NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040826

Metagenome / Metatranscriptome Family F040826

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040826
Family Type Metagenome / Metatranscriptome
Number of Sequences 161
Average Sequence Length 114 residues
Representative Sequence RGAAVVQSGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVYLANYALRAEFTSRSGAGFLNLLTTGTYLVCVSIWSGYLLAPEPEPASLAVVPHDEVETWNTELQHLLRD
Number of Associated Samples 135
Number of Associated Scaffolds 161

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.71 %
% of genes near scaffold ends (potentially truncated) 83.85 %
% of genes from short scaffolds (< 2000 bps) 81.99 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.547 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(19.255 % of family members)
Environment Ontology (ENVO) Unclassified
(47.205 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.584 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 65.00%    β-sheet: 0.00%    Coil/Unstructured: 35.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 161 Family Scaffolds
PF02700PurS 13.66
PF13522GATase_6 2.48
PF13565HTH_32 0.62
PF01343Peptidase_S49 0.62
PF07238PilZ 0.62
PF01058Oxidored_q6 0.62
PF00174Oxidored_molyb 0.62
PF00310GATase_2 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 161 Family Scaffolds
COG1828Phosphoribosylformylglycinamidine (FGAM) synthase, PurS subunitNucleotide transport and metabolism [F] 13.66
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.24
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 0.62
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 0.62
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 0.62
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.62
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 0.62
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.55 %
UnclassifiedrootN/A7.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10054122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2122Open in IMG/M
3300001545|JGI12630J15595_10059548All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7757Open in IMG/M
3300001593|JGI12635J15846_10106864All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1998Open in IMG/M
3300002245|JGIcombinedJ26739_100458421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71152Open in IMG/M
3300002245|JGIcombinedJ26739_100553179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71028Open in IMG/M
3300003370|JGI26337J50220_1027695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7648Open in IMG/M
3300004082|Ga0062384_100618648All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7736Open in IMG/M
3300004091|Ga0062387_100490594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7854Open in IMG/M
3300004092|Ga0062389_100128531All Organisms → cellular organisms → Bacteria2328Open in IMG/M
3300004092|Ga0062389_100403153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71487Open in IMG/M
3300004092|Ga0062389_100438348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1438Open in IMG/M
3300004606|Ga0068962_1248926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7627Open in IMG/M
3300004635|Ga0062388_102615113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7530Open in IMG/M
3300005445|Ga0070708_100467531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71190Open in IMG/M
3300005591|Ga0070761_10037794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2704Open in IMG/M
3300005938|Ga0066795_10088628All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7919Open in IMG/M
3300005994|Ga0066789_10415709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7562Open in IMG/M
3300006055|Ga0097691_1013530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3858Open in IMG/M
3300006059|Ga0075017_100194805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71463Open in IMG/M
3300006059|Ga0075017_101279106All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300006172|Ga0075018_10581780All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7593Open in IMG/M
3300006642|Ga0075521_10305684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7766Open in IMG/M
3300009521|Ga0116222_1482819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7542Open in IMG/M
3300009524|Ga0116225_1105828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71303Open in IMG/M
3300009617|Ga0116123_1021719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72040Open in IMG/M
3300009630|Ga0116114_1054935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71115Open in IMG/M
3300009636|Ga0116112_1215648All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7532Open in IMG/M
3300009646|Ga0116132_1104626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7870Open in IMG/M
3300009760|Ga0116131_1199470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7559Open in IMG/M
3300009760|Ga0116131_1235552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7502Open in IMG/M
3300009839|Ga0116223_10176113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71318Open in IMG/M
3300009839|Ga0116223_10189348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71262Open in IMG/M
3300010339|Ga0074046_10116002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71721Open in IMG/M
3300010379|Ga0136449_101310955All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71128Open in IMG/M
