NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041412

Metagenome / Metatranscriptome Family F041412

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041412
Family Type Metagenome / Metatranscriptome
Number of Sequences 160
Average Sequence Length 49 residues
Representative Sequence VSSSSGLARPRPGLATREAAFLLILAAGAWAATVALARGMAGMTGTMGL
Number of Associated Samples 141
Number of Associated Scaffolds 160

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.55 %
% of genes near scaffold ends (potentially truncated) 98.75 %
% of genes from short scaffolds (< 2000 bps) 94.38 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.625 % of family members)
Environment Ontology (ENVO) Unclassified
(28.750 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.500 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.05%    β-sheet: 0.00%    Coil/Unstructured: 51.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 160 Family Scaffolds
PF07040DUF1326 84.38
PF00069Pkinase 3.12
PF10604Polyketide_cyc2 1.25
PF12804NTP_transf_3 0.62
PF13191AAA_16 0.62
PF00501AMP-binding 0.62
PF07690MFS_1 0.62
PF16859TetR_C_11 0.62
PF09334tRNA-synt_1g 0.62
PF05016ParE_toxin 0.62
PF13412HTH_24 0.62
PF01545Cation_efflux 0.62
PF09948DUF2182 0.62
PF01906YbjQ_1 0.62
PF05227CHASE3 0.62
PF12840HTH_20 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 160 Family Scaffolds
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 84.38
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 12.50
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.62
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.62
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.62
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.62
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.62
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.62
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.62
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.62
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.62
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.50 %
UnclassifiedrootN/A2.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001454|JGI20204J15135_1011702All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa824Open in IMG/M
3300002917|JGI25616J43925_10320495All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa576Open in IMG/M
3300004091|Ga0062387_101679715All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa515Open in IMG/M
3300004401|Ga0068980_1129220All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa720Open in IMG/M
3300004619|Ga0068953_1462534All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa779Open in IMG/M
3300004803|Ga0058862_12724259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa630Open in IMG/M
3300005329|Ga0070683_100796710All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa906Open in IMG/M
3300005339|Ga0070660_101327122All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa611Open in IMG/M
3300005344|Ga0070661_100098945All Organisms → cellular organisms → Bacteria2167Open in IMG/M
3300005345|Ga0070692_10308256All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa969Open in IMG/M
3300005435|Ga0070714_100419924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1267Open in IMG/M
3300005436|Ga0070713_101494729All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa655Open in IMG/M
3300005436|Ga0070713_101748134All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa604Open in IMG/M
3300005437|Ga0070710_10555332All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa794Open in IMG/M
3300005456|Ga0070678_100381857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1219Open in IMG/M
3300005468|Ga0070707_101583137All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005536|Ga0070697_101863771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300005540|Ga0066697_10431335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia762Open in IMG/M
3300005560|Ga0066670_11033100All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa503Open in IMG/M
3300005569|Ga0066705_10762978All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa579Open in IMG/M
3300005618|Ga0068864_102727789All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa500Open in IMG/M
3300006052|Ga0075029_101255005All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa519Open in IMG/M
