Basic Information | |
---|---|
Family ID | F040609 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 161 |
Average Sequence Length | 46 residues |
Representative Sequence | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF |
Number of Associated Samples | 158 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Eukaryota |
% of genes with valid RBS motifs | 98.05 % |
% of genes near scaffold ends (potentially truncated) | 24.22 % |
% of genes from short scaffolds (< 2000 bps) | 93.79 % |
Associated GOLD sequencing projects | 154 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Eukaryota (70.186 % of family members) |
NCBI Taxonomy ID | 2759 |
Taxonomy | All Organisms → cellular organisms → Eukaryota |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.255 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.224 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.373 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.21% β-sheet: 0.00% Coil/Unstructured: 40.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF01176 | eIF-1a | 87.58 |
PF00313 | CSD | 3.11 |
PF13400 | Tad | 1.24 |
PF04116 | FA_hydroxylase | 0.62 |
PF07811 | TadE | 0.62 |
PF05853 | BKACE | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 87.58 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.62 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.65 % |
Unclassified | root | N/A | 4.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_9088202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1124 | Open in IMG/M |
2170459016|G1P06HT02GBX3Z | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
2170459021|G14TP7Y02FPTYR | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300001991|JGI24743J22301_10060932 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 777 | Open in IMG/M |
3300002074|JGI24748J21848_1011228 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 1055 | Open in IMG/M |
3300005104|Ga0066818_1002811 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 1040 | Open in IMG/M |
3300005172|Ga0066683_10501131 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 742 | Open in IMG/M |
3300005335|Ga0070666_10548641 | All Organisms → cellular organisms → Eukaryota | 841 | Open in IMG/M |
3300005339|Ga0070660_100631583 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 896 | Open in IMG/M |
3300005441|Ga0070700_100578642 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 876 | Open in IMG/M |
3300005441|Ga0070700_101123529 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005445|Ga0070708_101049924 | All Organisms → cellular organisms → Eukaryota | 763 | Open in IMG/M |
3300005466|Ga0070685_10264870 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300005466|Ga0070685_11016842 | All Organisms → cellular organisms → Eukaryota | 622 | Open in IMG/M |
3300005519|Ga0077119_10208493 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 841 | Open in IMG/M |
3300005530|Ga0070679_101631277 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 593 | Open in IMG/M |
3300005547|Ga0070693_100406364 | All Organisms → cellular organisms → Eukaryota | 945 | Open in IMG/M |
3300005557|Ga0066704_10944663 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005564|Ga0070664_100863693 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 847 | Open in IMG/M |
3300005569|Ga0066705_10501558 | All Organisms → cellular organisms → Eukaryota | 760 | Open in IMG/M |
3300005829|Ga0074479_11066367 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 570 | Open in IMG/M |
3300005834|Ga0068851_10396217 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 811 | Open in IMG/M |
3300005834|Ga0068851_10618538 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300005842|Ga0068858_100954330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 839 | Open in IMG/M |
3300005844|Ga0068862_102564108 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300006050|Ga0075028_100890631 | All Organisms → cellular organisms → Eukaryota | 548 | Open in IMG/M |
3300006575|Ga0074053_11934459 | All Organisms → cellular organisms → Eukaryota | 946 | Open in IMG/M |
3300006606|Ga0074062_10026930 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 849 | Open in IMG/M |
3300006800|Ga0066660_10855183 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 741 | Open in IMG/M |
3300006852|Ga0075433_10361913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1281 | Open in IMG/M |
