Basic Information | |
---|---|
Family ID | F041414 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 160 |
Average Sequence Length | 44 residues |
Representative Sequence | LVNTILDGFLAVTREEIQAAAKKYLRNEKRAIVFRTPVKAGAKEAA |
Number of Associated Samples | 139 |
Number of Associated Scaffolds | 160 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.63 % |
% of genes near scaffold ends (potentially truncated) | 96.88 % |
% of genes from short scaffolds (< 2000 bps) | 87.50 % |
Associated GOLD sequencing projects | 131 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.750 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.250 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.125 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.875 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.08% β-sheet: 0.00% Coil/Unstructured: 68.92% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 160 Family Scaffolds |
---|---|---|
PF05193 | Peptidase_M16_C | 38.12 |
PF00675 | Peptidase_M16 | 23.75 |
PF12836 | HHH_3 | 3.12 |
PF00926 | DHBP_synthase | 1.25 |
PF02574 | S-methyl_trans | 0.62 |
PF00118 | Cpn60_TCP1 | 0.62 |
PF02899 | Phage_int_SAM_1 | 0.62 |
PF05016 | ParE_toxin | 0.62 |
COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
---|---|---|---|
COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 1.25 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.62 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.62 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.62 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.75 % |
Unclassified | root | N/A | 1.25 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_103765557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300000955|JGI1027J12803_108950242 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300001356|JGI12269J14319_10087030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1614 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100787249 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300002917|JGI25616J43925_10292849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300004092|Ga0062389_103713960 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300004114|Ga0062593_100419972 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300004635|Ga0062388_100606486 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300005434|Ga0070709_11369608 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005526|Ga0073909_10553734 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300005534|Ga0070735_10422933 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300005537|Ga0070730_11072371 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005538|Ga0070731_10067917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2365 | Open in IMG/M |
3300005538|Ga0070731_10808762 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300005554|Ga0066661_10864563 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005591|Ga0070761_11098020 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300005602|Ga0070762_10170537 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300005615|Ga0070702_100846321 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300005764|Ga0066903_100529221 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
3300005921|Ga0070766_10060918 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
3300006028|Ga0070717_11260586 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300006172|Ga0075018_10135760 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300006174|Ga0075014_100668226 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300006176|Ga0070765_100173955 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
3300006176|Ga0070765_101930846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 553 | Open in IMG/M |