3300006102|Ga0075015_100966349All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa520Open in IMG/M
3300006172|Ga0075018_10260456All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa843Open in IMG/M
3300006176|Ga0070765_101747688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica584Open in IMG/M
3300006755|Ga0079222_10256104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1105Open in IMG/M
3300006797|Ga0066659_10193691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1482Open in IMG/M
3300006871|Ga0075434_101922089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica598Open in IMG/M
3300009038|Ga0099829_10970185All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa705Open in IMG/M
3300009143|Ga0099792_10666998All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa669Open in IMG/M
3300009545|Ga0105237_11214827All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa760Open in IMG/M
3300009551|Ga0105238_12229480All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa582Open in IMG/M
3300009700|Ga0116217_10779521All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa589Open in IMG/M
3300009700|Ga0116217_10819117All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa573Open in IMG/M
3300010325|Ga0134064_10088954All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1001Open in IMG/M
3300010358|Ga0126370_10476817All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1047Open in IMG/M
3300010359|Ga0126376_10685054All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa984Open in IMG/M
3300010362|Ga0126377_10592901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1152Open in IMG/M
3300010366|Ga0126379_11229544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa855Open in IMG/M
3300010366|Ga0126379_13081739All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa558Open in IMG/M
3300010379|Ga0136449_103585678All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa589Open in IMG/M
3300010396|Ga0134126_12257749All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa593Open in IMG/M
3300010859|Ga0126352_1202396All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa701Open in IMG/M
3300010859|Ga0126352_1248787All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa782Open in IMG/M
3300010880|Ga0126350_10980344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa546Open in IMG/M
3300010880|Ga0126350_11857373All Organisms → cellular organisms → Bacteria3032Open in IMG/M
3300011265|Ga0151613_1005763All Organisms → cellular organisms → Bacteria3347Open in IMG/M
3300011270|Ga0137391_10669333All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa865Open in IMG/M
3300011271|Ga0137393_10349286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1263Open in IMG/M
3300012189|Ga0137388_11231498All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa686Open in IMG/M
3300012200|Ga0137382_10353693All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1031Open in IMG/M
3300012206|Ga0137380_11564703All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa544Open in IMG/M
3300012208|Ga0137376_11449940All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa577Open in IMG/M
3300012359|Ga0137385_10911307All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa727Open in IMG/M
3300012930|Ga0137407_10063218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3053Open in IMG/M
3300013059|Ga0154012_167216All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa727Open in IMG/M
3300013307|Ga0157372_12937935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa545Open in IMG/M
3300014200|Ga0181526_10948401All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa541Open in IMG/M
3300016294|Ga0182041_10153600All Organisms → cellular organisms → Bacteria → Terrabacteria group1780Open in IMG/M
3300016357|Ga0182032_11362356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa614Open in IMG/M
3300017970|Ga0187783_10144805All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1751Open in IMG/M
3300017970|Ga0187783_10850034All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300017999|Ga0187767_10242113All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa590Open in IMG/M
3300018021|Ga0187882_1141249All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa987Open in IMG/M