3300006954|Ga0079219_12046549 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300009137|Ga0066709_102166806 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 767 | Open in IMG/M |
3300009148|Ga0105243_11751828 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300009174|Ga0105241_10998432 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 783 | Open in IMG/M |
3300009610|Ga0105340_1430951 | All Organisms → cellular organisms → Eukaryota | 588 | Open in IMG/M |
3300009795|Ga0105059_1009002 | All Organisms → cellular organisms → Eukaryota | 943 | Open in IMG/M |
3300009840|Ga0126313_11176768 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 631 | Open in IMG/M |
3300010038|Ga0126315_10406283 | All Organisms → cellular organisms → Eukaryota | 857 | Open in IMG/M |
3300010045|Ga0126311_10811574 | All Organisms → cellular organisms → Eukaryota | 755 | Open in IMG/M |
3300010117|Ga0127449_1160713 | All Organisms → cellular organisms → Eukaryota | 565 | Open in IMG/M |
3300010321|Ga0134067_10412136 | All Organisms → cellular organisms → Eukaryota | 544 | Open in IMG/M |
3300010323|Ga0134086_10207645 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 734 | Open in IMG/M |
3300010333|Ga0134080_10599005 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 536 | Open in IMG/M |
3300010364|Ga0134066_10188427 | All Organisms → cellular organisms → Eukaryota | 676 | Open in IMG/M |
3300010375|Ga0105239_13527787 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300010401|Ga0134121_12681732 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300010403|Ga0134123_11941002 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300010858|Ga0126345_1293136 | All Organisms → cellular organisms → Eukaryota | 729 | Open in IMG/M |
3300010864|Ga0126357_1074778 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300010905|Ga0138112_1028082 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 569 | Open in IMG/M |
3300011423|Ga0137436_1039044 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 1200 | Open in IMG/M |
3300011442|Ga0137437_1293788 | All Organisms → cellular organisms → Eukaryota | 555 | Open in IMG/M |
3300012038|Ga0137431_1187211 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300012096|Ga0137389_11527376 | All Organisms → cellular organisms → Eukaryota | 564 | Open in IMG/M |
3300012207|Ga0137381_11643467 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 533 | Open in IMG/M |
3300012212|Ga0150985_104875543 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 570 | Open in IMG/M |
3300012354|Ga0137366_10754447 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 692 | Open in IMG/M |
3300012400|Ga0134048_1312942 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 630 | Open in IMG/M |
3300012495|Ga0157323_1036596 | All Organisms → cellular organisms → Eukaryota | 545 | Open in IMG/M |
3300012499|Ga0157350_1044845 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 542 | Open in IMG/M |
3300012500|Ga0157314_1026438 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 626 | Open in IMG/M |
3300012506|Ga0157324_1039874 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 570 | Open in IMG/M |
3300012514|Ga0157330_1055954 | All Organisms → cellular organisms → Eukaryota | 573 | Open in IMG/M |
3300012885|Ga0157287_1120276 | All Organisms → cellular organisms → Eukaryota | 510 | Open in IMG/M |
3300012893|Ga0157284_10053902 | All Organisms → cellular organisms → Eukaryota | 927 | Open in IMG/M |
3300012898|Ga0157293_10151721 | All Organisms → cellular organisms → Eukaryota | 655 | Open in IMG/M |
3300012901|Ga0157288_10095447 | All Organisms → cellular organisms → Eukaryota | 797 | Open in IMG/M |
3300012906|Ga0157295_10128545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
3300012909|Ga0157290_10201027 | All Organisms → cellular organisms → Eukaryota | 677 | Open in IMG/M |
3300012910|Ga0157308_10135922 | All Organisms → cellular organisms → Eukaryota | 768 | Open in IMG/M |
3300012911|Ga0157301_10205628 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 666 | Open in IMG/M |
3300012912|Ga0157306_10040225 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 1123 | Open in IMG/M |
3300012957|Ga0164303_10009329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3337 | Open in IMG/M |
3300013096|Ga0157307_1191921 | All Organisms → cellular organisms → Eukaryota | 501 | Open in IMG/M |
3300013100|Ga0157373_10272903 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300014150|Ga0134081_10169791 | All Organisms → cellular organisms → Eukaryota | 726 | Open in IMG/M |
