFLAVKPEEIQSVARKYLRPENRAIVFRAPSKSSAKEAA*
Ga0075018_1013576013300006172WatershedsDGFLAVTREQVQEVAKKYLRPENRAIVFRMPAKSEVKEAA*
Ga0075014_10066822613300006174WatershedsEPQLVNTILDGFLTVKREEVQAVARKYLRTEKRAIVFRKPVHASAKEAA*
Ga0070765_10017395533300006176SoilILDGFLAVKREDVQAVAKKYLRAENRAIVFRTPVKSSEKEAA*
Ga0070765_10193084623300006176SoilLFDNQPQLVNSILDGFLAVKREEIQAVANKYLHATNRAVVFRTPVKAVAKEAA*
Ga0066653_1042330513300006791SoilLVNSILDGFLAVTREDVERAAQNYLRREKRAVIFRQPARGSKEAAA*
Ga0066660_1164445613300006800SoilFLAVSREEIQAVAKKYLRNEKRAIVFRTPVKAALPAGAKEAA*
Ga0079221_1069216913300006804Agricultural SoilLAVTREEIHSVAKKYLRDEKRAIVFRVPAKAGAKEAA*
Ga0081244_149917023300006939Tropical Rainforest SoilLVNTILTDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA*
Ga0099829_1172260723300009038Vadose Zone SoilVNSILDGFLAVTREEIQAVAKKYLRNDQRAIVFRTPVKPDAKVAA*
Ga0099830_1064909913300009088Vadose Zone SoilEPQLVNTILDGFLAVKREDIQTVAQKYLRSDKRAIVFRRPVNAQAREAA*
Ga0099830_1108975123300009088Vadose Zone SoilLVNTILDGFLAVTREEIQAAAKKYLRNEKRAIVFRTPVKAGAKEAA*
Ga0099828_1016599643300009089Vadose Zone SoilAVKSEEIKAVAEKYLRTEKRAIVFRKPVAAAAKEAA*
Ga0105237_1092203523300009545Corn RhizospherePELVNSILDGFLAVKKEDVQAVAKKYLRAENRAIVFRTPVKTEGKTAGEKEAA*
Ga0116216_1034517623300009698Peatlands SoilFDGEPQLVNTVLDGFLAVKREDIQAAAKKYLRSEKRAIVFRLPTVAGVKEAA*
Ga0116216_1094978523300009698Peatlands SoilGFLEVKREELHRAAQKYLRPENRVIVFRTPVKSDAKEAA*
Ga0126384_1001540753300010046Tropical Forest SoilLQVTPEQVQAVAKKYLHKENRAIVFRAPAANQKEAA*
Ga0126373_1204909723300010048Tropical Forest SoilLVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA*
Ga0134065_1001614513300010326Grasslands SoilVTPEEILAVAKKYLRNEKRAIVFRTPLKASAPLDKKEAA*
Ga0134062_1074744413300010337Grasslands SoilPQLVNTILDGFLAVTPEEIHSVAKKYLRNEKRAIVFRTPARAGVKEAA*
Ga0134066_1010823423300010364Grasslands SoilDHNPQLVNTILDGFLEVTEEEILSAARRYLRTENRAIVFRTPTRLREQAV*
Ga0126379_1090916623300010366Tropical Forest SoilPEQVHSVAKKYLRNEKRAIVFRTPAKTGSPAGVKEAA*
Ga0126381_10117274823300010376Tropical Forest SoilVNSILDGFLAVKREEIQAVAKKYLRPENRAIVFRTPVAKDAEEAA*
Ga0126356_1075003523300010877Boreal Forest SoilLFDNEPQLVNSILDGFLAVTREEIQAAAKKYLRNEKRAIVFRRPANAQAQEAA*
Ga0137392_1125222023300011269Vadose Zone SoilDGFLAVKREDIQAVAKRYLRNDKRAIVFRRPVAAHAKEAA*
Ga0137391_1146233423300011270Vadose Zone SoilDGEPQLVNTVLDGFLAVKKEEVHAVARKYLRTENRAIIFRKPANAVAKEAA*
Ga0137389_1159877323300012096Vadose Zone SoilFLAVTREEIHAAAKKYLRAEKRAIVFRTPAKAGAKEAA*