3300018058|Ga0187766_10410367All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa898Open in IMG/M
3300018060|Ga0187765_11268860All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa520Open in IMG/M
3300020075|Ga0206349_1458259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa721Open in IMG/M
3300020580|Ga0210403_10644390All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa853Open in IMG/M
3300020581|Ga0210399_10488012All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1024Open in IMG/M
3300021088|Ga0210404_10291521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria896Open in IMG/M
3300021180|Ga0210396_10445072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1137Open in IMG/M
3300021180|Ga0210396_11674703All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa517Open in IMG/M
3300021402|Ga0210385_10946896All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa661Open in IMG/M
3300021403|Ga0210397_10193141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1450Open in IMG/M
3300021405|Ga0210387_10859761All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa799Open in IMG/M
3300021405|Ga0210387_11416170All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa597Open in IMG/M
3300021407|Ga0210383_11280672All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa613Open in IMG/M
3300021479|Ga0210410_11751378All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa515Open in IMG/M
3300022513|Ga0242667_1018686All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa710Open in IMG/M
3300022523|Ga0242663_1052687All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa721Open in IMG/M
3300022715|Ga0242678_1029172All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa718Open in IMG/M
3300024181|Ga0247693_1068940All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa528Open in IMG/M
3300024331|Ga0247668_1103959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa575Open in IMG/M
3300025320|Ga0209171_10465707All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa633Open in IMG/M
3300025921|Ga0207652_11300417All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa630Open in IMG/M
3300025922|Ga0207646_10915453All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa777Open in IMG/M
3300026121|Ga0207683_10409786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300027109|Ga0208603_1038815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300027165|Ga0208608_112331All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa565Open in IMG/M
3300027297|Ga0208241_1021514All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa966Open in IMG/M
3300027737|Ga0209038_10128494All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa767Open in IMG/M
3300027857|Ga0209166_10570565All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa577Open in IMG/M
3300027874|Ga0209465_10069916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1700Open in IMG/M
3300027875|Ga0209283_10778024All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa591Open in IMG/M
3300027903|Ga0209488_10555098All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa837Open in IMG/M
3300027905|Ga0209415_11067324All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa529Open in IMG/M
3300028884|Ga0307308_10126382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1222Open in IMG/M
3300030531|Ga0210274_1031717All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa741Open in IMG/M
3300030545|Ga0210271_10138160All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa765Open in IMG/M
3300030586|Ga0265393_1071848All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa716Open in IMG/M
3300030706|Ga0310039_10221749All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa737Open in IMG/M
3300030862|Ga0265753_1148954All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa504Open in IMG/M
3300030968|Ga0075376_10999895All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa597Open in IMG/M
3300030969|Ga0075394_12058957All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa682Open in IMG/M
3300031446|Ga0170820_17168211All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa534Open in IMG/M
3300031469|Ga0170819_11318973All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa771Open in IMG/M
3300031543|Ga0318516_10311958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia909Open in IMG/M