3300014166|Ga0134079_10144462 | All Organisms → cellular organisms → Eukaryota | 954 | Open in IMG/M |
3300014325|Ga0163163_12991887 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 527 | Open in IMG/M |
3300014326|Ga0157380_11079588 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 841 | Open in IMG/M |
3300015024|Ga0167669_1115916 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 803 | Open in IMG/M |
3300015077|Ga0173483_10519313 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 639 | Open in IMG/M |
3300015241|Ga0137418_10219639 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
3300015262|Ga0182007_10266193 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 619 | Open in IMG/M |
3300015356|Ga0134073_10401087 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 517 | Open in IMG/M |
3300015358|Ga0134089_10264804 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 706 | Open in IMG/M |
3300017965|Ga0190266_10476575 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 719 | Open in IMG/M |
3300018027|Ga0184605_10354661 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 662 | Open in IMG/M |
3300018028|Ga0184608_10089199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1274 | Open in IMG/M |
3300018056|Ga0184623_10292736 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 737 | Open in IMG/M |
3300018066|Ga0184617_1006376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2168 | Open in IMG/M |
3300018081|Ga0184625_10318958 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 810 | Open in IMG/M |
3300018431|Ga0066655_10856371 | All Organisms → cellular organisms → Eukaryota | 620 | Open in IMG/M |
3300018469|Ga0190270_12651711 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300018481|Ga0190271_10012675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6114 | Open in IMG/M |
3300018482|Ga0066669_11670659 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 584 | Open in IMG/M |
3300019233|Ga0184645_1324178 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 522 | Open in IMG/M |
3300019238|Ga0180112_1007159 | All Organisms → cellular organisms → Eukaryota | 557 | Open in IMG/M |
3300019361|Ga0173482_10400336 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 638 | Open in IMG/M |
3300019362|Ga0173479_10735154 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 537 | Open in IMG/M |
3300019767|Ga0190267_11432343 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300019876|Ga0193703_1062969 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 556 | Open in IMG/M |
3300021073|Ga0210378_10081034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1271 | Open in IMG/M |
3300021445|Ga0182009_10680800 | All Organisms → cellular organisms → Eukaryota | 556 | Open in IMG/M |
3300021947|Ga0213856_1117439 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 546 | Open in IMG/M |
3300021951|Ga0222624_1451293 | All Organisms → cellular organisms → Eukaryota | 569 | Open in IMG/M |
3300022195|Ga0222625_1007012 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 593 | Open in IMG/M |
3300022694|Ga0222623_10241046 | All Organisms → cellular organisms → Eukaryota | 698 | Open in IMG/M |
3300022886|Ga0247746_1074171 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 808 | Open in IMG/M |
3300023066|Ga0247793_1095454 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 518 | Open in IMG/M |
3300023264|Ga0247772_1009878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1769 | Open in IMG/M |
3300024037|Ga0233355_103677 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 506 | Open in IMG/M |
3300025242|Ga0209258_120579 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 689 | Open in IMG/M |
3300025893|Ga0207682_10050375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1721 | Open in IMG/M |
3300026023|Ga0207677_12246109 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300026035|Ga0207703_11849510 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 580 | Open in IMG/M |
3300026295|Ga0209234_1290276 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 525 | Open in IMG/M |
3300026297|Ga0209237_1228737 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 576 | Open in IMG/M |
3300026310|Ga0209239_1061506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1664 | Open in IMG/M |
3300026334|Ga0209377_1107210 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 1148 | Open in IMG/M |