3300006791|Ga0066653_10423305 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300006804|Ga0079221_10692169 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300006939|Ga0081244_1499170 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300009038|Ga0099829_11722607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300009088|Ga0099830_10649099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300009088|Ga0099830_11089751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300009089|Ga0099828_10165996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1959 | Open in IMG/M |
3300009545|Ga0105237_10922035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
3300009698|Ga0116216_10345176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
3300009698|Ga0116216_10949785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300010046|Ga0126384_10015407 | All Organisms → cellular organisms → Bacteria | 4843 | Open in IMG/M |
3300010048|Ga0126373_12049097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
3300010326|Ga0134065_10016145 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300010337|Ga0134062_10747444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300010364|Ga0134066_10108234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 818 | Open in IMG/M |
3300010366|Ga0126379_10909166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
3300010376|Ga0126381_101172748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1110 | Open in IMG/M |
3300010877|Ga0126356_10750035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300011269|Ga0137392_11252220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300011270|Ga0137391_11462334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300012096|Ga0137389_11598773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300012096|Ga0137389_11739725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300012349|Ga0137387_11296098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300012351|Ga0137386_10581269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 806 | Open in IMG/M |
3300012361|Ga0137360_10856373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300012362|Ga0137361_11378663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300012683|Ga0137398_10556211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
3300012918|Ga0137396_11186259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300012925|Ga0137419_11217502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300012944|Ga0137410_10698727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300012944|Ga0137410_11503665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300012971|Ga0126369_11422400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300013296|Ga0157374_11151327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
3300014153|Ga0181527_1035856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2864 | Open in IMG/M |
3300014201|Ga0181537_10593766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300015167|Ga0167661_1065698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300016270|Ga0182036_11874662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300016422|Ga0182039_10204293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1578 | Open in IMG/M |
3300016422|Ga0182039_11747597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300016445|Ga0182038_10013170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4749 | Open in IMG/M |
3300016750|Ga0181505_11008693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
3300017656|Ga0134112_10145431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
3300017924|Ga0187820_1263028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300018062|Ga0187784_11366606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300018085|Ga0187772_10094725 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
3300018088|Ga0187771_11247340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300019788|Ga0182028_1317336 | All Organisms → cellular organisms → Bacteria | 2515 | Open in IMG/M |
3300020034|Ga0193753_10158729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
3300020579|Ga0210407_11021380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300020581|Ga0210399_10963153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300020583|Ga0210401_10801949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