3300031544|Ga0318534_10139718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1396Open in IMG/M
3300031544|Ga0318534_10402245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Embleya786Open in IMG/M
3300031549|Ga0318571_10045075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1293Open in IMG/M
3300031640|Ga0318555_10165322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1188Open in IMG/M
3300031640|Ga0318555_10220411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300031640|Ga0318555_10305644All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa861Open in IMG/M
3300031682|Ga0318560_10154509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1215Open in IMG/M
3300031708|Ga0310686_112252531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa766Open in IMG/M
3300031713|Ga0318496_10604698All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa606Open in IMG/M
3300031723|Ga0318493_10170851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. SS1135Open in IMG/M
3300031724|Ga0318500_10043803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1868Open in IMG/M
3300031736|Ga0318501_10052316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1914Open in IMG/M
3300031747|Ga0318502_10055929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2089Open in IMG/M
3300031753|Ga0307477_10435383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa896Open in IMG/M
3300031753|Ga0307477_10451483All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa877Open in IMG/M
3300031768|Ga0318509_10101349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1553Open in IMG/M
3300031769|Ga0318526_10105092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1130Open in IMG/M
3300031770|Ga0318521_10115716All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1493Open in IMG/M
3300031778|Ga0318498_10388522All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa621Open in IMG/M
3300031779|Ga0318566_10045226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2078Open in IMG/M
3300031781|Ga0318547_10933698All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa542Open in IMG/M
3300031782|Ga0318552_10234593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa930Open in IMG/M
3300031792|Ga0318529_10249717All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa825Open in IMG/M
3300031794|Ga0318503_10031228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1562Open in IMG/M
3300031795|Ga0318557_10409003All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa624Open in IMG/M
3300031823|Ga0307478_11373424All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa586Open in IMG/M
3300031845|Ga0318511_10479253Not Available575Open in IMG/M
3300031846|Ga0318512_10161812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. SS1084Open in IMG/M
3300031846|Ga0318512_10651697All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa538Open in IMG/M
3300031879|Ga0306919_11224169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300031890|Ga0306925_10087944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae3296Open in IMG/M
3300031890|Ga0306925_10810004All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa971Open in IMG/M
3300031890|Ga0306925_11150544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa781Open in IMG/M
3300031894|Ga0318522_10117485All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa993Open in IMG/M
3300031910|Ga0306923_10455165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1451Open in IMG/M
3300031939|Ga0308174_10856233All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa766Open in IMG/M
3300031954|Ga0306926_12457317Not Available573Open in IMG/M
3300031954|Ga0306926_12840699Not Available522Open in IMG/M
3300032039|Ga0318559_10129890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1135Open in IMG/M
3300032039|Ga0318559_10580477All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa523Open in IMG/M
3300032044|Ga0318558_10048611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1867Open in IMG/M
3300032055|Ga0318575_10386570All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa710Open in IMG/M
3300032065|Ga0318513_10056680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1765Open in IMG/M
3300032068|Ga0318553_10077212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1674Open in IMG/M