Ga0137389_1173972513300012096Vadose Zone SoilTILDGFLAVTREQIHSAAKKYLRNEKRAIVFRTPVKASAKEAA*
Ga0137387_1129609823300012349Vadose Zone SoilDGFLAVTRDEIQAVARKYLRNEKRAIVFRTPVKAREKEAA*
Ga0137386_1058126923300012351Vadose Zone SoilFLAVTREQMMTVAQKYLRNEKRAIVFRAPAKVAAKEVA*
Ga0137360_1085637313300012361Vadose Zone SoilTILDGFLAVKKEEVHAVARKYLRTENRAIIFRKPANAVAKEAA*
Ga0137361_1137866323300012362Vadose Zone SoilFLAVTREQIHSAAKKYLRNEKRAIVFRTPVKASAQEAA*
Ga0137398_1055621113300012683Vadose Zone SoilEIQAVAKKYLRNEKRAIVFRTPVKAGVPADAGAKEAA*
Ga0137396_1118625923300012918Vadose Zone SoilDGFLAVTREEIQAVANKYLRNEKRAIVFRTPVKVGAKEAA*
Ga0137419_1121750223300012925Vadose Zone SoilDGFLQVSPQQVQAAAKKYLRKENRAIVFRAPANLGAKEAA*
Ga0137410_1069872713300012944Vadose Zone SoilELWLLNNVLDGFLAVTREEIHAAAKKYLRNEKRAIVFRTPVKASAKEAA*
Ga0137410_1150366513300012944Vadose Zone SoilILDGFLAVTRDEIEAAARKYLRNEKRAIVFRTPVKASAKEVA*
Ga0126369_1142240023300012971Tropical Forest SoilDNEPQLVNTILDGFLAVRREEVHSAARRYLRNEKRAIVFRTPANAGAKEAA*
Ga0157374_1115132713300013296Miscanthus RhizospherePQLVNSILDGFLAVKREEIQGVAKRVLRPENRAIVFRKPVAKKEAA*
Ga0181527_103585613300014153BogLEVKREEVQRAAQKYLRPENRAIVFRTPVKSDAKEAA*
Ga0181537_1059376613300014201BogKREDVQAVAKKYLRAENRAIVFRTPVKAGEKEAA*
Ga0167661_106569823300015167Glacier Forefield SoilVTREDVLAAAKKYLRNDQRAIVFRTPANVASKEAA*
Ga0182036_1187466213300016270SoilNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA
Ga0182039_1020429323300016422SoilNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA
Ga0182039_1174759723300016422SoilDPQLVNSILDGFLGVKREDIQRVAKRYLVPENRAIVFRTPVRKGEKEAA
Ga0182038_1001317013300016445SoilGRVNTIQSDFLKVTREEVQSAAKKYLLPENRAIVFRTPVSKKEAA
Ga0181505_1100869323300016750PeatlandFDNEPQLVNTILEGFLAVKREEIQACAKRYLQPENRAIVFRTPVNRDVKEAA
Ga0134112_1014543123300017656Grasslands SoilFLAVTPEEILAVAKKYLRNEKRAIVFRTPLKASAPLDKKEAA
Ga0187820_126302813300017924Freshwater SedimentPEMVNSILDGFLAVKKEDVQAVAKKYLRAENRAIVFRTPVKAEGKPAGEKEAA
Ga0187784_1136660613300018062Tropical PeatlandILDGFLAVTREETQAAAKKYLRNDRRAIVFRLPAKPSVKEAA
Ga0187772_1009472513300018085Tropical PeatlandNTILDGFLAVKHEEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA
Ga0187771_1124734013300018088Tropical PeatlandNEPQLVNTILDGFLAVTREEIHAAAKKYLRNDKRAIVFRIPAKANVKEAA
Ga0182028_131733653300019788FenVKREEIQNAAQKYLRVENRAIVFRTPVKSDVKEAA
Ga0193753_1015872923300020034SoilLAVTREEIQAAAKKYLRNEKRAIVFRAPVKTDAKEAA
Ga0210407_1102138013300020579SoilAVKREEIQAVAKKYLHPTNRAVVFRTPIKAAAKEAA