3300021046|Ga0215015_10502878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1145 | Open in IMG/M |
3300021046|Ga0215015_10725774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1256 | Open in IMG/M |
3300021168|Ga0210406_10879839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300021171|Ga0210405_10041179 | All Organisms → cellular organisms → Bacteria | 3674 | Open in IMG/M |
3300021178|Ga0210408_10719879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
3300021178|Ga0210408_11218720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300021181|Ga0210388_10050615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3463 | Open in IMG/M |
3300021403|Ga0210397_10428169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
3300021403|Ga0210397_10751338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
3300021403|Ga0210397_11311265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300021407|Ga0210383_11117232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300021420|Ga0210394_10373718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1253 | Open in IMG/M |
3300021432|Ga0210384_10630804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
3300021474|Ga0210390_11549297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300021475|Ga0210392_11171261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300021478|Ga0210402_11359123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300021559|Ga0210409_10031533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5093 | Open in IMG/M |
3300021559|Ga0210409_10588255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
3300021861|Ga0213853_10532646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
3300022726|Ga0242654_10278379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300024251|Ga0247679_1072990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300024325|Ga0247678_1009279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1414 | Open in IMG/M |
3300024330|Ga0137417_1170626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
3300024330|Ga0137417_1394245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
3300026297|Ga0209237_1076074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1558 | Open in IMG/M |
3300026523|Ga0209808_1058224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1732 | Open in IMG/M |
3300026524|Ga0209690_1099774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1190 | Open in IMG/M |
3300026524|Ga0209690_1250450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300026890|Ga0207781_1017299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300027460|Ga0207506_1000957 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
3300027480|Ga0208993_1036443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
3300027568|Ga0208042_1126839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300027610|Ga0209528_1018456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1531 | Open in IMG/M |
3300027629|Ga0209422_1006444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2890 | Open in IMG/M |
3300027635|Ga0209625_1145281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300027701|Ga0209447_10126548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300027825|Ga0209039_10408392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300027846|Ga0209180_10238490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
3300027854|Ga0209517_10710149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300027862|Ga0209701_10176740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1287 | Open in IMG/M |
3300027862|Ga0209701_10342888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
3300027867|Ga0209167_10145078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1242 | Open in IMG/M |
3300027875|Ga0209283_10093636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1959 | Open in IMG/M |
3300028138|Ga0247684_1035289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