3300032068|Ga0318553_10319707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii812Open in IMG/M
3300032160|Ga0311301_10732678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1379Open in IMG/M
3300032160|Ga0311301_12423388All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa591Open in IMG/M
3300032180|Ga0307471_100141963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2290Open in IMG/M
3300032261|Ga0306920_104324965All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa510Open in IMG/M
3300032805|Ga0335078_10842382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1111Open in IMG/M
3300032829|Ga0335070_10938546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Embleya800Open in IMG/M
3300033290|Ga0318519_10614449All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa661Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.25%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.12%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.50%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.50%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.25%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.25%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.25%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.25%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.25%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.25%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.25%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.62%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.62%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment0.62%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.62%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.62%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.62%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001454Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004401Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004619Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011265Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 K-mer 55EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013059Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022513Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027109Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)EnvironmentalOpen in IMG/M
3300027165Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF035 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030968Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20204J15135_101170223300001454Arctic Peat SoilVSSSSGLARPRPGLAAREVAFLLILAAGAWAATVALARGMAGMTGTMGLGLAAF
JGI25616J43925_1032049513300002917Grasslands SoilVSGLPGAARPRPGVPRREVALLLILAAGAWAATVTIARGMAGMTGTMGLGLTAF
Ga0062387_10167971513300004091Bog Forest SoilMSSSSGVARLRPGLATREAAFLLILAAGAWAATVALARGT
Ga0068980_112922013300004401Peatlands SoilMSNLPGLARPRPGLAAREVSFLLIAAAGAWAATVAIARGMAGMTG
Ga0068953_146253413300004619Peatlands SoilMSNLPGLARPRPGLAAREVSFLLIAAAGAWAATVAIARGMAGMTGTMGLGLAAFV
Ga0058862_1272425913300004803Host-AssociatedMVRVTGSAELARPRPGQPAREAALLLITAAGAWAATVALARGMTG
Ga0070683_10079671023300005329Corn RhizosphereMVRVTGSAELARPRPGQPAREAALLLIAAAGAWAATVALARGMAGM
Ga0070660_10132712213300005339Corn RhizosphereMVRVTGSAELARPRPGQPAREAALLLITAAGAWAASVALARGMTGMTGTMGLGLSVFVPV
Ga0070661_10009894533300005344Corn RhizosphereMVRVTGSAELARPRPGQPAREAALLLITAAGAWAATVALARGMAGMTGTMGLGLSVFVPV
Ga0070692_1030825613300005345Corn, Switchgrass And Miscanthus RhizosphereMVRVTGSAELARPRPGQPAREAALLLIAAAGAWAATVALARGMAGMTGTMGLG
Ga0070714_10041992433300005435Agricultural SoilMVGVNGSAGLARPRPGLGTREAALLLIVAAGAWAATVALARGMAGMTGTMGL
Ga0070713_10149472923300005436Corn, Switchgrass And Miscanthus RhizosphereVSGPPGPGSPGLARLRPGLASREVAFLLIVAAGAWAATIALARGMAGMTGTMGLGLAAFVAIW
Ga0070713_10174813423300005436Corn, Switchgrass And Miscanthus RhizosphereMVGVNGSAGLARPRPGLGTREAALLLIVAAGAWAATVALARGMAGMTGTMGLGL
Ga0070710_1055533213300005437Corn, Switchgrass And Miscanthus RhizosphereMVRVNGPAELARPRPGLGTREAALLLIVAAGAWAATVALARGMAGMTGTMG
Ga0070678_10038185713300005456Miscanthus RhizosphereVSGPPGPGSAGLARLRPGLATREAAFLLIVAAGAWAATIALARGMAGMTGTM
Ga0070707_10158313723300005468Corn, Switchgrass And Miscanthus RhizosphereMTGTRGVARPQQAPATREVALILVAAAGGWAATVALARGMAGMTG
Ga0070697_10186377123300005536Corn, Switchgrass And Miscanthus RhizosphereVSGPPGPGSPGLARLRPGLATREAAFLLIVAAGAWAATIALARGMAGMTGTMGLGL