3300010379|Ga0136449_104013739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7549Open in IMG/M
3300011079|Ga0138569_1114172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7683Open in IMG/M
3300011269|Ga0137392_10354320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71216Open in IMG/M
3300011270|Ga0137391_11349514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7560Open in IMG/M
3300012203|Ga0137399_11239033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7628Open in IMG/M
3300012363|Ga0137390_10322435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71526Open in IMG/M
3300012927|Ga0137416_10229252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71507Open in IMG/M
3300012927|Ga0137416_11830144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7555Open in IMG/M
3300012927|Ga0137416_12035240All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7527Open in IMG/M
3300014151|Ga0181539_1095706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71261Open in IMG/M
3300014153|Ga0181527_1174989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7916Open in IMG/M
3300014153|Ga0181527_1289894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7648Open in IMG/M
3300014155|Ga0181524_10357784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7648Open in IMG/M
3300014165|Ga0181523_10130604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71490Open in IMG/M
3300014200|Ga0181526_10217530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71221Open in IMG/M
3300014491|Ga0182014_10138722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71391Open in IMG/M
3300014495|Ga0182015_10096303All Organisms → cellular organisms → Bacteria → Acidobacteria2059Open in IMG/M
3300014498|Ga0182019_10010515All Organisms → cellular organisms → Bacteria → Acidobacteria4871Open in IMG/M
3300014498|Ga0182019_10920304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7631Open in IMG/M
3300014498|Ga0182019_11295484All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7538Open in IMG/M
3300014657|Ga0181522_11057845All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7504Open in IMG/M
3300014838|Ga0182030_10438719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71337Open in IMG/M
3300014838|Ga0182030_11331976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7603Open in IMG/M
3300017823|Ga0187818_10044869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71898Open in IMG/M
3300017929|Ga0187849_1131976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71024Open in IMG/M
3300017932|Ga0187814_10422621All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7521Open in IMG/M
3300017934|Ga0187803_10243028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7713Open in IMG/M
3300017935|Ga0187848_10177774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7924Open in IMG/M
3300017935|Ga0187848_10254469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7740Open in IMG/M
3300017940|Ga0187853_10026850All Organisms → cellular organisms → Bacteria → Acidobacteria3118Open in IMG/M
3300017940|Ga0187853_10536536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7508Open in IMG/M
3300017941|Ga0187850_10062051All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71890Open in IMG/M
3300017946|Ga0187879_10451788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7712Open in IMG/M
3300017955|Ga0187817_10576640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7718Open in IMG/M
3300017996|Ga0187891_1191086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7703Open in IMG/M
3300017996|Ga0187891_1208277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7664Open in IMG/M
3300017998|Ga0187870_1151361All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7848Open in IMG/M
3300018003|Ga0187876_1252419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7574Open in IMG/M
3300018018|Ga0187886_1153522All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7913Open in IMG/M
3300018019|Ga0187874_10107142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71212Open in IMG/M
3300018020|Ga0187861_10405574All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7571Open in IMG/M
3300018025|Ga0187885_10004423All Organisms → cellular organisms → Bacteria11544Open in IMG/M
3300018030|Ga0187869_10399596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7655Open in IMG/M
3300018035|Ga0187875_10574842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7595Open in IMG/M
3300018037|Ga0187883_10760881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7506Open in IMG/M
3300018038|Ga0187855_10915233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7512Open in IMG/M
3300018040|Ga0187862_10045872All Organisms → cellular organisms → Bacteria → Acidobacteria3203Open in IMG/M
3300018040|Ga0187862_10360311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7902Open in IMG/M
3300018042|Ga0187871_10645019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7588Open in IMG/M
3300018043|Ga0187887_10601588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7649Open in IMG/M
3300018047|Ga0187859_10420641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7736Open in IMG/M
3300018057|Ga0187858_10412390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7838Open in IMG/M
3300018090|Ga0187770_10878812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7719Open in IMG/M