3300028536|Ga0137415_10708333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
3300028906|Ga0308309_11531165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300030580|Ga0311355_10029034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6773 | Open in IMG/M |
3300031057|Ga0170834_108498785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300031226|Ga0307497_10292965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300031240|Ga0265320_10272308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300031247|Ga0265340_10478572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300031573|Ga0310915_10520928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
3300031668|Ga0318542_10448054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300031680|Ga0318574_10937022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300031681|Ga0318572_10342924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
3300031708|Ga0310686_108338706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300031720|Ga0307469_11580333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300031736|Ga0318501_10003977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 5022 | Open in IMG/M |
3300031744|Ga0306918_10211239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1467 | Open in IMG/M |
3300031754|Ga0307475_10424547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
3300031754|Ga0307475_11366985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300031797|Ga0318550_10205814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
3300031820|Ga0307473_10604975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300031823|Ga0307478_11010867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300031896|Ga0318551_10019954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales → Hydrogenophilaceae → unclassified Hydrogenophilaceae → Hydrogenophilaceae bacterium | 3102 | Open in IMG/M |
3300031942|Ga0310916_11572876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300031954|Ga0306926_10487808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1515 | Open in IMG/M |
3300031962|Ga0307479_10619705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
3300032060|Ga0318505_10458243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300032066|Ga0318514_10461974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300032076|Ga0306924_10798187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
3300032180|Ga0307471_100030787 | All Organisms → cellular organisms → Bacteria | 4132 | Open in IMG/M |
3300032180|Ga0307471_100361169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1566 | Open in IMG/M |
3300032180|Ga0307471_100696103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1180 | Open in IMG/M |
3300032180|Ga0307471_101373350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300032180|Ga0307471_102721656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300032205|Ga0307472_101181793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
3300032805|Ga0335078_10032464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7756 | Open in IMG/M |
3300032828|Ga0335080_10982221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
3300032895|Ga0335074_11353946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300032954|Ga0335083_10247651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1596 | Open in IMG/M |
3300032954|Ga0335083_10781834 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.25% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.12% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.12% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.12% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.75% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.50% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.88% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.25% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.25% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.25% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.62% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.62% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.62% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.62% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.62% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.62% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006939 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