3300027523|Ga0208890_1015887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1047 | Open in IMG/M |
3300027809|Ga0209574_10045470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1101 | Open in IMG/M |
3300027870|Ga0209023_10603858 | All Organisms → cellular organisms → Eukaryota | 644 | Open in IMG/M |
3300027873|Ga0209814_10129118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1079 | Open in IMG/M |
3300028380|Ga0268265_11081152 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 795 | Open in IMG/M |
3300028590|Ga0247823_10577135 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 847 | Open in IMG/M |
3300028592|Ga0247822_10444307 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300028716|Ga0307311_10239034 | All Organisms → cellular organisms → Eukaryota | 538 | Open in IMG/M |
3300028744|Ga0307318_10319979 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300028755|Ga0307316_10199346 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 721 | Open in IMG/M |
3300028774|Ga0302208_10179323 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 522 | Open in IMG/M |
3300029984|Ga0311332_10486452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 967 | Open in IMG/M |
3300029990|Ga0311336_11238819 | All Organisms → cellular organisms → Eukaryota | 652 | Open in IMG/M |
3300030516|Ga0268255_10079379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1008 | Open in IMG/M |
3300030902|Ga0308202_1061601 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 710 | Open in IMG/M |
3300031058|Ga0308189_10284228 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 640 | Open in IMG/M |
3300031095|Ga0308184_1024432 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 670 | Open in IMG/M |
3300031170|Ga0307498_10112441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 855 | Open in IMG/M |
3300031422|Ga0308186_1019134 | All Organisms → cellular organisms → Eukaryota | 651 | Open in IMG/M |
3300031521|Ga0311364_12239224 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300031649|Ga0307514_10335956 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 817 | Open in IMG/M |
3300031902|Ga0302322_102751522 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 606 | Open in IMG/M |
3300032157|Ga0315912_11194337 | All Organisms → cellular organisms → Eukaryota | 603 | Open in IMG/M |
3300032179|Ga0310889_10410678 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 674 | Open in IMG/M |
3300034151|Ga0364935_0182447 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 672 | Open in IMG/M |
3300034156|Ga0370502_0095267 | All Organisms → cellular organisms → Eukaryota | 946 | Open in IMG/M |
3300034161|Ga0370513_034678 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 1380 | Open in IMG/M |
3300034447|Ga0370544_20650 | All Organisms → cellular organisms → Eukaryota | 535 | Open in IMG/M |
3300034652|Ga0316598_136280 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 688 | Open in IMG/M |
3300034664|Ga0314786_121598 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 584 | Open in IMG/M |
3300034666|Ga0314788_044895 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 852 | Open in IMG/M |
3300034670|Ga0314795_066069 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 670 | Open in IMG/M |
3300034676|Ga0314801_122272 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 605 | Open in IMG/M |
3300034680|Ga0370541_036371 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 609 | Open in IMG/M |
3300034820|Ga0373959_0149253 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.35% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.73% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.11% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.11% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.11% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.86% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.86% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.24% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.24% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.24% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.24% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.24% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.24% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.24% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.62% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.62% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.62% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.62% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.62% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.62% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.62% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.62% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.62% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.62% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.62% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.62% |