3300018090|Ga0187770_10971344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7683Open in IMG/M
3300019082|Ga0187852_1038059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72291Open in IMG/M
3300019082|Ga0187852_1334026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7599Open in IMG/M
3300019787|Ga0182031_1132738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7696Open in IMG/M
3300020581|Ga0210399_10607376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7904Open in IMG/M
3300021168|Ga0210406_10640238All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7825Open in IMG/M
3300021171|Ga0210405_10777817All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7735Open in IMG/M
3300021474|Ga0210390_11519304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7529Open in IMG/M
3300021478|Ga0210402_11226225All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7677Open in IMG/M
3300022881|Ga0224545_1014979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71145Open in IMG/M
3300023068|Ga0224554_1063661All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7920Open in IMG/M
3300025406|Ga0208035_1019457All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71097Open in IMG/M
3300025412|Ga0208194_1001168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5497Open in IMG/M
3300025419|Ga0208036_1071133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7558Open in IMG/M
3300025442|Ga0208034_1036626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71123Open in IMG/M
3300025444|Ga0208189_1046086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7837Open in IMG/M
3300025454|Ga0208039_1023006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71287Open in IMG/M
3300025527|Ga0208714_1043307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71001Open in IMG/M
3300025612|Ga0208691_1102274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7645Open in IMG/M
3300025922|Ga0207646_10312223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71420Open in IMG/M
3300026277|Ga0209350_1081716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7865Open in IMG/M
3300026322|Ga0209687_1257685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7542Open in IMG/M
3300026498|Ga0257156_1100407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7602Open in IMG/M
3300026514|Ga0257168_1067813All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7787Open in IMG/M
3300026880|Ga0209623_1013594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7557Open in IMG/M
3300027158|Ga0208725_1019778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71093Open in IMG/M
3300027546|Ga0208984_1036124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71039Open in IMG/M
3300027587|Ga0209220_1170345All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7559Open in IMG/M
3300027605|Ga0209329_1055168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7850Open in IMG/M
3300027645|Ga0209117_1024691All Organisms → cellular organisms → Bacteria → Acidobacteria1915Open in IMG/M
3300027662|Ga0208565_1109922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7825Open in IMG/M
3300027676|Ga0209333_1112452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7739Open in IMG/M
3300027696|Ga0208696_1244655All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7558Open in IMG/M
3300027767|Ga0209655_10018041All Organisms → cellular organisms → Bacteria → Acidobacteria2374Open in IMG/M
3300027768|Ga0209772_10164012All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7699Open in IMG/M
3300027854|Ga0209517_10041240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3639Open in IMG/M
3300027905|Ga0209415_11128963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7507Open in IMG/M
3300027908|Ga0209006_10718569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7816Open in IMG/M
3300028536|Ga0137415_11262930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7555Open in IMG/M
3300028552|Ga0302149_1003884All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4196Open in IMG/M
3300028745|Ga0302267_10269363All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7731Open in IMG/M
3300028798|Ga0302222_10362612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7565Open in IMG/M
3300029636|Ga0222749_10798115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7516Open in IMG/M
3300029903|Ga0247271_120752All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7761Open in IMG/M
3300029910|Ga0311369_10529962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7996Open in IMG/M
3300029943|Ga0311340_10031264All Organisms → cellular organisms → Bacteria6531Open in IMG/M
3300029943|Ga0311340_10812984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7787Open in IMG/M
3300029944|Ga0311352_10466558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71025Open in IMG/M
3300030007|Ga0311338_10086986All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73945Open in IMG/M
3300030007|Ga0311338_10346197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71619Open in IMG/M
3300030399|Ga0311353_11385251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7573Open in IMG/M
3300030494|Ga0310037_10187209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7924Open in IMG/M
3300030706|Ga0310039_10167329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7881Open in IMG/M
3300030737|Ga0302310_10377044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7781Open in IMG/M