Ga0066697_1043133513300005540SoilVSGSSGLARPRPGLATREVAFLLIVAAGAWAATIALVRGMAGMTGTMGLGLAAF
Ga0066670_1103310013300005560SoilVSGPPGPGSAGLARLRPGLATREVAFLLIVAAGAWAATIVLAQSMAGMTG
Ga0066705_1076297823300005569SoilVSGSPGPGSPGLARLRPGLATREVAFLLIVAAGAWAATIVLAQSMAGMTG
Ga0068864_10272778923300005618Switchgrass RhizosphereVSGPPGPGSPGLARLRPGLATREAAFLLIVAAGAWAATIALARGMAGM
Ga0075029_10125500513300006052WatershedsMVRVNGSAELARPRPGLGTREAALLLIVAAAAWAATVALARGMTGMTGTMGLG
Ga0075015_10096634923300006102WatershedsVNSSAPLARPGVGRWEGALVLIAAAGAWAATVTVARGMTGMTGTMGL
Ga0075018_1026045623300006172WatershedsVNGSRGLARTRTSLGAREAVVLLILAAGAWAATVALA
Ga0070765_10174768813300006176SoilVNGSAQLARPGLARLPIALLLIAAAGAWVATIAIARGMAGMTGTMGLG
Ga0079222_1025610413300006755Agricultural SoilVSGPPGPGSPGLARLRPGLPSREVAFLLIAAAGAWAATIALARGMAGMTGTMGLG
Ga0066659_1019369113300006797SoilVSGSPGLARPRPGLAAREVAFLLIVGAGAWAATIALARGMA
Ga0075434_10192208913300006871Populus RhizosphereVSGPPGPGSPGLARLRPGLATREAAFLLIVAAGAWAATIALARGMAGMTGTMGLGLAAF
Ga0099829_1097018523300009038Vadose Zone SoilMVRVNSSAELARPRPGLATREAALLLIAAAGAWAGTVALARGMTGMTGTMGLGL
Ga0099792_1066699823300009143Vadose Zone SoilVSSSGLARPRPGLAIREVAFLLILAAGAWAATVALARGMAGMAGTMGAGPGRV
Ga0105237_1121482713300009545Corn RhizosphereVSSPPGPGSAGLARLRPGLATREAAFLLIVAAGAWAATIALARGMAG
Ga0105238_1222948013300009551Corn RhizosphereMVRVTGSAELARPRPGQPAREAALLLITAAGAWAATVALARGMTGMTGTNTLSPSPIVPVIP
Ga0116217_1077952113300009700Peatlands SoilVNGSGQLARPSLARREAALLLIAAAGAWVATFALARGMAGMTGTMGLG
Ga0116217_1081911723300009700Peatlands SoilVSGSSGLARPRPGLATREVAFLLILAAGAWAATVALARGMAGMAGTMGLGLA
Ga0134064_1008895423300010325Grasslands SoilVSGSSGLARPRPSLATREVAFLLIVAAGAWAATVALARGMTGMAGTMGLGLALF
Ga0126370_1047681713300010358Tropical Forest SoilVSGSSGLARPRPALAATREVAVLLILAAGAWVATIALAHGMAGMTGTMGLGLALFVP
Ga0126376_1068505413300010359Tropical Forest SoilVTGSPGPASSGLTRPRPGLATREVAFLLVVAAGAWAATIALARGMAGMTGTMGLGLAAF
Ga0126377_1059290113300010362Tropical Forest SoilVSGSPGPASSGLTRPRPGLATREVAFLLIVAAGAWAATIALARGMAGMTGPGGMGLAAFVRLWTMTMADMML
Ga0126379_1122954423300010366Tropical Forest SoilVSGSPGPGSPGLASPRPGLAAREVAFLLIVAAGAWAATIVLAQGMAGMTGT
Ga0126379_1308173913300010366Tropical Forest SoilVSGSSGLARPRPALAATREVAVLLILAAGAWVATIALAHGMAGMTGTMGLGL
Ga0136449_10358567813300010379Peatlands SoilMVRVNGSAELARPRPGLGTPEAALLLIVAAGAWAATVALARGMAGMTGTMGLGLAV
Ga0134126_1225774913300010396Terrestrial SoilMVRVTGSAEPTRLRPRLATREAALLLIAAAGAWVVVVMLAR
Ga0126352_120239613300010859Boreal Forest SoilMVRVSGSAELARPRPGLATREVVLLLIAAAGAWAG
Ga0126352_124878713300010859Boreal Forest SoilMVRVNGSAELARPRPGLGSREAALLLIAAAGAWVATVALARGMTGMTGTMGLGLAVFV
Ga0126350_1098034413300010880Boreal Forest SoilVSSSSGLARLRPGLATREAAFLLILAGCAWAATVALARGMAGM
Ga0126350_1185737363300010880Boreal Forest SoilMVRVSGSAELARPRPGLATREVALLLIAAAGAWAGTVTLARGMTGMSGTMGLEL
Ga0151613_100576313300011265SedimentMVRVTGSARLARPWPGAASREAALLLIAAAGAWAATVAL
Ga0137391_1066933323300011270Vadose Zone SoilVVRVTGSAPLVRPGLGRRDAALLLIAAAGAWAATVALARGMAGMTGTMGLGLV
Ga0137393_1034928613300011271Vadose Zone SoilVNTAAPLAPPGLARREAAFLLIAAAGAWAATVALAR
Ga0137388_1123149813300012189Vadose Zone SoilMVRVNSSAELARPRPGLATREAALLLIAGAGAWAGTVALARGMT
Ga0137382_1035369333300012200Vadose Zone SoilVSGPPGPGSPGLARLRPGLATREAAFLLIVAASAWAATIALARG
Ga0137380_1156470313300012206Vadose Zone SoilVVRVTGSAPLARPGLGRRDAALLLITAAGAWAATVALARGMAGMTGTM
Ga0137376_1144994013300012208Vadose Zone SoilVSGSSGLARPRPGLATREVAFLLIVAAGAWAATIALARGMAGMTGTMGLGLAAFVA
Ga0137385_1091130713300012359Vadose Zone SoilVSSSPGLAGPRPGLAAREVAFLLILAAGAWAATVTLARGMAGMTGTLGLGLALFVPMWALMM
Ga0137407_1006321813300012930Vadose Zone SoilVTSSSGLARLRPGLATREVAFLLILAAGAWAATVA
Ga0154012_16721613300013059Corn, Switchgrass And Miscanthus RhizosphereMVRVTGSAELARPRPGQPAREAALLLITAAGAWAATVALARGMT
Ga0157372_1293793513300013307Corn RhizosphereVSSSSGLARPRPGLATREAAFLLILAAGAWAATVALARGM
Ga0181526_1094840113300014200BogVNGSAQLAARSPARREAALLLIAAAGAWVATFALARGMAG
Ga0182041_1015360013300016294SoilVSGSAGLARQRPGLATREAAFLLILAAGAWAATIALARGMAGM
Ga0182032_1136235613300016357SoilVNGPAELAPSRPALATREAGLVLIVAAAAWAGTVLLARGMAGMTGTMGL
Ga0187783_1014480513300017970Tropical PeatlandMTDSARLAPPRPGLATREAAFVLILAAGAWAVTIAVARGMAGM
Ga0187783_1085003423300017970Tropical PeatlandVSSSAELATARPQIATRDVVLVLIAAAAAWVATVMLARGMSGMTG