Arabidopsis Root | Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300005104 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005519 | Combined assembly of arab plate scrape CL_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015024 | Arctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite) | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021947 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
3300023264 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6 | Environmental | Open in IMG/M |
3300024037 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-Q75 | Environmental | Open in IMG/M |
3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028774 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030516 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Host-Associated | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
3300034161 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_18 | Environmental | Open in IMG/M |
3300034447 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_00788950 | 2088090015 | Soil | MQEGDALNALTFPALAFAALLRRTRLFVPVRLCRRFITTTAARTARAF |
2ZMR_05381060 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MQEGDALNALALTGLALAALLRRALLLLVPARLRRGITTTSATGTARAF |
4NP_00584660 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MQEGDALNALALAGLLALAALLRRALLLLVPARLRRGIITTSAAGTARAF |
JGI24743J22301_100609321 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTXAGTARAF* |
JGI24748J21848_10112283 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTTAARTARAF* |
JGI25404J52841_100108615 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MQEGDALNAFALADLRLTRRLMPVRLRRGIITTTAAASAR |
Ga0066818_10028112 | 3300005104 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITPTSAGTARAF* |
Ga0066683_105011312 | 3300005172 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGSARAF* |
Ga0070666_105486412 | 3300005335 | Switchgrass Rhizosphere | MQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGITTTTAAGTARAF* |
Ga0070660_1006315831 | 3300005339 | Corn Rhizosphere | MQEGYALNAFALTGLALATLLCRARLLVPVRLRRGIITTATAGTARAF* |
Ga0070700_1005786422 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTAAARTARAF* |
Ga0070700_1011235292 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGITTTTAAGTARAL* |
Ga0070708_1010499242 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0070685_102648702 | 3300005466 | Switchgrass Rhizosphere | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSAGTARAF* |
Ga0070685_110168421 | 3300005466 | Switchgrass Rhizosphere | MQEGDALNAFTFPALALAGLLRRARLFVPVRLRRGIITTTAAGTARAF* |
Ga0077119_102084931 | 3300005519 | Arabidopsis Root | MQEGDALNALTFPALAVAGLLRRTRLVVPVRLLRGLITTTAAGTARAF* |
Ga0070679_1016312771 | 3300005530 | Corn Rhizosphere | MQEGDALNALAFPALALAGLLRRTRLFVPVRLRRGIITTT |
Ga0070693_1004063641 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTSAARTARAF* |
Ga0066704_109446631 | 3300005557 | Soil | GLSIRTALAMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGSARAF* |
Ga0070664_1008636932 | 3300005564 | Corn Rhizosphere | MQEGDALNALTFPALAFAALLRRTRLFVPVRLCRRFITTTAARTARAF* |
Ga0066705_105015582 | 3300005569 | Soil | MQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0074479_110663671 | 3300005829 | Sediment (Intertidal) | MQEGDALNALTFPALAVAGLLRRTRLFVPVRLWRGIITTTAAGTARAF* |
Ga0068851_103962171 | 3300005834 | Corn Rhizosphere | MQEGDALNALAFPALALAGLLRRTRLFVPVRLRRGIITTTSAGTARAF* |
Ga0068851_106185382 | 3300005834 | Corn Rhizosphere | MQEGDALNAFAVTGLALAVLLRARLLVPVRLRRGIITTAAAGTARAF* |
Ga0068858_1009543303 | 3300005842 | Switchgrass Rhizosphere | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTT |
Ga0068862_1025641081 | 3300005844 | Switchgrass Rhizosphere | MQEGDALNALAFPALALAGLLRRTRLFMPVRLRRGLITTTAPVTARAF* |
Ga0075028_1008906311 | 3300006050 | Watersheds | MQEGDALNAFALTGLALAALLPLARLLVPVRLRRGIITTAAAGTARAI* |
Ga0074053_119344591 | 3300006575 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGAARAF* |