Ga0210399_1096315323300020581SoilLAVKREEVQAAAKKYLLPENRAIVFRTPVNKDVKEAA
Ga0210401_1080194923300020583SoilNSILDGFLAVKREEIQAVAKKYLHPANRAVVFRTPIKAAAKEAA
Ga0215015_1050287813300021046SoilMCIRDRFDGEPQLVNTVLDGFLAVRKEEVHAVARKYLRTENRAIIFRKPANAVAKEAA
Ga0215015_1072577413300021046SoilAVKREDIQAVAQKYLRKDRRAIVFRCPVKAHAKEAA
Ga0210406_1087983913300021168SoilPQLVNTILDGFLAVKREDIQDVAKKYLRDDKRAIVFRRPASAPAQEAA
Ga0210405_1004117953300021171SoilLAVTREDVLAAAKKYLRNDKRAIVFRKPVNVTAKEAA
Ga0210408_1071987923300021178SoilPRLINSMLDGFVAVKSEEIKAVAEKYLQTAKRAIVFRKPTSAAAKEVA
Ga0210408_1121872013300021178SoilPQLVNTILDGFMAVKREEVQAVSQKYLRSEKRAIVFRVPANASAKEAA
Ga0210388_1005061513300021181SoilILDGFLAVKKEDVQAVAKKYLRAENRAIVFRTPVKAGEKEAA
Ga0210397_1042816913300021403SoilFLAVKKEDVQAVAKKYLRAENRAIVFRTPVKAGEKEAA
Ga0210397_1075133813300021403SoilTLFDNEPQLVNTILDGFLAVAREEIQAAAKKYLRTEKRAIVFRTPVKAKTQEAA
Ga0210397_1131126513300021403SoilLAVKKEDVQAVAKKYLRAENRAIVFRTPLKAEGKTAGEKEAA
Ga0210383_1111723213300021407SoilGEPQLVNTVLDDFLSVKREDILAAAKKYLHKEKRAIVFRIPAVAGADKKEAA
Ga0210394_1037371813300021420SoilGFLAVKREDIQRVAKKYLVPENRAIVFRAPVNTEAKEAA
Ga0210384_1063080423300021432SoilPQLVNTVLDGFLSVKREEIHAVAKKYLLKEKRAMVFRRPVMVGVPASAGKKEAA
Ga0210390_1154929723300021474SoilLDGFLAVAREEIQAAAKKYLRTEKRAIVFRTPVKAKTQEAA
Ga0210392_1117126123300021475SoilRAVKREEIQAVAKKYLRSEKRAIVFRKPVKAVAKEAA
Ga0210402_1135912323300021478SoilLFDNEPQLVNSILDGFLAVKREEIQAVAKKYLRNDKRAIVFRKPAGAVAKEAA
Ga0210409_1003153313300021559SoilLGVTREQVQAAAKKYLQKEKRAIVFRKPVQSSVKEAA
Ga0210409_1058825523300021559SoilGFLAVKREEIQAAAKKYLLPENRAIVFRTPVNKDVKEAA
Ga0213853_1053264613300021861WatershedsLVNSILDGFLTVTPEDIHAVAKKYLRNERRAIVIRTPVKGSVKEAA
Ga0242654_1027837923300022726SoilFLAVTREQVQEVAKKYLRPENRAIVFRMPAKSEVKEAA
Ga0247679_107299023300024251SoilQLVNTILDGFLQVTPEQVQAAAKKYLRKENRAIVFRAPANLAAKEAA
Ga0247678_100927923300024325SoilARVLLALGEPQLVNAILDGFLQVTPEQVQSAAKKYLRKENRAIVFRSPANLGVKEVA
Ga0137417_117062623300024330Vadose Zone SoilNSILDGFLAVRCEDIQAVAKKYLRNDQRAIVFRRPIDAHAKEAA
Ga0137417_139424513300024330Vadose Zone SoilLFDNEPQLVNTILDGFLAVTREEIQAAAAKKYLRNEKRAIVFRTPVNAGAKEAA
Ga0209237_107607423300026297Grasslands SoilVNTILDGFLAVTREEIHDVAKKYLRKEKRAIVFRTPAKAGAKEVA
Ga0257163_102649123300026359SoilIQAVAKKYLRNERRAIVFRTPVKAGVPADAGAKEAA
Ga0209808_105822423300026523SoilEILTVAKRYLRNEKRAIVFRTPVKTSAPSDKKEAA
Ga0209690_109977413300026524SoilDCFLQVTPEQVLAVARKYLRKENRALVVRAPANLGAKEAA