Ga0187767_1024211313300017999Tropical PeatlandMSSSSGLAGPRPGLAATREVAFLLILAAGAWVATIALARGMAGMTGTMGLGLAL
Ga0187882_114124923300018021PeatlandVSSSSGLARPRPGLAAREVAFLLILAAGAWAATVALARGMAGMTGTMGLGL
Ga0187766_1041036713300018058Tropical PeatlandVNGSAGLAGPRPGLAAREAAALLILAAGAWAATVTIARGMSGMTGTMGLGL
Ga0187765_1126886023300018060Tropical PeatlandVSGSPGPGSPGLARPRPGLAGREVAFLLIAAAGAWAATIALARGMAGMTGTMGLGLAAFV
Ga0206349_145825923300020075Corn, Switchgrass And Miscanthus RhizosphereMVGVTGSAEPTRLRPGLATREAALLLIAAAAAWAVTVMLTRGMAGMTG
Ga0210403_1064439023300020580SoilMVRLNGSAELARARPGLATREASLLLIAAAGAWAATVVLARGMAGMAGTMGLGL
Ga0210399_1048801213300020581SoilMVRLNGSAELAPLRPGLATREASLLLIAAAGAWAATVVLARGMAGMAG
Ga0210404_1029152113300021088SoilMNGSAELARPRPGLGTREAALLLSVAAGAWAATIALARGMAGMTGTMGLGLAVFVPGWTL
Ga0210396_1044507213300021180SoilMNGSAELARPRPGLGTREAALLLSVAAGAWAATIALARGMAGMTGTMGLGLAAFVPGWT
Ga0210396_1167470313300021180SoilVTSSSGLARLRPGLATREVAFLLILAAGAWAATVAL
Ga0210385_1094689623300021402SoilVNSSAPLARPGVGRWEGALVLIAAAGAWAATVAVARGMAGMTGTMGLGLVAFVPV
Ga0210397_1019314133300021403SoilMVRLNGSAELTRARPGLATREAGLLLVAAAGAWAATVVLARGMAGMAGTMGL
Ga0210387_1085976123300021405SoilMVRVNGSAELARPRPGLGTREAALLLSVAAGAWAATIALARGMAG
Ga0210387_1141617013300021405SoilMVRVNGSAELARPRPRLATREAALLLIAAAAAWAGTVTLARGMTGMSGTMGLELAV
Ga0210383_1128067223300021407SoilMVRVNGSAELARPRPGPGTREAALLLSVAAGAWAATIALARGMAGMTGTMGLGLAV
Ga0210410_1175137813300021479SoilVTGSRGLARPRPGLATREAAFLLILAAGAWAATLALARGM
Ga0242667_101868623300022513SoilMVRVNGSAELARPRPGLATREAALLLIAAAGAWAGTVT
Ga0242663_105268713300022523SoilMSSPRELVRPWRERATPEAAFLLILAAAAWAATLALARGMAGMTGTMGL
Ga0242678_102917213300022715SoilMTSSSGLARLRPGLATREVAFLLILAAGAWAATVALARGMAGMAGTMG
Ga0247693_106894023300024181SoilVSGPPGPGSPGLARLRPGLASREVAFLLIVAAGAWAATIALARGMAGMTGTMGLGLAAFV
Ga0247668_110395913300024331SoilVTSSAELTRPRPGLPTREAALLLIAAAGAWAATVALARGMSGMTGTM
Ga0209171_1046570723300025320Iron-Sulfur Acid SpringVSGSSGFARPRPGLATREVAFLLILAAGAWAATLALARGMAGMTGTMGLDLALFVPTWTL
Ga0207652_1130041723300025921Corn RhizosphereVSSSSGLARPRPGLATREAAFLLILAAGAWAATVALARGMAGMTGTMGL
Ga0207646_1091545313300025922Corn, Switchgrass And Miscanthus RhizosphereVSGSPGFARPRPGLPTREVALLLILAVGAWAATVTIARGMTGMTGTMGLGL
Ga0207683_1040978613300026121Miscanthus RhizosphereVSGPPGPGSAGLARLRPGLATREAAFLLIVAAGAWAATIALARGMAGMTGTMGLGLAAFVAI
Ga0208603_103881513300027109Forest SoilMVRVSGSAELARPRPGLATREAALLLIAAAGAWAGTVTLARGMTGMSGTMGLELAVF
Ga0208608_11233113300027165Forest SoilMVRVNGSAELARPRPGLANREAALLLIAAAGAWAGTVTLARGM
Ga0208241_102151433300027297Forest SoilMVGVNGSAELARPRPGLGTRQAALLLIVAAGAWAATVALARGM
Ga0209038_1012849423300027737Bog Forest SoilMVRVNGSAELARARPRLATREAALLLIAAAAAWAGTVTLARGM
Ga0209166_1057056523300027857Surface SoilMVGVNGSAGLARPRPGLGTREAALLLIVAAGAWAATVALARGMAGMTGTM
Ga0209465_1006991643300027874Tropical Forest SoilVSGSSGLARPRPALAATREVAVLLILAAGAWVATIAL
Ga0209283_1077802413300027875Vadose Zone SoilVSGPQGLARPRPGLPTREVALLLVLAAGAWAATVTLARGMTGMTGTM
Ga0209488_1055509823300027903Vadose Zone SoilVSSSGLARPRPGLAIREVAFLLILAAGAWAATVALARGMAGMAGTMGLGLAA
Ga0209415_1106732413300027905Peatlands SoilVQLARPSLARRETALLLIAAAGAWVATFALARGMAGMT
Ga0307308_1012638213300028884SoilVSGPPGPGSPGLARLRPGLASREAAFLLIVAAGAWAATIALARGMAGMTGTMGLGLA
Ga0210274_103171723300030531SoilVNSSAPLARPGVGRWEGALVLIAAAGAWAATVAVARGMTGMTGTMGL
Ga0210271_1013816013300030545SoilMVRVSGPAELARPRPGLATREAALLLIAAAAAWAGTVTLARGMTGMSGTMGLE
Ga0265393_107184823300030586SoilMVRVNGSADLARPRPGLASGEAALLLIAAAGAWAGTVTLARGMTGMR
Ga0310039_1022174923300030706Peatlands SoilVTGSAQLARPALARREAALLLIAAAGAWAATVAIVRGMAGMTGT
Ga0265753_114895413300030862SoilMVRVSGSAELARPRPGLATREAALLLIAAAGAWAGTVTLAR
Ga0075376_1099989513300030968SoilVTSSSGLARLRPGLATREVAFLLILAAGAWAATVALARGMAG
Ga0075394_1205895713300030969SoilVTSSPGLARLRPGLATREVAFLLILAAGAWAATVALARGMAGMAGTM
Ga0170820_1716821113300031446Forest SoilVTSAREVARQRPGLATAEVALLLILAAGAWAATIVIA
Ga0170819_1131897323300031469Forest SoilMSDYSQGVGPRLSLPGRDVAVLLILAAGAWAAIVAIARGMAGMAGTMGLGLA
Ga0318516_1031195823300031543SoilVNGAAPLPGLARREIAFLLIVAAGAWAGTVALARGMAGMTGTMGLGSSGRPGSPGW
Ga0318534_1013971833300031544SoilMVQVSEPGQLAPPGVARRETALLLITAAGAWAATIAVARGMAGMTGTMGLGLLVFVPMWTLM
Ga0318534_1040224533300031544SoilVNGAARLPGLARREIAFLLIAAAGAWAGTVALARGMAGMTGTMGL
Ga0318571_1004507533300031549SoilVSGSPGLARPRPGLATREVAFLLIAAAGAWAATIVVAQEMAGMTGTMGLGPA
Ga0318555_1016532233300031640SoilVSGSPGLARPRPGLATREVAFLLIAAAGAWAATIVVAQEMAGMTGTMGLGPAAFVAVW