Ga0074062_100269301 | 3300006606 | Soil | MQEGDALNAFALPALALAGLLRRTRLFVPVRLRRGIITTTAAGAARTF* |
Ga0066660_108551833 | 3300006800 | Soil | MQEGDALNALTFPALAFAGLMRRTRLFVPVRLRRGIITTTAAGSARAF* |
Ga0075433_103619133 | 3300006852 | Populus Rhizosphere | MQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTTAARRARAF* |
Ga0079219_120465491 | 3300006954 | Agricultural Soil | TVGLSIRTALAMQEGDALNALAFPALALAGLLRRTRLFMPVRLRRGIITTTAPVTARAF* |
Ga0066709_1021668062 | 3300009137 | Grasslands Soil | MQEGDALNALTFPALALAGLLCRARLFVPVRLRRGIITTTAAGTARAF* |
Ga0105243_117518281 | 3300009148 | Miscanthus Rhizosphere | TFPALAVAGLLRRTRLFVPVRLRRGLITTTAAGTARAF* |
Ga0105241_109984322 | 3300009174 | Corn Rhizosphere | MQEGDALNALAFPALALAGLLRRTRLFVPVRLLRGIITTTAPGTARAF* |
Ga0105340_14309512 | 3300009610 | Soil | MQEGDALNALAFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0105059_10090021 | 3300009795 | Groundwater Sand | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTSAAGTARAF* |
Ga0126313_111767681 | 3300009840 | Serpentine Soil | MQEGDALNALTFPALAFAGLLRRTRLFVPVRLRRGI |
Ga0126315_104062832 | 3300010038 | Serpentine Soil | MQEGDALNALTFPALALAGLLRRARLFVPVRLRRGIITTTAAGTARAF* |
Ga0126311_108115742 | 3300010045 | Serpentine Soil | MQEGDALNAFTFPALAFASLLRRTRLFVPVRLRRGIVTTTAAGTARAF* |
Ga0127449_11607132 | 3300010117 | Grasslands Soil | MQEGDALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0134067_104121362 | 3300010321 | Grasslands Soil | MQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTAAGSARAF* |
Ga0134086_102076452 | 3300010323 | Grasslands Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAA |
Ga0134080_105990051 | 3300010333 | Grasslands Soil | MQEGDALNALAVATLRRTRRLMQGRLRRGIITTTAAGTARAF |
Ga0134066_101884272 | 3300010364 | Grasslands Soil | MQEGYALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGSARAF* |
Ga0105239_135277871 | 3300010375 | Corn Rhizosphere | MQEGDALNAFALTGLALAALLRRARLLVPVRLRRGIITTATAGTARAF* |
Ga0134121_126817321 | 3300010401 | Terrestrial Soil | MQEGDALNPLTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0134123_119410022 | 3300010403 | Terrestrial Soil | MQEGDALNPLTFPALALAGLLRRTRLFVPVRLLRGIITTTAPGTARAF* |
Ga0126345_12931361 | 3300010858 | Boreal Forest Soil | MQEGDALNAFALTGLALAALLCRARLLVPVRLRRGIITTAAAGTARAF* |
Ga0126357_10747783 | 3300010864 | Boreal Forest Soil | MQEGDALNAFALTGLALAALLRRARLLVPVRLRRGIITTAAAGTARAF* |
Ga0138112_10280822 | 3300010905 | Grasslands Soil | MQEGDALNALTFPALALAGLLRRARLFVPVRLRRGIITTTAAGSARAF* |
Ga0150983_133641322 | 3300011120 | Forest Soil | MQEGNALNSLVLAPLRRTRRLTTVRLRRGIITTAAAAAARAF* |
Ga0137436_10390444 | 3300011423 | Soil | MQEGDALNPLTFPALALAGLLHRTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0137437_12937882 | 3300011442 | Soil | MQEGDALNALTFPALALTGLLRRTRLFVSVRLRRGIITT |
Ga0137431_11872112 | 3300012038 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVSVRLRRGIITTSAAGTARAF* |
Ga0137389_115273762 | 3300012096 | Vadose Zone Soil | MQEGDALNALAFAGLRRTRRILTVRLRRGIITTSAAVTARAF* |
Ga0137383_112395632 | 3300012199 | Vadose Zone Soil | MQEGDALNAFAFATLRRTWRLATVRLRRGIITTSAAGTA |
Ga0137381_116434671 | 3300012207 | Vadose Zone Soil | MQEGDALNALTFPALALAGLLCRTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0150985_1048755431 | 3300012212 | Avena Fatua Rhizosphere | MQEGDALNAFALTGLALATLLCRTRLLMPVRLRRGIITTAAAGTARAF* |
Ga0137366_107544472 | 3300012354 | Vadose Zone Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAPATARAF* |
Ga0134048_13129422 | 3300012400 | Grasslands Soil | MQEGDALNALTFPALAFAGLMRRTRLFVPVRLRNGIITTTAAGSARAF* |
Ga0157323_10365962 | 3300012495 | Arabidopsis Rhizosphere | MQEGDALNALTFPALALAGLLRRTRLFMPVRLRRGIITTTAAGTARAF* |
Ga0157350_10448452 | 3300012499 | Unplanted Soil | MQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITT |
Ga0157314_10264382 | 3300012500 | Arabidopsis Rhizosphere | MQEGDALNALTFPALALAGLLRRTRLLVPVRLRRGIITTSAAR |
Ga0157324_10398742 | 3300012506 | Arabidopsis Rhizosphere | MQEGDALNALTFPTLALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0157330_10559542 | 3300012514 | Soil | MQEGDALNALTFPALALAGLLRRTGLFVPVRLRRGIITTTSAGTARAF* |
Ga0157287_11202761 | 3300012885 | Soil | MQEGDALNALTFPALFHPLAVAGLLRRTRPFVPVRLRRGLITTTAAGTARAF* |
Ga0157284_100539022 | 3300012893 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGITTTTAAGTARAF* |
Ga0157293_101517212 | 3300012898 | Soil | MQEGDALNALTFPALFHPLAVAGLLRRTRPFVPVRLRRGIITTTAAGTARAF* |
Ga0157288_100954472 | 3300012901 | Soil | MQEGDALNALAFPALALAGLLRRTRPFVPVRLRRGIITTTAAGTARAF* |