Ga0209690_125045013300026524SoilVNTILDGFLAVTREEIQAAAKKYLRNEKRAIVFRTPVNAGAKEAA
Ga0207781_101729923300026890Tropical Forest SoilFQRVTAAEVQAVANKYLQPVNRAIVFRAPAKNGREAA
Ga0207506_100095713300027460SoilVNTVLDGFLSVTRDEILAAANKYLRKEKRAIVFRRPAAAGVKEAA
Ga0208993_103644313300027480Forest SoilEEIQAVAKKYLRNEKRAIVFRTPVKAAVPAGAKEAA
Ga0208042_112683913300027568Peatlands SoilLDGFLEVKREELHRAAQKYLRPENRAIVFRTPVKSDAKEAA
Ga0209528_101845613300027610Forest SoilQPQLVNSILDGFLAVKRDEIQAVAKKYLRSANRAVVFRTPIKAAAKEAA
Ga0209422_100644443300027629Forest SoilGFLAVTREDVLAAAKKYLRNDKRAIVFRKPVNVAAKEAA
Ga0209625_114528113300027635Forest SoilLVNTILDGFLAVKGEDIQGVAKKYLLNNKRAIVFRRPVNASAQEAA
Ga0209447_1012654813300027701Bog Forest SoilILDGFLAVKREEIQSVAKKYLRTEKRAIVFRKPVKPAAQEAA
Ga0209039_1040839223300027825Bog Forest SoilPELVNTILDDFLAVTREDVHAAAKEYLRRENRAIVFRTPVKSDAREAA
Ga0209180_1023849013300027846Vadose Zone SoilEEIQAVAKKYLRNEKRAIVFRTPVKAAVPADAGAKEAA
Ga0209517_1071014923300027854Peatlands SoilNEPQLVNTILDGFLGVKREEVHRAAQKYLRPENRAIVFRTPAKSDAKEAA
Ga0209701_1017674013300027862Vadose Zone SoilRERVQAVAKKYLRNENRAIVFRTPVKAGVPADAKEAA
Ga0209701_1034288823300027862Vadose Zone SoilFLALKREDIQTVAQKYLRSDKRAIVFRRPVNAQAREAA
Ga0209167_1014507823300027867Surface SoilVTREDIQRVADKYLKAENRAIVFRTPVSKTVKEAA
Ga0209283_1009363613300027875Vadose Zone SoilAVKSEEIKAVAEKYLRTEKRAIVFRKPVAAAAKEAA
Ga0247684_103528913300028138SoilFLQVTPEQVQSAAKKYLRKENRAIVFRSPANLGVNEVA
Ga0137415_1070833323300028536Vadose Zone SoilLAVSREEILAVAKKYLRNEKRAIVFRRPLKAGAKEAA
Ga0308309_1153116513300028906SoilEMVNSILDGFLAVKREDVQAVAKKYLRAENRAIVFRTPVKTDKKEAA
Ga0311355_1002903473300030580PalsaLVNSILDGVLAVKRAEIQQVAKKYLRPEHRAIVFRTPVKNVKEAA
Ga0170834_10849878513300031057Forest SoilLVNSMLDCFLAVKREEIQAVAKKYLHPTNRAVVFRTPIKAAAKEAA
Ga0307497_1029296523300031226SoilGFLAVTRAQVQEVAKKYLRPENRAIVFRMPAKSEVKEAA
Ga0265320_1027230823300031240RhizosphereNEPQLVNSILDGFLAVKREDVLAAAKKYLLKEKRAIVFRLPVTAGVKEAA
Ga0265340_1047857213300031247RhizosphereTLFDNEPQLVNSILDGFLAVKREDVLAAAKKYLLKEKRAIVFRLPVTAGVKEAA
Ga0310915_1052092813300031573SoilDPQLVNSILDGFLAVKREEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA
Ga0318542_1044805423300031668SoilLKVTKEEVHAAARKYLVPENRAIVFRTPVGRQEAA
Ga0318574_1093702223300031680SoilFLAVKREEIQNVAQKYLLPENRAIVLRTPVTSDAKEAA
Ga0318572_1034292413300031681SoilDGFLAVKREEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA
Ga0310686_10833870623300031708SoilSVKREDILAAAKKYLRKEKRAIVFRIPAVAGADKKEAA