Ga0318555_1022041133300031640SoilMSGPAGLTGPRPGLAAREAAVLLILAAGAWAATVTIARGM
Ga0318555_1030564423300031640SoilMSDSAELRRPRPGQATLEVALVLIAAAGAWAGTVVLARGMTG
Ga0318560_1015450933300031682SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTGTMGLGLAVFV
Ga0310686_11225253123300031708SoilVSGAPGLARPRPGLATREVAFLLILAAGAWVATIALARGMAGMTGTM
Ga0318496_1060469823300031713SoilMSGPAGLTGPRPGLAAREAAVLLILAAGAWAATVTIARGMSGMTGT
Ga0318493_1017085133300031723SoilVNGAARLPGLARREIAFLLIAAAGAWAGTVALARGMAGMTGTMGLGLVA
Ga0318500_1004380343300031724SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTCTMGLGLAVFVPIWTL
Ga0318501_1005231613300031736SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLAPGMAGMTGTMGLGLAVFVPI
Ga0318502_1005592953300031747SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTGTMGLGLAGFVPIWT
Ga0307477_1043538313300031753Hardwood Forest SoilVTGTPGLARPRPAPATREVALILVLAAGGWAATVALARGM
Ga0307477_1045148333300031753Hardwood Forest SoilVNGPAELARPRPGLATREAALLLIAAAGAWAGTVTLARGMTGMSGTMGLALA
Ga0318509_1010134933300031768SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTGTMGLGLA
Ga0318526_1010509233300031769SoilMAQARAGFVTREAGLVLIVAAGAWAATVVLARGMAGMTGTMGLGLAVFV
Ga0318521_1011571643300031770SoilMSGSAGLARPRPGLAAREVAVLLVLAAGAWAATVTIARGMSGMTGT
Ga0318498_1038852213300031778SoilMSDSAELRRPRPGQATLEVALVLIAAAGAWAGTVVLA
Ga0318566_1004522653300031779SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTGTMGLGLAGFV
Ga0318547_1093369823300031781SoilVSGSTGLARQRPGLATREAAFLLILSAGAWAATMALARGMAGMAAT
Ga0318552_1023459313300031782SoilMNGSAGLAGPRPGLAAREVAVLLILAAGAWAATVTIARGMSGMTGTMGLGLAAF
Ga0318529_1024971723300031792SoilVSGPSGLAGPRPGLAATREVAFLLILAAGAWVATIALARG
Ga0318503_1003122813300031794SoilVSGPSGLAGRRPGLAATREVAFLLILAAGAWVATIALARGMAGMTGTMGLGLAL
Ga0318557_1040900323300031795SoilVNGPSGLARPRPGLAATREVAFLLILAAGAWVATIALARGMAGMTGTMGLGLALF
Ga0307478_1137342423300031823Hardwood Forest SoilMVGVNGPAELARPRPGLATREAALLLIAAAGAWAGTVTLARGMTGMSGTMGLELAVF
Ga0318511_1047925313300031845SoilVSSSPGLARPRPGLATREVAFLLIAAAGAWTATIVLAQEMAGMTGTMGLGLATFV
Ga0318512_1016181233300031846SoilVNGAARLPGLARREIAFLLIAAAGAWAGTVALARGMAGMTGTM
Ga0318512_1065169723300031846SoilVNGPSGLARPRPGLAATREVAFLLILAAGAWVATIALARGMAGMTGTMGLGLA
Ga0318527_1000168253300031859SoilMAQARAGFVTREAGLVLIAAAGAWAATVVLARAMAGMTGTMGLGL
Ga0306919_1122416913300031879SoilVNGAARLPGLARREIAFLLIAAAGAWAGTVALARGMAGMT
Ga0306925_1008794463300031890SoilVSGSAGLAGPRPGLAAREVAVLLVLAAGAWAATVTVARGMSGMTGT
Ga0306925_1081000423300031890SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTGTMGLGLAVFVPIWT
Ga0306925_1115054413300031890SoilMVQVSEPGQLAPPGVARRETALLLITAAGAWAATIAVARGMAGMTG
Ga0318522_1011748523300031894SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTGTMGLGLAA
Ga0306923_1045516533300031910SoilVSGPSGLAGPRPGLAATREVAFLLILAAGAWVATIALARGMAGMTGTMGL
Ga0308174_1085623323300031939SoilVTSPAELTRPRPGRPAREAALLLIAAAGAWAATVALARGMSGMTGTMGLGL
Ga0306926_1245731723300031954SoilMVVRSRGKDHVMVRFSGPAGLARPRPEQATAEAGLLLLVAAGAWAGTVLLARGMAGMTGTMGLGLAA
Ga0306926_1284069923300031954SoilVNGAARLPGLARREIAFLLIAAAGAWAGTVALARGMAGMTGTMGLGLVAFVPV
Ga0318559_1012989033300032039SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTGTNTA
Ga0318559_1058047723300032039SoilVSGSAGLAGPRPGLAAREVAVLLVLAAGAWAATVTVARG
Ga0318558_1004861113300032044SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTGTM
Ga0318575_1038657023300032055SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTGTMGLGL
Ga0318513_1005668043300032065SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLARGMAGMTG
Ga0318553_1007721213300032068SoilVSSSGGLARPRSGPAAREVAVLLILAAAAWAATLVLA
Ga0318553_1031970713300032068SoilVNGAARLPGLARREIAFLLIAAAGAWAGTVALARGMAGMTGTMG
Ga0311301_1073267813300032160Peatlands SoilMTGSAELARPRPGLATREAALLLIAAAGAWAGTVTLARGMTGM
Ga0311301_1242338823300032160Peatlands SoilVTSSQGLARPRPGLATREVAFLLILAAGAWAATLVLARGMAGM
Ga0307471_10014196343300032180Hardwood Forest SoilVSGPPGPGSPGLARLRPGLATREAAFLLIVAAGAWAATIALARG
Ga0306920_10432496523300032261SoilMNGSAGLAGPRPGLAAREVAVLLILAAGAWAATVTIAR
Ga0335078_1084238223300032805SoilVTGSAEITRPQPGQAAVEAGPLLLVAAGAWAGTVLLARGMAGITGTMGLGLAAFVPVW
Ga0335070_1093854613300032829SoilMAQVSETGPLAPPAVARRETALLLFAAAGAWAATVAVARGMAGMT
Ga0318519_1061444913300033290SoilMVQVSEPGQLAPPGVARRETALLLITAAGAWAATIAVARGMAGMTGTMGLG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.