3300030740|Ga0265460_12721391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7530Open in IMG/M
3300030991|Ga0073994_12009380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7522Open in IMG/M
3300031231|Ga0170824_123858101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7524Open in IMG/M
3300031247|Ga0265340_10262221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7769Open in IMG/M
3300031718|Ga0307474_11397093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7552Open in IMG/M
3300031962|Ga0307479_11059173All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7778Open in IMG/M
3300031962|Ga0307479_11664199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7592Open in IMG/M
3300032160|Ga0311301_10962714All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71136Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland19.25%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil10.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland9.32%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.21%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.59%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.59%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.35%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.48%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.48%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.86%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.86%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.24%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.24%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.24%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.62%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.62%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003370Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004606Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011079Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026880Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1005412253300000567Peatlands SoilSVVNRGVALVQCGLLLSLLVFSRFLGLSWRRSAFGIALGLGVLTSVDLAYSALRAEFTSAAAAEYLNLLRTGTYLACVSIWIGYLLAPEPESASPTVVADDEVETWNTELQRLLRQ*
JGI12630J15595_1005954813300001545Forest SoilYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELASPTVVAHDEVETWNREFQQFLKQ*
JGI12635J15846_1010686453300001593Forest SoilYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPEVELASPTDVPHDEVETWNRELQQLLKE*
JGIcombinedJ26739_10045842113300002245Forest SoilTGLLIIVGVLIAVFATGDSGARWTAGTFVVNRGAAMVQCGLLLTLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAYSALRAEFTGRVSAQLLNLVVTATYLVCVLIWIGYSLSPEAEPVTSLAILPHDEVETWNMELQHLLRD*
JGIcombinedJ26739_10055317933300002245Forest SoilIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELEVASPTVVAHDEVETWNRELQQFLKQ*
JGI26337J50220_102769523300003370Bog Forest SoilMVQCGSLLSLLLFSRFLGLSWRRAAFGIALGLGILTSVDLAAYAVRAEFTSGAGAAFLNLLTKGTYLVCVSIWIGYSLTPELESASSTIVPHDEVETWNREFQHLLKP*
Ga0062384_10061864813300004082Bog Forest SoilIAVLLAVYAPGDVGIVLVAGSIVSRGAAMVQCGLLLSLLLFSRFLGLSWRRPTFGIALGLGVVSSVDLATYALRAEFSSATWVPYLNLGIAGTYLVCVSIWIGYLLAPELEPASLTVVSRDEVETWNAELQHLERQ*
Ga0062387_10049059423300004091Bog Forest SoilAAIVQCGLLLSLLLFSHLMGLSWRRPAFGIALGLGILTSVDLATSALRAEFTTEAMREYLNLLLTGASFICVSLWLRYLVAPEPKSAPAIIVPHNEVEIWNRELQHFLKQ*
Ga0062389_10012853153300004092Bog Forest SoilMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGALTSIDLATFALRAEFTSELSVKLLNLLITGTDLACVLIWIGYLLAGELETVSPTIVPHDEVESWNRELQHLLKQ*
Ga0062389_10040315313300004092Bog Forest SoilYAPGNNSAKWHAGIFVINRGAAIVQCGLLLSLLLFSHLMGLSWRRPAFGIALGLGILTSVDLATSALRAEFTTEAMREYLNLLLTGASFICVSLWLRYLVAPEPKSAPAIIVPHNEVEIWNRELQHFLKQ*
Ga0062389_10043834833300004092Bog Forest SoilVMGVLLAVYAPGGNSVKWFAGVLVVNRGAAMVQCGSLLSLLLFSRFLGLSWRRAAFGIALGLGILTSVDLAAYAVRAEFTSGAGAAFLNLLTKGTYLVCVSIWIGYSLTPELESASSTIVPHDEVETWNREFQHLLKP*
Ga0068962_124892613300004606Peatlands SoilWRRPAFGITLGLGVLTSVNLAIYALRAEFTNRVGAAFLNFLATGTYLVCVSIWIGYLLAPEPQPASLAVVPHDEVETWNTELQHLLRD*
Ga0062388_10261511313300004635Bog Forest SoilWHAGVFAVNRGAAMVQCGLLLASLLLSRFLGLTWRRPAFGIALGLGILTTVNLATSALRAELTTNAARDFLNLLTTGTYLVCVSLWLRYLLAPETEPASPMIVSHNEVEIWNQELQHFLKQ*
Ga0070708_10046753113300005445Corn, Switchgrass And Miscanthus RhizosphereVYAPGDNSVRWIAGVSVVNRGAAMVQCGLLLSLLLFSRFLGVSWRGAAFGITLGLGVLASVDLAAYALRAEFTSKVGEEFLNLLIPGTYLVCVLIWIRFLLAPELQPASPPVVPHDEVETWNTELRRLLKD*
Ga0070699_10024041513300005518Corn, Switchgrass And Miscanthus RhizosphereAFGIALGFGVLTSVDLAFSALRAEFASDVAREFLNLLITGTYLVCVLIWIGYSLAPELELASPKDVPPDEVGTWNRELQQLLKQ*
Ga0070761_1003779413300005591SoilGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGITLGLGILTSVDLAVYAVRAGFAPGVGAEFLNFLTTGTYLVCVLIWIGYLLAPELQPVSLTAVSRDEVETWNTELQHLLRD*
Ga0066795_1008862823300005938SoilAVYAPGNNSVRWHAGVSVVNRGAVMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLATSAIRVEFTSDVTREFLNLLITVASLVCVSIWIGYLWAPELEPAPVAVVPRDEVETWNRELQQWLKP*
Ga0066789_1041570913300005994SoilLLVIGVLLAVYAPGNNSVRWITGVSVVNRGAAMVQCGLLLSLLLLSRFLGLSWRRPAFGITLGLGILTSVDLAIRAVRTEFSSDLWVSYLNLLATGTYLVCISIWIGYLLAPELKPASLEVLPHDDEVETWNREFQQLLRR*
Ga0097691_101353063300006055Arctic Peat SoilRPAFGITLGLGILTSVDLATSALRAEFTSAGTREFLNLLITVASLVCVSIWIGYLWAPELEPAPVAVVPRDEVETWNRELQQWLKP*
Ga0075017_10019480513300006059WatershedsSSRFLGLSWRRPAFGIALGLGILSSVDLAVYAVHAEFTGEGWTEFLNLLTTGTYLVCVLIWIGYSLAPEPAPVSLAVVPDDEVETWNRELQQLLRQ*