3300027460 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1037655572 | 3300000364 | Soil | EPHLVNSILDGFDAVKPAEIQSVAQKYLRPENRAIVFRKPAAGKKEAA* |
JGI1027J12803_1089502422 | 3300000955 | Soil | QLVNTILDGFLAVTRSQLQEVAKKYLRPENRAIVFRMPAKSEVKEAA* |
JGI12269J14319_100870302 | 3300001356 | Peatlands Soil | KREEIQGAAQKYLRAENRAIVFRTPVKSVAKEAA* |
JGIcombinedJ26739_1007872491 | 3300002245 | Forest Soil | QLVNSILGGFLAVKREEIQAVAKKYLHPANRAVVFRTPIKAAAKEAA* |
JGI25616J43925_102928491 | 3300002917 | Grasslands Soil | TILDGFIAVTREEIQAAAKKYLRNEKRAIVFRTPVKANAKEAA* |
Ga0062389_1037139601 | 3300004092 | Bog Forest Soil | VNSILDGFLAVKREEIQAVAKKYLHPANRAVVFRTPITAAAKEAA* |
Ga0062593_1004199721 | 3300004114 | Soil | EPQLVNTVLDGFLSVTRDEILAAANKYLRKEKRAIVFRRPAAAGVKEAA* |
Ga0062388_1006064861 | 3300004635 | Bog Forest Soil | DREPELVNTILEGFLAVTREDVQAAAKKYLVDARRAIVFRTPVAAGAKEAA* |
Ga0070709_113696081 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SILDGFLAVKREEVQQVAKKVLQPQNRAIVFRKPVTKKEAA* |
Ga0073909_105537341 | 3300005526 | Surface Soil | QLVNSILDGFLAVTREDVQAAAKKYLRNEKRAIVFRTPVNAGAKEAA* |
Ga0070735_104229332 | 3300005534 | Surface Soil | NKPEMVNSILDGFLAVKREDVQAVAKKYLRAENRAIVFRTPVKSSEKEAA* |
Ga0070730_110723711 | 3300005537 | Surface Soil | VNTVLDGFLSVKQDEILAAANKYLRKEKRAIVFRRPAAAGVKEAA* |
Ga0070731_100679174 | 3300005538 | Surface Soil | DGFLTVKREDVLAAAKKYLLREKRAIVFRLPVTAGVKEAA* |
Ga0070731_108087622 | 3300005538 | Surface Soil | DNKPELVNSILDGFLAVKKQDVQAVAKKYLRAENRAIVFRTPVKAGEKEAA* |
Ga0066661_108645632 | 3300005554 | Soil | FDNEPQLVNTILDGFFAVTPEQVHSVAGKYLRKEKRAIVFRVPASAGVKEAA* |
Ga0070761_110980201 | 3300005591 | Soil | DNEPQLVNTIMDGFLAVKREEIRAVARRYLRAENRAIVFRAPVMKNETEVA* |
Ga0070762_101705372 | 3300005602 | Soil | LFDNQPQLVNSILDGFLAVKSEEIQAVAKKYLHPTNRAVVFRTPIKAAAKEAA* |
Ga0070702_1008463211 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | TLFDNEPQLVNSILDGFLAVKREEIQGVAKRVLRPENRAIVFRKPVAKKEAA* |
Ga0066903_1005292214 | 3300005764 | Tropical Forest Soil | LVNTILDGFLAVTCAQVQEVAKKYLRPENRAIVFRMPAKSEVKEAA* |
Ga0070766_100609181 | 3300005921 | Soil | VNSILDGFLAVKREEIQAVAKKYLHPANRAVVFRTPIKAAAKEAA* |
Ga0070717_112605862 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SILDGFLAVKPEEIQSVARKYLRPENRAIVFRAPSKSSAKEAA* |
Ga0075018_101357601 | 3300006172 | Watersheds | DGFLAVTREQVQEVAKKYLRPENRAIVFRMPAKSEVKEAA* |
Ga0075014_1006682261 | 3300006174 | Watersheds | EPQLVNTILDGFLTVKREEVQAVARKYLRTEKRAIVFRKPVHASAKEAA* |
Ga0070765_1001739553 | 3300006176 | Soil | ILDGFLAVKREDVQAVAKKYLRAENRAIVFRTPVKSSEKEAA* |
Ga0070765_1019308462 | 3300006176 | Soil | LFDNQPQLVNSILDGFLAVKREEIQAVANKYLHATNRAVVFRTPVKAVAKEAA* |
Ga0066653_104233051 | 3300006791 | Soil | LVNSILDGFLAVTREDVERAAQNYLRREKRAVIFRQPARGSKEAAA* |
Ga0066660_116444561 | 3300006800 | Soil | FLAVSREEIQAVAKKYLRNEKRAIVFRTPVKAALPAGAKEAA* |
Ga0079221_106921691 | 3300006804 | Agricultural Soil | LAVTREEIHSVAKKYLRDEKRAIVFRVPAKAGAKEAA* |
Ga0081244_14991702 | 3300006939 | Tropical Rainforest Soil | LVNTILTDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA* |
Ga0099829_117226072 | 3300009038 | Vadose Zone Soil | VNSILDGFLAVTREEIQAVAKKYLRNDQRAIVFRTPVKPDAKVAA* |
Ga0099830_106490991 | 3300009088 | Vadose Zone Soil | EPQLVNTILDGFLAVKREDIQTVAQKYLRSDKRAIVFRRPVNAQAREAA* |
Ga0099830_110897512 | 3300009088 | Vadose Zone Soil | LVNTILDGFLAVTREEIQAAAKKYLRNEKRAIVFRTPVKAGAKEAA* |
Ga0099828_101659964 | 3300009089 | Vadose Zone Soil | AVKSEEIKAVAEKYLRTEKRAIVFRKPVAAAAKEAA* |
Ga0105237_109220352 | 3300009545 | Corn Rhizosphere | PELVNSILDGFLAVKKEDVQAVAKKYLRAENRAIVFRTPVKTEGKTAGEKEAA* |
Ga0116216_103451762 | 3300009698 | Peatlands Soil | FDGEPQLVNTVLDGFLAVKREDIQAAAKKYLRSEKRAIVFRLPTVAGVKEAA* |