Ga0157295_101285452 | 3300012906 | Soil | MQEGDALNALTFPALALAGLLRRARLFVPVRLRRGIITTTSAGTARAF* |
Ga0157290_102010271 | 3300012909 | Soil | MQEGDALNALTFPTLAVAGLLRRTRLFVPVRLRRGLITTTAAGTARAF* |
Ga0157308_101359222 | 3300012910 | Soil | MQEGDALNALAFPALALAGLLRRTRLCVPVRLRRGITTTTAAGTARAF* |
Ga0157301_102056281 | 3300012911 | Soil | MQEGDALNALTFPTLALAGLLRRTRLFVPVRLRRGIITTTSAGTA |
Ga0157306_100402254 | 3300012912 | Soil | MQEGDALNALTFPALAFAGLLRRARLFVPVRLRRGFITTSA |
Ga0164303_100093291 | 3300012957 | Soil | MQEGDALNALTFAALAFAGLLRRTRLFVPVRLRRGIITTTSAGTARAF* |
Ga0157307_11919211 | 3300013096 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAPGTARAF* |
Ga0157373_102729032 | 3300013100 | Corn Rhizosphere | MQEGDALNALPFPALALAGLLRLTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0134081_101697912 | 3300014150 | Grasslands Soil | MQEGDALNALTFPALAVAGLLRRARLFVPVRLRRGIITTTAAGTARAF* |
Ga0134079_101444622 | 3300014166 | Grasslands Soil | MQEGDALNALTFPALTLAGLLRRTRLFVPVRLRRGIITTTAAGTARAF* |
Ga0163163_129918871 | 3300014325 | Switchgrass Rhizosphere | MQEGEALNALTFPALAFASLLRRTRLFVPVRLRRGITTTTAAGTARAF* |
Ga0157380_110795881 | 3300014326 | Switchgrass Rhizosphere | MQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTAAAR |
Ga0167669_11159161 | 3300015024 | Glacier Forefield Soil | MQERDALNAFALTGLALATLLRRARLLVPVRLRRGIISTAATGTARAF* |
Ga0173483_105193131 | 3300015077 | Soil | MQEGDALNALAFPALALAGLLRRTRLFVPVRLRRGIITTTAPGTARAF* |
Ga0137418_102196393 | 3300015241 | Vadose Zone Soil | MQEGDALNAFTFPALAVAGLLRRTRLFVSVRLRRGIITTTAAGSARAF* |
Ga0182007_102661931 | 3300015262 | Rhizosphere | MQEGDALNALTFPALAVAGLLRRTRLVVPVRLLRGLITTTAPGTARAF* |
Ga0134073_104010871 | 3300015356 | Grasslands Soil | MQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTSAGTARAF* |
Ga0134089_102648041 | 3300015358 | Grasslands Soil | MQEGDALNALTFPALALAGLLRRPRLFVSVRLRRGIITTTAAGTARAF* |
Ga0163161_110669541 | 3300017792 | Switchgrass Rhizosphere | MQEGDALNALALAPLRRTRRLTTVRLRRDVITTAAAA |
Ga0190266_104765752 | 3300017965 | Soil | MQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTTAARTARAF |
Ga0184605_103546612 | 3300018027 | Groundwater Sediment | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARTF |
Ga0184608_100891993 | 3300018028 | Groundwater Sediment | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF |
Ga0184623_102927361 | 3300018056 | Groundwater Sediment | MQEGDALNTLTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF |
Ga0184617_10063761 | 3300018066 | Groundwater Sediment | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSAGTARAF |
Ga0184625_103189581 | 3300018081 | Groundwater Sediment | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGT |
Ga0066655_108563712 | 3300018431 | Grasslands Soil | MQEGDALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGSARAF |
Ga0190270_126517111 | 3300018469 | Soil | MQEGDALNALTFPARALAGLLRRTRLFVSVRLRRGIITTSSAGTARAF |
Ga0190271_100126752 | 3300018481 | Soil | MQEGDALNALTFPALALAGLLRRTRLLLPVRLRRGIITTTAARTARAF |
Ga0066669_116706591 | 3300018482 | Grasslands Soil | MQEGDALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGTARAF |
Ga0184645_13241782 | 3300019233 | Groundwater Sediment | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAVGTARTF |
Ga0180112_10071591 | 3300019238 | Groundwater Sediment | MQEGDALNALTFPALALTGLLRRTRLFVPVRLRRGIITTSAAGTARAF |
Ga0173482_104003361 | 3300019361 | Soil | MQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTSAGTARAF |
Ga0173479_107351541 | 3300019362 | Soil | MQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGLITTTAAGTARAF |
Ga0190267_114323431 | 3300019767 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRRRRGIITTTAARTARAF |
Ga0193703_10629691 | 3300019876 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGNITTSSAGTARAF |
Ga0210378_100810343 | 3300021073 | Groundwater Sediment | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGITTTTAAGTARAF |
Ga0182009_106808002 | 3300021445 | Soil | MQEGDALNALTFPALAVAGLLRRTRLVVPVRLLRGLITTTAAGTARAF |
Ga0213856_11174392 | 3300021947 | Watersheds | MQEGDALNTLTFPALAVAGLLRRTRLFVPVRLRRGIIT |
Ga0222624_14512932 | 3300021951 | Groundwater Sediment | MQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGITTTTAAGTARAF |
Ga0222625_10070121 | 3300022195 | Groundwater Sediment | MQEGDALNALTFPALALAGLLCRTRLFVPVRLRRGIITTTTAGTARAF |
Ga0242662_100490391 | 3300022533 | Soil | MQEGNALNSLVLAPLRRTRRLTTVRLRRGIITTAAAAAARAF |
Ga0222623_102410462 | 3300022694 | Groundwater Sediment | MQEGDALNALTFPALAFAGLLRRTRLFVPVRLRRGIITTTSAGTARAF |