Ga0075017_10127910613300006059WatershedsVMGVLFAVYAPGDISIRLVAGSIVSRGAAMIQCGLLLALLLFSRILGLCWRRPAFGIVLGLGVLTSVDLAVYALRTGFSSAVWVPYLNLAMTGTYLVCVSIWIGYFLAPEPKLAFATIVSRDEVETCNSELQQWIRH*
Ga0075018_1058178013300006172WatershedsIYAPGDNGIRWIAGVSVVNRGAAMVQSGLLLSLLFFSRFLGLSWRRPAFGITLGLGLLSSVDLGIYALRAEFTSEVSVEFLNLLTTGAYLACVLVWIGYLLVPEPKPASLEALPHEEVETWNREFQQLLRH*
Ga0075521_1030568423300006642Arctic Peat SoilMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLGALTSADLAMFALRAAFTSGAAVEVLDLLITGAYLVCVSIWIGYLLAPELEPVTLTVVHDNEVETWNRELQQLLRP*
Ga0116222_148281923300009521Peatlands SoilMVQSGLLLSLLLFSRFLGLSWRRLAFGITLGLGIVTSVDLAMFALRAEFTSAAGKEFLNLLITGTYLICVLIWIRYLLAPEPEPASLAVVPHDEVETWNTELQHLLRD*
Ga0116225_110582823300009524Peatlands SoilASVVTRGAALVQCGLLLTLLLFSRFLGLTWRRPAFGITLGLGVLTSVNLAIYALRAEFTNRVGAAFLNFLATGTYLVCVSIWIGYLLAPEPQPASLAVVPHDEVETWNTELQHLLRD*
Ga0116123_102171943300009617PeatlandMVQCGLLLALLLFSRFLGLSWRRPAFGITLGLGILTSVDLAFSALRAEFTSRVGAEFLNLLITGAYLVCVSIWIGYLRAPEIEPASLTVVPRDEVETWNRELRHFLRQ*
Ga0116114_105493513300009630PeatlandRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH*
Ga0116112_121564813300009636PeatlandRGAAMVQSGLLLALLLYSRFLGLSWRRPALGIALGLAVLTSADLATFALRAAFTSELAKDIVNLLMTGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD*
Ga0116113_102398243300009638PeatlandSLLVFSRFMGLSWRRPAFGIALGLAILAGIDLVVHAIRSEFSSHAWVQYLSLLATGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD*
Ga0116126_104381013300009640PeatlandIALGLGVLTSVDLAFSALRAEFNSRVGAQLLDLLVTGTYLVCVLIWIGYSLAPELELASLTIVSHDEVENWNTELQHLLRD*
Ga0116132_110462623300009646PeatlandAFGIALGLAVLTSLDLAMFALRAEFTSRAGAEFLNLLITGNYLVCVSIWIGYLLAPEAKPASLAAVPHDEVETWNTELQRLLKG*
Ga0116131_119947023300009760PeatlandLLFSRFLGLSWRRPAFGIALGLGFLASADLAMFALRAEYTSVVGAEFLNLLITAAYLVCVSIWIGYLLAPEVERVSLTVVPHGAVVLHDEVGTWNREFQQFLKQ*
Ga0116131_123555223300009760PeatlandLLLFSRFLGLSWRRPAFWITLGLGALTSVDLAIYALRAEFSSDVWVPYLNLLITGTYLVCVSIWIGYLLAPELEPGPLTVVPHDEVETWNTELQQFLKQ*
Ga0116223_1017611313300009839Peatlands SoilKWVAGASVVTRGAALVQCGLLLTLLLFSRFLGLTWRRPAFGITLGLGVLTSVNLAIYALRAEFTNRVGAAFLNFLATGTYLVCVSIWIGYLLAPEPQPASLAVVPHDEVETWNTELQHLLRD*
Ga0116223_1018934813300009839Peatlands SoilKIDACQDPETERDPESFGIALGLGVLTSVYLANYALRAEFTSRSGAGFLNLLTTGTYLVCVSIWSGYLLAPEPEPASLAVVPHDEVETWNTELQHLLRD*
Ga0116223_1088168323300009839Peatlands SoilGLGILTSVDLATYALRAEFTSRVGAELLNLLITGTYLVCVSIWIGYLLAPEARPVSLAVLPRDEVETWNREFQHLLKD*
Ga0074046_1011600243300010339Bog Forest SoilWHAGVSVVNRGAVMVQCGLLVALLLFSRFLGVSWRRPAFGIALGLGILTSVDLATSALRVEFTSNVTRDFLNLLITVASLVCVSIWIGYLLAPEPKPVSLTVVPHNEVETWNTELQRFLRD*
Ga0074046_1082754013300010339Bog Forest SoilGIALGVGVVTSVDLAMFALRVEFASEAGKDFLDLLITGAYLVCVSIWVRYMLAPEVEPASLTVVPRDEVEIWNRELQQFLKD*
Ga0136449_10131095523300010379Peatlands SoilASVVTRGAALVQCGLLLTLLLFSRFLGLTWRRPAFGITLGLGVLTSVNLAIYALRAEFTSRVGAALLNFLATGTFLVCVLIWTGYLLAPEPEPVSLAAVPHDEVETWNTELQHLLRD*
Ga0136449_10401373923300010379Peatlands SoilAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSFDLAMFALRAEFTSRAGAETLNLLITGNYLVCVSIWIGYLLAPEPKPASLAAVPHDEVETWNTELQRLLKG*
Ga0138569_111417213300011079Peatlands SoilGLTWRRPAFGITLGLGVLTSVNLAIYALRAEFTNRVGAAFLNFLATGTYLVCVSIWIGYLLAPEPQPASLAVVPHDEVETWNTELQHLLRD*
Ga0137392_1035432033300011269Vadose Zone SoilYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELASPTVVAHDEVETWNRELQQLIKQ
Ga0137391_1091356023300011270Vadose Zone SoilAFGIALGFGVLTSVDLAFSALRAEFASDVAREFLNLLITGTYLVCVLMWIGYSLAPELELASPKDVPPDEVETWNRELQQLLKQ*
Ga0137391_1134951413300011270Vadose Zone SoilMGVLLAVYAPGGNSAKWYAGVFVINRGAAMVQCGLLLALLLFSGFLGLSWRRSAFGIALGLGILTSVDLAMFALRTAFASWVAVEFFNLLITGAYLVCVSIWIGYVLALELKPASLTVVPHDEVETWNTELQRLLKDRFLRQ*
Ga0137399_1123903323300012203Vadose Zone SoilLLSLLLFSRFLGLSWRRSAFGIALGLGVLTSADLAMFALRAEFTSEGGKQFLDLLITGVYLACVLIWIGYSLAPEHSPAFLTVVPNDNDEVETWNRELQQLLKQ*
Ga0137390_1032243543300012363Vadose Zone SoilLAVYAPGGNSAKWYAGVFVINRGAAMVQCGLLLALLLFSGFLGLSWRRSAFGIALGLGILTSVDLAFSALRAEFASEVGAEFLDLLITGTYLVCVLIWIGYLLAPELEPASVAAVPHEEVETWNRELQQLLKQ*
Ga0137416_1022925213300012927Vadose Zone SoilKWYAGIFVINRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANLLDLLITGTYLVCVSIWIGYLLAPELELASPTVVAHDEVETWNRELQQFLKQ*
Ga0137416_1183014423300012927Vadose Zone SoilVNRGAAMVQCGLLLSLLLFSRFLGLSWRRSAFGIALGLGVLTSADLAMFALRAEFTSEGGKQFLDLLITGVYLACVLIWIGYSLAPEHSPAFLTVVPNDNDEVETWNRELQQLLKQ*
Ga0137416_1203524023300012927Vadose Zone SoilLLLALLLFSRFLGLSWRRSTFGIARRLGVLTSLDLAMFALRTAFASWVAVEFFNLLITGAYLVCVSIWIGYVLALELKPASLTVGPNDNDNAEVETWNRELQQLLKH*
Ga0181539_109570633300014151BogVAPGDSSVKWHAGVSVVNRGAAMVQCGLLLSLLLFSRFVGVSWRRPAFGIALGLALLTSVDLAASALRVEFSSDVSRGILNLVVTGASLVCVSIWLRYLVAPEPEPASITVVSRDEAETWNRELRQWLSH*
Ga0181527_117498913300014153BogAVYAPGDNRAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEFTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDVVETWNRELQQFLRH*
Ga0181527_128989423300014153BogAVYAPGDNRAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH*
Ga0181524_1035778423300014155BogAVYAPGDNRAKWIAGVYVVNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEFTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH*
Ga0181523_1013060413300014165BogGVFVVNRAAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAFSALRAEFNSRVGAQLLDLLVTGTYLVCVLIWVGYSLAPELEPASLAVVPHDEVETWNTELQHFLRD*
Ga0181526_1021753033300014200BogLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAIYAVRAEFSSGIWVPYLNLLRTSTDFVCILIWIGYLLVPEPESASPTVVSCEEVETWNTELQHLVRQ*
Ga0182014_1013872243300014491BogSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH*
Ga0182015_1009630353300014495PalsaSIKLVAGSVVNRGAAMVQCGLLLSLLLFSRFVGLSWRRPAFGIALGLGVLSSVDLAIFALRTEFSSAAWIPYLNWAITGTYFVCVSIWIAYLLAPELEPASLTVVSRDEVENWNTELQHVVRQ*