Ga0307469_1158033323300031720Hardwood Forest SoilHLLACFSLFDNEPQLVNTVLDGFLAVKCEDIQGVAKKYLRNDKRAIVFRRLPNAQAQEAA
Ga0318501_1000397753300031736SoilFDNQPAHVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA
Ga0306918_1021123923300031744SoilFLAVKREEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA
Ga0307475_1042454713300031754Hardwood Forest SoilPQLVNTVLDGFLAVRKEEVHAVARKYLRRENRAIIFRKPANAVAKEAA
Ga0307475_1136698523300031754Hardwood Forest SoilGFLAVKREDIQRVAKKYLVPENRAIVFRAPVNAGAKEAA
Ga0318550_1020581413300031797SoilVKREEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA
Ga0307473_1060497513300031820Hardwood Forest SoilQLVNTILEGFMAVKREEIQAVAKKYLRPENRAIVFRTPVSKVAKEAA
Ga0307478_1101086713300031823Hardwood Forest SoilPRLINSMLDGFLAVKSEEIKAVAEKYLQTSKRAIVFRKPASAAAKEAA
Ga0318551_1001995413300031896SoilFDNQPALVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA
Ga0310916_1157287623300031942SoilVNTILNDFLKVTQEEVHAAAQKYLVPENRAIVFRTPVGKQEAA
Ga0306926_1048780823300031954SoilNQPALVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA
Ga0307479_1061970513300031962Hardwood Forest SoilDNEPQLVNTILDGFLAVKREDIQGVAKKYLRNDKRAIVFRRPATQAQEAA
Ga0318505_1045824323300032060SoilLFDNQPALVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA
Ga0318514_1046197423300032066SoilVNTILEDFLKVTKEEVHAAARKYLVPENRAIVFRTPVGRQEAA
Ga0306924_1079818723300032076SoilLVNSILNDFLKSTREEVQAAAKRYLVPENRAIVFRAPTSKKEAA
Ga0307471_10003078743300032180Hardwood Forest SoilDQFLAVTRDEIQAAAKKYLRNEKRAIVFRTPVKAGAKEAA
Ga0307471_10036116913300032180Hardwood Forest SoilILDGFLAVEREDIQDVAKKYLRNDKRAIVFRRPASAPAQEAA
Ga0307471_10069610323300032180Hardwood Forest SoilGVRREDIQAVAKTYLRNDKRAIVFRRPVHVQAKEAA
Ga0307471_10137335013300032180Hardwood Forest SoilLVNTILDGFLAVTREDVLAAAKKYLRNDKRAIVFRKPVNVVAKEAA
Ga0307471_10272165613300032180Hardwood Forest SoilFLAVTREEIQAAAKKYLRNEKRAIVFRMPVNTGAKEAG
Ga0307472_10118179313300032205Hardwood Forest SoilILAAAKKYLRNEKRAIVFRTPIKASAPLSTGEKEAA
Ga0335078_10032464103300032805SoilILGGFLAVKREEIQAVAKKYLKSENRAIVFRTPVVKDAKEAA
Ga0335080_1098222123300032828SoilILDGFLAVTREQVQEVAKKYLRPENRAIVFRMPAKSDAKEAA
Ga0335074_1135394613300032895SoilDNDPQLVNTVLQSFLVVQREQIQAVANKYLRPENRAIVFRAPVSKDAKEAA
Ga0335083_1024765113300032954SoilVKPEEIQAAAQKYLKPQNRAIVFRAPVSKNEKEAA
Ga0335083_1078183433300032954SoilLVNTILDGFLTVTRDQVQAAAKQYLVPRNRAIVFRTPSKAGAQEAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.