Ga0116216_109497852 | 3300009698 | Peatlands Soil | GFLEVKREELHRAAQKYLRPENRVIVFRTPVKSDAKEAA* |
Ga0126384_100154075 | 3300010046 | Tropical Forest Soil | LQVTPEQVQAVAKKYLHKENRAIVFRAPAANQKEAA* |
Ga0126373_120490972 | 3300010048 | Tropical Forest Soil | LVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA* |
Ga0134065_100161451 | 3300010326 | Grasslands Soil | VTPEEILAVAKKYLRNEKRAIVFRTPLKASAPLDKKEAA* |
Ga0134062_107474441 | 3300010337 | Grasslands Soil | PQLVNTILDGFLAVTPEEIHSVAKKYLRNEKRAIVFRTPARAGVKEAA* |
Ga0134066_101082342 | 3300010364 | Grasslands Soil | DHNPQLVNTILDGFLEVTEEEILSAARRYLRTENRAIVFRTPTRLREQAV* |
Ga0126379_109091662 | 3300010366 | Tropical Forest Soil | PEQVHSVAKKYLRNEKRAIVFRTPAKTGSPAGVKEAA* |
Ga0126381_1011727482 | 3300010376 | Tropical Forest Soil | VNSILDGFLAVKREEIQAVAKKYLRPENRAIVFRTPVAKDAEEAA* |
Ga0126356_107500352 | 3300010877 | Boreal Forest Soil | LFDNEPQLVNSILDGFLAVTREEIQAAAKKYLRNEKRAIVFRRPANAQAQEAA* |
Ga0137392_112522202 | 3300011269 | Vadose Zone Soil | DGFLAVKREDIQAVAKRYLRNDKRAIVFRRPVAAHAKEAA* |
Ga0137391_114623342 | 3300011270 | Vadose Zone Soil | DGEPQLVNTVLDGFLAVKKEEVHAVARKYLRTENRAIIFRKPANAVAKEAA* |
Ga0137389_115987732 | 3300012096 | Vadose Zone Soil | FLAVTREEIHAAAKKYLRAEKRAIVFRTPAKAGAKEAA* |
Ga0137389_117397251 | 3300012096 | Vadose Zone Soil | TILDGFLAVTREQIHSAAKKYLRNEKRAIVFRTPVKASAKEAA* |
Ga0137387_112960982 | 3300012349 | Vadose Zone Soil | DGFLAVTRDEIQAVARKYLRNEKRAIVFRTPVKAREKEAA* |
Ga0137386_105812692 | 3300012351 | Vadose Zone Soil | FLAVTREQMMTVAQKYLRNEKRAIVFRAPAKVAAKEVA* |
Ga0137360_108563731 | 3300012361 | Vadose Zone Soil | TILDGFLAVKKEEVHAVARKYLRTENRAIIFRKPANAVAKEAA* |
Ga0137361_113786632 | 3300012362 | Vadose Zone Soil | FLAVTREQIHSAAKKYLRNEKRAIVFRTPVKASAQEAA* |
Ga0137398_105562111 | 3300012683 | Vadose Zone Soil | EIQAVAKKYLRNEKRAIVFRTPVKAGVPADAGAKEAA* |
Ga0137396_111862592 | 3300012918 | Vadose Zone Soil | DGFLAVTREEIQAVANKYLRNEKRAIVFRTPVKVGAKEAA* |
Ga0137419_112175022 | 3300012925 | Vadose Zone Soil | DGFLQVSPQQVQAAAKKYLRKENRAIVFRAPANLGAKEAA* |
Ga0137410_106987271 | 3300012944 | Vadose Zone Soil | ELWLLNNVLDGFLAVTREEIHAAAKKYLRNEKRAIVFRTPVKASAKEAA* |
Ga0137410_115036651 | 3300012944 | Vadose Zone Soil | ILDGFLAVTRDEIEAAARKYLRNEKRAIVFRTPVKASAKEVA* |
Ga0126369_114224002 | 3300012971 | Tropical Forest Soil | DNEPQLVNTILDGFLAVRREEVHSAARRYLRNEKRAIVFRTPANAGAKEAA* |
Ga0157374_111513271 | 3300013296 | Miscanthus Rhizosphere | PQLVNSILDGFLAVKREEIQGVAKRVLRPENRAIVFRKPVAKKEAA* |
Ga0181527_10358561 | 3300014153 | Bog | LEVKREEVQRAAQKYLRPENRAIVFRTPVKSDAKEAA* |
Ga0181537_105937661 | 3300014201 | Bog | KREDVQAVAKKYLRAENRAIVFRTPVKAGEKEAA* |
Ga0167661_10656982 | 3300015167 | Glacier Forefield Soil | VTREDVLAAAKKYLRNDQRAIVFRTPANVASKEAA* |
Ga0182036_118746621 | 3300016270 | Soil | NDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA |
Ga0182039_102042932 | 3300016422 | Soil | NTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA |
Ga0182039_117475972 | 3300016422 | Soil | DPQLVNSILDGFLGVKREDIQRVAKRYLVPENRAIVFRTPVRKGEKEAA |
Ga0182038_100131701 | 3300016445 | Soil | GRVNTIQSDFLKVTREEVQSAAKKYLLPENRAIVFRTPVSKKEAA |
Ga0181505_110086932 | 3300016750 | Peatland | FDNEPQLVNTILEGFLAVKREEIQACAKRYLQPENRAIVFRTPVNRDVKEAA |
Ga0134112_101454312 | 3300017656 | Grasslands Soil | FLAVTPEEILAVAKKYLRNEKRAIVFRTPLKASAPLDKKEAA |
Ga0187820_12630281 | 3300017924 | Freshwater Sediment | PEMVNSILDGFLAVKKEDVQAVAKKYLRAENRAIVFRTPVKAEGKPAGEKEAA |
Ga0187784_113666061 | 3300018062 | Tropical Peatland | ILDGFLAVTREETQAAAKKYLRNDRRAIVFRLPAKPSVKEAA |
Ga0187772_100947251 | 3300018085 | Tropical Peatland | NTILDGFLAVKHEEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA |
Ga0187771_112473401 | 3300018088 | Tropical Peatland | NEPQLVNTILDGFLAVTREEIHAAAKKYLRNDKRAIVFRIPAKANVKEAA |
Ga0182028_13173365 | 3300019788 | Fen | VKREEIQNAAQKYLRVENRAIVFRTPVKSDVKEAA |
Ga0193753_101587292 | 3300020034 | Soil | LAVTREEIQAAAKKYLRNEKRAIVFRAPVKTDAKEAA |
Ga0210407_110213801 | 3300020579 | Soil | AVKREEIQAVAKKYLHPTNRAVVFRTPIKAAAKEAA |