Ga0182019_1001051513300014498FenMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLGALTSADLAMFALRAAFTSGAAVEVLDLLITGAYLVCVSIWIGYLLAPELEPVTLTVVPDNEVETWNRELQQLLRP*
Ga0182019_1092030423300014498FenMQYVAGFLLVLGVLLAVYAPAENSVKWIAGMSSINRGAALVQCGLLLSLLIFSRFLGLSWRRPTFGIALGLGILTSVDLAIRAVFSEFTHGLGSAYMDVLITGTFLVCVLVWIGYSLLPEIKPASVAALPRVEVETWNTELQHLLRD*
Ga0182019_1129548413300014498FenLLFSRFLGLSWRRPAFGITLGLAVLISVDLALYALRAQFSSNVWLPYIDLLSTGAYLACVLIWIGYLLAPEVEPASLTLVTHDEVEIWNTELQHLLRD*
Ga0181522_1105784513300014657BogAGVFVVNRGAALVQCGLLLFLLGFSYFMGLSWRRLGFGITLGLGVLTSVELAVSAIRAEFASASVRDVLNLLTTGTYLLCVVTWIGYALAPEPEPAVLALFPRDEVETWNTVFRHLLRD*
Ga0182030_1043871933300014838BogVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAFSALRAEFNSMVGAQLLDLLVTGTYLVCVLIWVGYSLAPELEPASLTVVSRDEVETWNTELQHLLRD*
Ga0182030_1133197623300014838BogRRPAFGVALGLGILTSADFAMFALRAAFPNEVVVEFLNLLIPGAYLVCVSIWIGYLLTPELELASPMVVPRDEVETWNREFQQFLER*
Ga0181505_1069442023300016750PeatlandAFGIALGLGVLTSVYLANYALRAEFTGKVAAGFLSLLTTGTFLVCVSIWIGYLLAPEPEPASLAVVPHGEVETWNTELQHLLRD
Ga0187818_1004486933300017823Freshwater SedimentRWFAGVLAINRGAAMVQSGLLLSLLLFSRFLGLSWRRSAFGIALGLGVLTSVYLANYALRAEFTSKAGADFLNLLTTGTYLACVSIWTGYLLTPEPEPVSLAVVSHDEVETWNTELQHLLRD
Ga0187849_113197613300017929PeatlandLLGVGVLLAVYAPGDMSVRWLAGMLDVNRGAAIVQSGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAFSALRAEFASEVAADFLDLLRTGTYLVCVLIWVGYSLAPELEPASLAVVPHDEVETWNTELQHLLRD
Ga0187814_1042262123300017932Freshwater SedimentSRFLGLSWRRSAFGIALGLGVLTSVYLANYALRAEFTSKAGADFLNLLTTGTYLACVSIWTGYLLTPEPEPVSLAVVSHDEVETWNTELQHLLRD
Ga0187803_1024302823300017934Freshwater SedimentYASGDSRVKWHTGVFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPTLGITLGLGILTSVDLATSALRAAFTGDATRQLLNLLITGASLICVSLWIGYLWAPELEPAASLAVVPHDEVETWNRELQHLVRH
Ga0187848_1017777413300017935PeatlandTGLLLIMGVLLGVYAPGGNSARWYAGVLVVNRGAAMVQCGLLLALLLFSRFLGLSWRRSAFGIALGLGVLTSVDLATFALRAELTSDVEADFLDLLITGTYLVCVSIWIGYVLAPEVDPASLTIVPHDEVETWNREFQQFLKH
Ga0187848_1025446913300017935PeatlandTGLLMAVSVLLAIYAPGDNNVRWIAGVSVVNRGAALVQCGLLLSLLLLSRFLGLTWRRPAFGITLGLGVLTSADLAVYALRAQLTSSTWVPYLDLLRTGTYLACVLIWIGYSLASERKPASLAVLPRDEVETWNTAFQHLLRD
Ga0187853_1002652813300017940PeatlandRPAFGIALGLAILAGIDLVVHAIRSEFSSHAWVQYLSLLATGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD
Ga0187853_1002685063300017940PeatlandLLLALLLFSRFLGLSWRRSAFGIALGLGVLTSVDLATFALRAELTSDVEADFLDLLITGTYLVCVSIWIGYVLAPEVDPASLTIVPHDEVETWNREFQQFLKH
Ga0187853_1053653613300017940PeatlandRPAFGITLGLGILTSVDLAFSALRAEFTSRVGAEFLNLLITGAYLVCVSIWIGYLRAPEIEPASLTVVPRDEVETWNRELRHFLRQ
Ga0187850_1006205113300017941PeatlandSAFGIALGLGVLTSVDLATFALRAELTSDVEADFLDLLITGTYLVCVSIWIGYVLAPEVDPASLTIVPHDEVETWNREFQQFLKH
Ga0187879_1045178823300017946PeatlandLLVTISVMLAVFAPGDNGVRAIAGITVVNRGAAMVQCGSLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAIYAVRAEFSSGIWVPYLNLLRTSTDFVCILIWIGYLLVPEPESASPTVVSCEEVETWNTELQHLVRQ
Ga0187817_1057664023300017955Freshwater SedimentFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPTLGITLGLGILTSVDLATSALRAEFTGDATRQLLNLLITGASLICVSLWIGYLWAPELEPAASLAVVPHDEVETWNRELQHLVRH
Ga0187891_119108623300017996PeatlandVVLTVYAPGGSSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSLDLAMFALRAEFTSRAGAEFLNLLITGNYLVCVSIWIGYLLAPEAKPASLAAVPHDEVETWNTELQRLLKG
Ga0187891_120827713300017996PeatlandESRFFNVTTQQSLRYLTGLLLVIGVLLAIYAPGNNRVWWVAAASVIDRGAAMVQCGLLIILLLFSLFSGLSWRRPALGIALGLTIMVSVDLVIRALRAEFRSDAWVPYLDLLATGTYLVCVAIWIRYLLAPELEPSSPTVVSYDEVEIWNRELHQFLRH
Ga0187870_115136113300017998PeatlandMGVLLAVYAPGDNSLRWIAGVSVVNRGAAMVQCGLLVALLLFSRFLGLSWRRPAFGITLGLGILTSVDLAFSALRAEFTSRVGAEFLNLLITGAYLVCVSIWIGYLRAPEIEPASLTVVPRDEVETWNRELRHFLRQ
Ga0187876_125241913300018003PeatlandTAFLLVMGVVLTVYAPGGSSAKWYAGIFVVNRGADMVQSGLLLALLLFSRFLGLSWRRPAFGIALGLAVLTSLDLAMFALRAEFTSRAGAEFLNLLITGNYLVCVSIWIGYLLAPEAKPASLAAVPHDEVETWNTELQRLLKG
Ga0187884_1018896123300018009PeatlandLGLGVLTSVDLAFSALRAEFNSMVGAQLLDLLVTGTYLVCVLIWVGYSLAPELEPASLTVVSRDEVETWNTELQHLLRD
Ga0187886_115352223300018018PeatlandFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYLVCVLIWIGYSLAPELELASLTIVSHDEVENWNTELQHLLRD
Ga0187874_1010714223300018019PeatlandGLSWRRPAFGIALGLAVLTSLDLAMFALRAEFTSRAGAEFLNLLITGNYLVCVSIWIGYLLAPEAKPASLAAVPHDEVETWNTELQRLLKG
Ga0187861_1040557413300018020PeatlandVSVVNRGAAMVQCGLLLSLLLFSRFLGLSWRHPAFGIALGLGVLTSVDLAAYAVRAEFTSAVGTEFLNLLTTGTYLVCVLIWIGYLLAPEAEPASVAVLPRDEVETWNTEFQHLLRD
Ga0187889_1008255253300018023PeatlandDLVVHAIRSEFSSHAWVQYLSLLATGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD
Ga0187885_10004423133300018025PeatlandLTVYAPGGYSDGWWYTGAAVINRGAAMIQSGLLLALLLSSRFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYLVCVLIWIGYSLAPELELASLTIVSHDEVENWNTELQHLLRD
Ga0187869_1039959623300018030PeatlandAFGIALGLGVLTSVDLATFALRAELTSDVEADFLDLLITGTYLVCVSIWIGYVLAPEVDPASLTIVPHDEVETWNREFQQFLKH
Ga0187875_1057484213300018035PeatlandNRGAAMVQCGLLLALLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH
Ga0187883_1076088123300018037PeatlandGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVYLANYALRAEFTGKVAAGFLSLLTTGTFLVCVSIWIGYLLAPEPEPASLAVVPHGEVETWNTELQHLLRD
Ga0187855_1091523323300018038PeatlandMIQCGLLLSLLLFSRFLGLSWHRRAFGITLGLGILSSVDLAVYAAHVEFTGPGWTAYLNLLATATYLASVSIWIGYVSAPEAQPASVAVLPREEVETWNTVFQHLLRD
Ga0187862_1004587253300018040PeatlandLAVGVLLTVYAPGQSANWYSDIFVANRGAAMIQLGVLLSLLVFSRFMGLSWRRPAFGIALGLAILAGIDLVVHAIRSEFSSHAWVQYLSLLATGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD
Ga0187862_1036031123300018040PeatlandVYAPGGNTARWYAGVFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAFSALRAEFNSRVGAQLLDLLVTGTYLVCVLIWVGYSLAPELEPASLAVVPHDEVETWNTELQHFLRD
Ga0187871_1064501923300018042PeatlandAFGITLGFGILACVDLAASALRTEFTSNAARDLLNLLTMSTYLVCVLIWLRYLVASEAEAAPPPVLPPNNEVEIWNKALQQFLNH
Ga0187887_1060158823300018043PeatlandLLVLGVVLAAYSPGGNSVKWIAGVSVINRGAAMIQCGLLLSLLLFSRFLGLSWHRRAFGITLGLGILSSVDLAVYAAHVEFTGPGWTAYLNLLATATYLASVSIWIGYVSAPEAQPASVAVLPREEVETWNTVFQHLLRD
Ga0187859_1042064113300018047PeatlandLLTVYAPGGYSDGWWYTGAAVINRGAAMIQSGLLLALLLSSRFLGLSWRRPAFGIALGLAVLTSADLATFALRAAFASEAMKDILNLLMTGTYLVCVLIWIGYSLAPELELASLTIVSHDEVENWNTELQHLLRD
Ga0187858_1041239023300018057PeatlandVQSGLLLSLLLFSRFLGVTWRRHAFGIALGLAVLTSAYLAIYGLRAEFTSRAGTDFLNLLLNGTNLVCVSIWIGYVLAPEPEPASLAVVSHDEVETWNTELQHLLKD
Ga0187770_1087881223300018090Tropical PeatlandLFSRLLGLSWRRHAFGIALGLGILTSFDIANFALRAEFTSRTSVYVLNFLITGSYLVSVLIWTAYSLAPEPAPAPVTILAHEEVETWSTEFQRLLRG
Ga0187770_1097134423300018090Tropical PeatlandLAVYAPGDNSAKWYAGIFVVNRGAALIQSGILLALLLSSRFLGLSWRRHAFGIALGLAVLTSVDLAFFALRAEFSGGVVRDYLNLLITGAYLVCVSIWIGYLLAPEVELSSPAVVAHGAVLPHDEVETWNRELQQFLRQ
Ga0187852_103805943300019082PeatlandMVQCGLLLSLLLFSRFLGLSWRRSAFGIALGLGVLTSVDLATYAIRAEFPSDVVRGVLNLLKTGAYLVCVSIWIGYLRAPELEPVSLTVVPHDEVETWNTELQRLLRD
Ga0187852_133402613300019082PeatlandTGLLLIMGVLLGVYAPGGNSARWYAGVFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAFSALRAEFNSMVGAQLLDLLVTGTYLVCVLIWVGYSLAPELEPASLTVVSRDEVETWNTELQHLLRD
Ga0182031_113273823300019787BogFLGLSWRRPAFGIALGLAALTSADLATFALRAAFTSEAAKEILNLLMTGPYLVCVSIWIGYLLAREPKPASVAVLPHDEVETWNTEFQRLLRH
Ga0210399_1060737613300020581SoilWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELASPTVVAHDEVETWNRELQQLIKQ
Ga0210406_1064023823300021168SoilPEGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAASFLDLLITGTYLVCVSTWIGYLLAPELELASPTAVAHDEVETWNRELQQFLKQ
Ga0210405_1077781713300021171SoilRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELASPTVVARDEVETWNRELQQFLKQ
Ga0210390_1151930423300021474SoilAPGDNSVRLIAGIFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVQTSVDLAMFALRAQFTSAASINFLNLLITGTYLICVLTWLGYLLVPEHEPASAGIISHDEVETWNKELQHFLKQ
Ga0210402_1122622513300021478SoilAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFSSEAAANFLDLLITGTYFVCVSIWIGYLLAPELEVASPTVVAHDEVETWNRELQQFLKQ
Ga0224545_101497913300022881SoilAPGDNSIKWIAGVSVVNRGAAMVQCGLLLSLLLFSRFLGLSLRRLAFGITLGLGASASVDLAIYALRAEFISQRWTEFLNLLSTGTDLVCVLIWIGYVLAPEHTPASPTVFPDDEVNTWNRELQQLLRQ
Ga0224554_106366113300023068SoilMGVLLCVYAPGGNSARWYAGVFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLAFSALRAEFNSMVGAQLLDLLVTGTYLVCVLIWVGYSLAPELEPASLTVVSRDEVETWNTELQHLLRD
Ga0208035_101945733300025406PeatlandGDYSAKWYVGVAVVNRGAAMVQSGLLLALLLYSRFLGLSWRRPALGIALGLAVLTSADLATFALRAAFTSELAKDIVNLLMTGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD
Ga0208194_100116883300025412PeatlandVGVLLTVYAPGQSANWYSDIFVANRGAAMIQLGVLLSLLVFSRFMGLSWRRPAFGIALGLAILAGIDLVVHAIRSEFSSHAWVQYLSLLATGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD
Ga0208036_107113323300025419PeatlandAVYAPGNNSVRWHAGVFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH
Ga0208034_103662623300025442PeatlandVQSGLLLALLLFSRFLGLSWRGPAFGIALGLGVLTSVDLAMFALRAEFASAVAAVYLNLLTTGTYLVCVLIWIGYLLAPEVDPASLTVVPRDEVETWNKELQQFLKQ
Ga0208189_104608613300025444PeatlandGLSWRRPAFGIALGLGILTSVDLAFSALRAEVTSRAGQEILNLLITGAYLVCVSIWIGYLRAPELEPASLTVVPRDEVETWNRELRQFLRH
Ga0208039_102300613300025454PeatlandSLLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVLIWIGYLLVPEVEPASVTVVPHDEVETWNREFQQFLRH
Ga0208714_104330723300025527Arctic Peat SoilQSGLLLALLLFSRFLGLSWRRPAFGITLGLAVLTSLDLAMFTLRAEFASEVAAEFLDLLITGTYFICVSIWIGYLRAPEFEPAASLAVVPPDEVETWNTELQHLLRD
Ga0208691_110227413300025612PeatlandFRLVAGIVVVSRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGITLGLGILTSVDLAVYAVRAGFAPGVGAEFLNFLTTGTYLVCVLIWIGYLLAPEHQPVSLTAVSRDEVETWNTELQHLLRD
Ga0207646_1031222333300025922Corn, Switchgrass And Miscanthus RhizosphereLLFARFLGLSWRRPAFGITLGLGVLTSVDLATYALRAAFASEVAADFSDLLATGAYLVCVSIWIGYLLAPELKSASLAVVPQDEVETWNTELQHLLRN
Ga0209350_108171623300026277Grasslands SoilMVQCGLLLALLLSSRFLGLSWRRSTFGIALGLGILTSVDLATFALRTAFASWVAVEFFNLLITSAYLVCVSIWIGYVLAPELQPASLMIVPNDNDNDEVGTWNRELRQLLKH
Ga0209687_125768513300026322SoilGDNSGRWIAGVSVVNRGAAMVQCGLLLALLLSSRFVGLSWRRSTFGIALGLGILTSVDLATFALRTAFASWVAVEFFNLLITSAYLVCVSIWIGYVLAPELQPASLMIVPNDNDNDEVGTWNRELRQLLKH
Ga0257156_110040723300026498SoilKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELGSPTVVAHDEVETWNRELQQFLKQ
Ga0257168_106781313300026514SoilLLGAGALLAVYAPGGNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAALTSEAAANFLDLLITGTYLACVSTWIGYLLAPELELASPTVVAHDEVETWNRELQQFLKQ
Ga0209623_101359423300026880Forest SoilNSAKWYAGIFVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELASPTVVAHDEVETWNREFQQFLKQ
Ga0208725_101977813300027158Forest SoilGVLLAAYAPGDNSVRLIAGIFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVQTSVDLAMFALRAQFTSAASINFLNLLITGTYLICVLTWLGYLLVPEHEPASAGIISHDEVETWNKELQHFLKQ
Ga0208984_103612423300027546Forest SoilLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGAYLVCVSIWIGYLLAPEVELASPTDVPHDEVETWNRELQQLLKE
Ga0209735_100613863300027562Forest SoilALGLGVLTSVDLAYSALRAEFTSRVGAEFLNLLVTGTYLVCVLTWIGYLLAPELKPASLTVVPRDNDEVETWNRELQQLLKH
Ga0209220_117034523300027587Forest SoilNRGAAMVQSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPEVELASPTDVPHDEVETWNRELQQLLKE
Ga0209329_105516813300027605Forest SoilAPGGNSAKWYAGIVVVNRGAAMVQSGLLLALLLFSRFLGLSWRRSTFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELASPTVVAHDEVETWNRELQQFLKQ
Ga0209117_102469153300027645Forest SoilWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELELASPTVVAHDEVETWNREFQQFLKQ
Ga0208565_110992213300027662Peatlands SoilGASVVTRGAALVQCGLLLTLLLFSRFLGLTWRRPAFGITLGLGVLTSVNLAIYALRAEFTNRVGAAFLNFLATGTYLVCVSIWIGYLLAPEPQPASLAVVPHDEVETWNTELQHLLRD
Ga0209333_111245213300027676Forest SoilGLSVVNRGVAMVQCGLLLSLLLFSRFLGLSWRRHAFGIALGLGILASVDLAVYAVHAEFTSERWTEFLNFLTTGTYLVCVSIWIAYLLAPELKPVSLTVIPNDEVETWNSELQQLLKH
Ga0208696_124465523300027696Peatlands SoilMVQCGLLLALLLFSRFLGLSWRRPAFGVVLGLGVLTSVDLAIYALRTEFSSAVWVPYLNLAMTGAYLVCVSIWIGYLLAPEPQPAFVSRDEVETWNSELQQWIRH
Ga0209655_1001804153300027767Bog Forest SoilMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGALTSIDLATFALRAEFTSELSVKLLNLLITGTDLACVLIWIGYLLAGELETVSPTIVPHDEVESWNRELQHLLKQ
Ga0209772_1016401213300027768Bog Forest SoilLSWRRAAFGIALGLGILTSVDLAAYAVRAEFTSGAGAAFLNLLTKGTYLVCVSIWIGYSLTPELESASSTIVPHDEVETWNREFQHLLKP
Ga0209517_1004124063300027854Peatlands SoilLALLLSRFLGLPWRRPAFGITLGLGILTSVDLATYALRAEFTSRVGAELLNLLITGTYLVCVSIWIGYLLAPEARPVSLAVLPRDEVETWNREFQHLLKD
Ga0209415_1112896323300027905Peatlands SoilLGLPWRRPAFGITLGLGILTSVDLATYALRAEFTSRVGAELLNLLITGTYLVCVSIWIGYLLAPEARPVSLAVLPRDEVETWNREFQHLLKD
Ga0209006_1071856913300027908Forest SoilLLSLLLLSRFLGLSWRRHAFGITLGLGILSSVDLAVYAVRAEFSSGVWVPYLNLLRTGTYLVCVLTWIGYLLLPELEPASLAVLPRDEVEIWNTEFQHLLRD
Ga0137415_1126293013300028536Vadose Zone SoilVNRGAAMVQCGLLLSLLLFSRFLGLSWRRSAFGIALGLGVLTSADLAMFALRAEFTSEGGKQFLDLLITGVYLACVLIWIGYSLAPEHSPAFLTVVPNDNDEVETWNRELQQLLKQ
Ga0302149_100388463300028552BogYEGVFVVNRGAAMVQCGLLLALLLSSCFLGLSWRRPAFGIALGLAALTSADLATFALRAAFTSEAAKEILNLLMTGPYLVCVSIWIGYLLAREPKPASVAVLPHDEVETWNTEFQRLLRH
Ga0302267_1026936313300028745BogLILGVLLAVYAPGDYSAKWYVGVAVVNRGAAMVQSGLLLALLLYSRFLGLSWRRPALGIALGLAVLTSADLATFALRAAFTSELAKDIVNLLMTGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD
Ga0302222_1036261213300028798PalsaAVYAPGDNSAKWYAGVFVVNRGAAMVQSGLLLSLLLFSRFLGMSWRRPAFGITLGLGVLTSLDLAYSALRAEFSSGVGAEFLNLLITGVYLVCVSIWMRYLVAPEPEPVSPTAVPHDEVEIWNRELQQFLKH
Ga0222749_1079811513300029636SoilSGLLLALLLFSRFLGLSWRRSAFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELEVASPTVVAHDEVETWNRELQQFLKQ
Ga0247271_12075223300029903SoilLGLSWRRPALGIALGLAVLTSADLATFALRAAFTSELAKDIVNLLMTGTYFVCVLIWIGYLLLPEPKPASIAVLPHDEVETWNTEFQRLLRAKD
Ga0311369_1052996223300029910PalsaMVQCGLLLSLLLFSYFLGLTWRRPAIGITLGLGILTSIDLATSALRAEFTSAATRELLNLMVTGSALACVSIWIGYLLVPEPNPAPVTVVSSDEVETWNKELQRLARH
Ga0311340_10031264103300029943PalsaYFLGLTWRRPAIGITLGLGILTSIDLATSALRAEFTSAATRELLNLMVTGSALACVSIWIGYLLVPEPNPAPVTVVSSDEVETWNKELQRLARH
Ga0311340_1081298413300029943PalsaLTGALLAVYAPGDQSIMLVAGSIISRGAAMVQCGLLLSLLLCSPLLGLTWRLRTLGIALGLGVVSSVDLATYALRTEFSSPAWVPYLNFALTAAYFVAVSIWIGYLLAPEREPALLAGVSREEVETLNTVLQHLVR
Ga0311352_1046655823300029944PalsaMVQSGLLLSLLLFSRFLGMSWRRPAFGITLGLGVLTSLDLAYSALRAEFSSGVGAEFLNLLITGVYLVCVSIWMRYLVAPEPEPVSPTAVPHDEVEIWNRELQQFLKH
Ga0311338_1008698613300030007PalsaQGLLLMMAVLLAVSAPGGNSLGLAAGIFVVNRGAALVQCGLLIALLLSSRFLGLSWHPPAFGIALGVAVLTTFDLAMFSLRAEFTSATGKEILNLLTTGTYLICVLLWIGYLRVPEAEPDSSSLAVLPHDEVETWNTEFQHLLRD
Ga0311338_1034619713300030007PalsaSWRRPAFGITLGLGVLTSLDLAYSALRAEFSSGVGAEFLNLLITGVYLVCVSIWMRYLVAPEPEPVSPTAVPHDEVEIWNRELQQFLKH
Ga0311353_1138525113300030399PalsaLLAVYAPGDNSAKWYAGVFVVNRGAAMVQSGLLLSLLLFSRFLGMSWRRPAFGITLGLGVLTSLDLAYSALRAEFSSGVGAEFLNLLITGVYLVCVSIWMRYLVAPEPEPVSPTAVPHDEVEIWNRELQQFLKH
Ga0310037_1018720923300030494Peatlands SoilVYAPGGNSVRWFAGVLAVNRGAAVVQSGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVYLANYALRAEFTSRSGAGFLNLLTTGTYLVCVSIWIGYLLAPEPQPASLAVVPHDEVETWNRELQHLVRH
Ga0310039_1016732913300030706Peatlands SoilRGAAVVQSGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVYLANYALRAEFTSRSGAGFLNLLTTGTYLVCVSIWSGYLLAPEPEPASLAVVPHDEVETWNTELQHLLRD
Ga0302310_1037704423300030737PalsaCGLLLSLLLFSYFLGLTWRRPAIGITLGLGILTSIDLATSALRAEFTSAATRELLNLMVTGSALACVSIWIGYLLVPEPNPAPVTVVSSDEVETWNKELQRLARH
Ga0265460_1272139113300030740SoilLLLFSRFLGLSWRRPAFGITLGLGILASVDVAASALRAEFTSNAARELLNLLTTGTYLVCVSIWMRYLGAPEAVPAPPTVVPHDEVEIWNRELQHLLKH
Ga0073994_1200938023300030991SoilYAPGDNSGRWMAGVSVVNRGSAMVQCGLLLALLLFSRFLGLSWRRSTFGIALGLGILTSVDLAMFALRTAFASWVAVEFFNLLITGAYLVCVSIWIGYVLALELKPASLTVVPNDNDNAEVETWNRELQQLLKH
Ga0170824_12385810113300031231Forest SoilGVVLAVYAPGDNSVRWIAGVSVVNRGAAMVQCGLLLSLLLVSRFLGVSWRGAAFGITLGLGVLASVDLAAYALRAEFTSKVGEKFLNLVIPGTYLVCVLIWIRFLLAPELQPASPPVVPHDEVETWNTELQRLLRD
Ga0265340_1026222113300031247RhizosphereGIFVVNRGAAMIQSGLLFSLLLFARFLGVSWRNSAFGIALGLGILTSVDLAYSALRAEFISEVGTDILDLLVTGTYLVCVSIWVRYMLAPEPKPASLTVVSRDEVETWNTELQRLLGQ
Ga0307474_1139709323300031718Hardwood Forest SoilMVQCGLLLSLLLFSRFLGVSWRGTAFGITLGLGVLASVDLAAYALRAEFTSKVGEEFLNLLIPGTYLVCVLIWIRFLLVPELQPASPPVVPHDHDEVETWNTELQRLLRD
Ga0307478_1074834023300031823Hardwood Forest SoilFGIALGLGILTSVDLAMFALRTAFASWVAVEFFNLLITGTYLVCVSIWIGYVLALELKPVSLPVVPNDNDNAEVETWNRELRQLLKH
Ga0307479_1105917313300031962Hardwood Forest SoilLLLALLLFSRFLGLSWRRSTFGIALGLAVLTSLDLAMFALRAAFTSEAAANFLDLLITGTYLVCVSIWIGYLLAPELALASPTVVGHDEVETWNRELQQLIKQ
Ga0307479_1166419913300031962Hardwood Forest SoilSLLLFSRFLGVSWRGTAFGITLGLGVLASVDLAAYALRAEFTSKVGEEFLNLLIPGTYLVCVLIWIRFLLAPELQPASPPVVPHDEVETWNTELQRLLRD
Ga0311301_1096271423300032160Peatlands SoilGASVVTRGAALVQCGLLLTLLLFSRFLGLTWRRPAFGITLGLGVLTSVNLAIYALRAEFTSRVGAALLNFLATGTFLVCVLIWTGYLLAPEPEPVSLAAVPHDEVETWNTELQHLLRD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.