Ga0210399_109631532 | 3300020581 | Soil | LAVKREEVQAAAKKYLLPENRAIVFRTPVNKDVKEAA |
Ga0210401_108019492 | 3300020583 | Soil | NSILDGFLAVKREEIQAVAKKYLHPANRAVVFRTPIKAAAKEAA |
Ga0215015_105028781 | 3300021046 | Soil | MCIRDRFDGEPQLVNTVLDGFLAVRKEEVHAVARKYLRTENRAIIFRKPANAVAKEAA |
Ga0215015_107257741 | 3300021046 | Soil | AVKREDIQAVAQKYLRKDRRAIVFRCPVKAHAKEAA |
Ga0210406_108798391 | 3300021168 | Soil | PQLVNTILDGFLAVKREDIQDVAKKYLRDDKRAIVFRRPASAPAQEAA |
Ga0210405_100411795 | 3300021171 | Soil | LAVTREDVLAAAKKYLRNDKRAIVFRKPVNVTAKEAA |
Ga0210408_107198792 | 3300021178 | Soil | PRLINSMLDGFVAVKSEEIKAVAEKYLQTAKRAIVFRKPTSAAAKEVA |
Ga0210408_112187201 | 3300021178 | Soil | PQLVNTILDGFMAVKREEVQAVSQKYLRSEKRAIVFRVPANASAKEAA |
Ga0210388_100506151 | 3300021181 | Soil | ILDGFLAVKKEDVQAVAKKYLRAENRAIVFRTPVKAGEKEAA |
Ga0210397_104281691 | 3300021403 | Soil | FLAVKKEDVQAVAKKYLRAENRAIVFRTPVKAGEKEAA |
Ga0210397_107513381 | 3300021403 | Soil | TLFDNEPQLVNTILDGFLAVAREEIQAAAKKYLRTEKRAIVFRTPVKAKTQEAA |
Ga0210397_113112651 | 3300021403 | Soil | LAVKKEDVQAVAKKYLRAENRAIVFRTPLKAEGKTAGEKEAA |
Ga0210383_111172321 | 3300021407 | Soil | GEPQLVNTVLDDFLSVKREDILAAAKKYLHKEKRAIVFRIPAVAGADKKEAA |
Ga0210394_103737181 | 3300021420 | Soil | GFLAVKREDIQRVAKKYLVPENRAIVFRAPVNTEAKEAA |
Ga0210384_106308042 | 3300021432 | Soil | PQLVNTVLDGFLSVKREEIHAVAKKYLLKEKRAMVFRRPVMVGVPASAGKKEAA |
Ga0210390_115492972 | 3300021474 | Soil | LDGFLAVAREEIQAAAKKYLRTEKRAIVFRTPVKAKTQEAA |
Ga0210392_111712612 | 3300021475 | Soil | RAVKREEIQAVAKKYLRSEKRAIVFRKPVKAVAKEAA |
Ga0210402_113591232 | 3300021478 | Soil | LFDNEPQLVNSILDGFLAVKREEIQAVAKKYLRNDKRAIVFRKPAGAVAKEAA |
Ga0210409_100315331 | 3300021559 | Soil | LGVTREQVQAAAKKYLQKEKRAIVFRKPVQSSVKEAA |
Ga0210409_105882552 | 3300021559 | Soil | GFLAVKREEIQAAAKKYLLPENRAIVFRTPVNKDVKEAA |
Ga0213853_105326461 | 3300021861 | Watersheds | LVNSILDGFLTVTPEDIHAVAKKYLRNERRAIVIRTPVKGSVKEAA |
Ga0242654_102783792 | 3300022726 | Soil | FLAVTREQVQEVAKKYLRPENRAIVFRMPAKSEVKEAA |
Ga0247679_10729902 | 3300024251 | Soil | QLVNTILDGFLQVTPEQVQAAAKKYLRKENRAIVFRAPANLAAKEAA |
Ga0247678_10092792 | 3300024325 | Soil | ARVLLALGEPQLVNAILDGFLQVTPEQVQSAAKKYLRKENRAIVFRSPANLGVKEVA |
Ga0137417_11706262 | 3300024330 | Vadose Zone Soil | NSILDGFLAVRCEDIQAVAKKYLRNDQRAIVFRRPIDAHAKEAA |
Ga0137417_13942451 | 3300024330 | Vadose Zone Soil | LFDNEPQLVNTILDGFLAVTREEIQAAAAKKYLRNEKRAIVFRTPVNAGAKEAA |
Ga0209237_10760742 | 3300026297 | Grasslands Soil | VNTILDGFLAVTREEIHDVAKKYLRKEKRAIVFRTPAKAGAKEVA |
Ga0257163_10264912 | 3300026359 | Soil | IQAVAKKYLRNERRAIVFRTPVKAGVPADAGAKEAA |
Ga0209808_10582242 | 3300026523 | Soil | EILTVAKRYLRNEKRAIVFRTPVKTSAPSDKKEAA |
Ga0209690_10997741 | 3300026524 | Soil | DCFLQVTPEQVLAVARKYLRKENRALVVRAPANLGAKEAA |
Ga0209690_12504501 | 3300026524 | Soil | VNTILDGFLAVTREEIQAAAKKYLRNEKRAIVFRTPVNAGAKEAA |
Ga0207781_10172992 | 3300026890 | Tropical Forest Soil | FQRVTAAEVQAVANKYLQPVNRAIVFRAPAKNGREAA |
Ga0207506_10009571 | 3300027460 | Soil | VNTVLDGFLSVTRDEILAAANKYLRKEKRAIVFRRPAAAGVKEAA |
Ga0208993_10364431 | 3300027480 | Forest Soil | EEIQAVAKKYLRNEKRAIVFRTPVKAAVPAGAKEAA |
Ga0208042_11268391 | 3300027568 | Peatlands Soil | LDGFLEVKREELHRAAQKYLRPENRAIVFRTPVKSDAKEAA |
Ga0209528_10184561 | 3300027610 | Forest Soil | QPQLVNSILDGFLAVKRDEIQAVAKKYLRSANRAVVFRTPIKAAAKEAA |
Ga0209422_10064444 | 3300027629 | Forest Soil | GFLAVTREDVLAAAKKYLRNDKRAIVFRKPVNVAAKEAA |
Ga0209625_11452811 | 3300027635 | Forest Soil | LVNTILDGFLAVKGEDIQGVAKKYLLNNKRAIVFRRPVNASAQEAA |
Ga0209447_101265481 | 3300027701 | Bog Forest Soil | ILDGFLAVKREEIQSVAKKYLRTEKRAIVFRKPVKPAAQEAA |
Ga0209039_104083922 | 3300027825 | Bog Forest Soil | PELVNTILDDFLAVTREDVHAAAKEYLRRENRAIVFRTPVKSDAREAA |
Ga0209180_102384901 | 3300027846 | Vadose Zone Soil | EEIQAVAKKYLRNEKRAIVFRTPVKAAVPADAGAKEAA |
Ga0209517_107101492 | 3300027854 | Peatlands Soil | NEPQLVNTILDGFLGVKREEVHRAAQKYLRPENRAIVFRTPAKSDAKEAA |
Ga0209701_101767401 | 3300027862 | Vadose Zone Soil | RERVQAVAKKYLRNENRAIVFRTPVKAGVPADAKEAA |
Ga0209701_103428882 | 3300027862 | Vadose Zone Soil | FLALKREDIQTVAQKYLRSDKRAIVFRRPVNAQAREAA |
Ga0209167_101450782 | 3300027867 | Surface Soil | VTREDIQRVADKYLKAENRAIVFRTPVSKTVKEAA |
Ga0209283_100936361 | 3300027875 | Vadose Zone Soil | AVKSEEIKAVAEKYLRTEKRAIVFRKPVAAAAKEAA |
Ga0247684_10352891 | 3300028138 | Soil | FLQVTPEQVQSAAKKYLRKENRAIVFRSPANLGVNEVA |
Ga0137415_107083332 | 3300028536 | Vadose Zone Soil | LAVSREEILAVAKKYLRNEKRAIVFRRPLKAGAKEAA |
Ga0308309_115311651 | 3300028906 | Soil | EMVNSILDGFLAVKREDVQAVAKKYLRAENRAIVFRTPVKTDKKEAA |
Ga0311355_100290347 | 3300030580 | Palsa | LVNSILDGVLAVKRAEIQQVAKKYLRPEHRAIVFRTPVKNVKEAA |
Ga0170834_1084987851 | 3300031057 | Forest Soil | LVNSMLDCFLAVKREEIQAVAKKYLHPTNRAVVFRTPIKAAAKEAA |
Ga0307497_102929652 | 3300031226 | Soil | GFLAVTRAQVQEVAKKYLRPENRAIVFRMPAKSEVKEAA |
Ga0265320_102723082 | 3300031240 | Rhizosphere | NEPQLVNSILDGFLAVKREDVLAAAKKYLLKEKRAIVFRLPVTAGVKEAA |
Ga0265340_104785721 | 3300031247 | Rhizosphere | TLFDNEPQLVNSILDGFLAVKREDVLAAAKKYLLKEKRAIVFRLPVTAGVKEAA |
Ga0310915_105209281 | 3300031573 | Soil | DPQLVNSILDGFLAVKREEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA |
Ga0318542_104480542 | 3300031668 | Soil | LKVTKEEVHAAARKYLVPENRAIVFRTPVGRQEAA |
Ga0318574_109370222 | 3300031680 | Soil | FLAVKREEIQNVAQKYLLPENRAIVLRTPVTSDAKEAA |
Ga0318572_103429241 | 3300031681 | Soil | DGFLAVKREEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA |
Ga0310686_1083387062 | 3300031708 | Soil | SVKREDILAAAKKYLRKEKRAIVFRIPAVAGADKKEAA |
Ga0307469_115803332 | 3300031720 | Hardwood Forest Soil | HLLACFSLFDNEPQLVNTVLDGFLAVKCEDIQGVAKKYLRNDKRAIVFRRLPNAQAQEAA |
Ga0318501_100039775 | 3300031736 | Soil | FDNQPAHVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA |
Ga0306918_102112392 | 3300031744 | Soil | FLAVKREEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA |
Ga0307475_104245471 | 3300031754 | Hardwood Forest Soil | PQLVNTVLDGFLAVRKEEVHAVARKYLRRENRAIIFRKPANAVAKEAA |
Ga0307475_113669852 | 3300031754 | Hardwood Forest Soil | GFLAVKREDIQRVAKKYLVPENRAIVFRAPVNAGAKEAA |
Ga0318550_102058141 | 3300031797 | Soil | VKREEIQAVAKKYLRPENRAIVFRTPVAKDAKEAA |
Ga0307473_106049751 | 3300031820 | Hardwood Forest Soil | QLVNTILEGFMAVKREEIQAVAKKYLRPENRAIVFRTPVSKVAKEAA |
Ga0307478_110108671 | 3300031823 | Hardwood Forest Soil | PRLINSMLDGFLAVKSEEIKAVAEKYLQTSKRAIVFRKPASAAAKEAA |
Ga0318551_100199541 | 3300031896 | Soil | FDNQPALVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA |
Ga0310916_115728762 | 3300031942 | Soil | VNTILNDFLKVTQEEVHAAAQKYLVPENRAIVFRTPVGKQEAA |
Ga0306926_104878082 | 3300031954 | Soil | NQPALVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA |
Ga0307479_106197051 | 3300031962 | Hardwood Forest Soil | DNEPQLVNTILDGFLAVKREDIQGVAKKYLRNDKRAIVFRRPATQAQEAA |
Ga0318505_104582432 | 3300032060 | Soil | LFDNQPALVNTILNDFLKVTREEVRAAAKAYLVPENRAIVFRTPVSKKEAA |
Ga0318514_104619742 | 3300032066 | Soil | VNTILEDFLKVTKEEVHAAARKYLVPENRAIVFRTPVGRQEAA |
Ga0306924_107981872 | 3300032076 | Soil | LVNSILNDFLKSTREEVQAAAKRYLVPENRAIVFRAPTSKKEAA |
Ga0307471_1000307874 | 3300032180 | Hardwood Forest Soil | DQFLAVTRDEIQAAAKKYLRNEKRAIVFRTPVKAGAKEAA |
Ga0307471_1003611691 | 3300032180 | Hardwood Forest Soil | ILDGFLAVEREDIQDVAKKYLRNDKRAIVFRRPASAPAQEAA |
Ga0307471_1006961032 | 3300032180 | Hardwood Forest Soil | GVRREDIQAVAKTYLRNDKRAIVFRRPVHVQAKEAA |
Ga0307471_1013733501 | 3300032180 | Hardwood Forest Soil | LVNTILDGFLAVTREDVLAAAKKYLRNDKRAIVFRKPVNVVAKEAA |
Ga0307471_1027216561 | 3300032180 | Hardwood Forest Soil | FLAVTREEIQAAAKKYLRNEKRAIVFRMPVNTGAKEAG |
Ga0307472_1011817931 | 3300032205 | Hardwood Forest Soil | ILAAAKKYLRNEKRAIVFRTPIKASAPLSTGEKEAA |
Ga0335078_1003246410 | 3300032805 | Soil | ILGGFLAVKREEIQAVAKKYLKSENRAIVFRTPVVKDAKEAA |
Ga0335080_109822212 | 3300032828 | Soil | ILDGFLAVTREQVQEVAKKYLRPENRAIVFRMPAKSDAKEAA |
Ga0335074_113539461 | 3300032895 | Soil | DNDPQLVNTVLQSFLVVQREQIQAVANKYLRPENRAIVFRAPVSKDAKEAA |
Ga0335083_102476511 | 3300032954 | Soil | VKPEEIQAAAQKYLKPQNRAIVFRAPVSKNEKEAA |
Ga0335083_107818343 | 3300032954 | Soil | LVNTILDGFLTVTRDQVQAAAKQYLVPRNRAIVFRTPSKAGAQEAA |
⦗Top⦘ |