Ga0247746_10741711 | 3300022886 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTSAARTARAF |
Ga0247793_10954542 | 3300023066 | Soil | MQEGDALNALAFPALALAGLLRRTRLFVPVRLLRGIITTTAPGTARAF |
Ga0247772_10098781 | 3300023264 | Plant Litter | MQEGDALNALTFPTLAVAGLLRRTRLFVPVRLRRGLITTTAAGTARAF |
Ga0233355_1036772 | 3300024037 | Soil | MQEGDALNALTFPALAFAGLLRRTRLFVPVRLRRGITTTTAAGTARAF |
Ga0209258_1205791 | 3300025242 | Arabidopsis Root | MQEGDALNALTFPALAVAGLLRRTRLVVPVRLLRGLI |
Ga0207682_100503754 | 3300025893 | Miscanthus Rhizosphere | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTAR |
Ga0207677_122461092 | 3300026023 | Miscanthus Rhizosphere | MQEGDALNAFTFPALALAGLLRRARLFVPVRLRRGIITTTSAGTARAF |
Ga0207703_118495102 | 3300026035 | Switchgrass Rhizosphere | MQEGDALNAFAVTGLALAVLLRARLLVPVRLRRGIITTAA |
Ga0209234_12902762 | 3300026295 | Grasslands Soil | MQEGDALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGSA |
Ga0209237_12287372 | 3300026297 | Grasslands Soil | MQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTAAG |
Ga0209239_10615061 | 3300026310 | Grasslands Soil | MQEGDALNALTFPALAVAGLLRWTRLFVPVRLRRAIITT |
Ga0209377_11072103 | 3300026334 | Soil | MQEGDALNALTFPALALAGLLCRTRLFVPVRLRRGIITTTAAGTARAF |
Ga0208890_10158873 | 3300027523 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSAGTAAVRRRTAGRDSAGAL |
Ga0209574_100454703 | 3300027809 | Agave | MQEGDALNALAFPALFHTLALAGLLRRTRLVVPVRLRRGLITTTPAG |
Ga0209023_106038581 | 3300027870 | Freshwater And Sediment | MQEGDALNAFGLTGLALAALLGRARLLVPVRLRRGIITTAAAGTARAF |
Ga0209814_101291181 | 3300027873 | Populus Rhizosphere | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTA |
Ga0209488_106029072 | 3300027903 | Vadose Zone Soil | MQEGDALNALAVATLHRTRRLMPGRLRRRIITTTTAVAAR |
Ga0268265_110811521 | 3300028380 | Switchgrass Rhizosphere | MQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGI |
Ga0247823_105771351 | 3300028590 | Soil | MQEGDALNALTFPALALAGLLRRTRLLVPVRLRRGIITTAAARTARAF |
Ga0247822_104443071 | 3300028592 | Soil | MQEGDALNALAFPALALAGLLRRTRLLVPVRLRRGIITTTSARTARAF |
Ga0307311_102390342 | 3300028716 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSAG |
Ga0307318_103199792 | 3300028744 | Soil | MQEGDALNALTFPALAFAGLLRRTRLFVPVRLRRGIITTTAAGTARAF |
Ga0307316_101993462 | 3300028755 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITT |
Ga0302208_101793232 | 3300028774 | Fen | MQEGDALNALALAGRLALAALLRRALLLLVPARLRRRIITTSAAGTARAF |
Ga0311332_104864521 | 3300029984 | Fen | MQEGDALNALTFPALALAGLLRRTRLFVPARLRRGIITTTSAGTARAF |
Ga0311336_112388191 | 3300029990 | Fen | MQEGDALNAFALACLALAALLRRARLLVPAWLRRGIITTAAAGTARAF |
Ga0268255_100793793 | 3300030516 | Agave | MQEGDALNALAVAGLALAALTRRTRPFMPVRLRRRIITTSA |
Ga0308202_10616011 | 3300030902 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTSTAGTARAF |
Ga0308189_102842281 | 3300031058 | Soil | MQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGIITTTAAGTARAF |
Ga0308184_10244321 | 3300031095 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTTAGTARAF |
Ga0307498_101124411 | 3300031170 | Soil | MQEGDALNTLTFPALAVAGLLRRTRLFVPVRLRRGI |
Ga0308186_10191341 | 3300031422 | Soil | MQEGDALNALTFPALALAGLLRRTRLLVPVRLRRGIITTTSAGTARAF |
Ga0311364_122392241 | 3300031521 | Fen | MQEGDALNALALAGRLALAALLRRALLLLVPARLRRGIITTSAAGTARAF |
Ga0307514_103359562 | 3300031649 | Ectomycorrhiza | MQEGDALNALTFPALALAGLLRRTRLVLPVRLRRGLTTTTSAG |
Ga0307473_114806141 | 3300031820 | Hardwood Forest Soil | MQEGDALNALAVATLRRTRRLMPGRLRRGIITTTAAG |
Ga0302322_1027515222 | 3300031902 | Fen | MQEGDALDAFALTGLALAALLRRARLLVPVRLRRGIITTAAAG |
Ga0315912_111943371 | 3300032157 | Soil | MQEGDALNALTFPALALAGLLRRTRLLVPVRLRRGIITTAAARSARAF |
Ga0310889_104106782 | 3300032179 | Soil | MQEGDALNALAFPALALAGLLRRTRLFMPVRLRRGIITTTAPVTARAF |
Ga0364935_0182447_457_603 | 3300034151 | Sediment | MQEGDALNALTFPALALAGLLRRTRLLLPVRLRRGIITTSAVRTARAF |
Ga0370502_0095267_217_363 | 3300034156 | Untreated Peat Soil | MQEGDALNALTFPALAVAGLLRRTRLVVPVRLRRGTLTTTSAGTARAF |
Ga0370513_034678_1131_1277 | 3300034161 | Untreated Peat Soil | MQEGDALNALALTGLALAALLRRARLLVPVRLRRSIITTSAAGTARAF |
Ga0370544_20650_2_148 | 3300034447 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVWLRRGIITTTSAGTARAF |
Ga0316598_136280_145_291 | 3300034652 | Untreated Peat Soil | MQEGDALNALTFPALALAGLLRRTRLVVPVRLRRGIITTTSAGTARAF |
Ga0314786_121598_423_569 | 3300034664 | Soil | MQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTAAARTARAF |
Ga0314788_044895_738_851 | 3300034666 | Soil | MQEGDALNALTFPALAFAALLRRTRLFVPVRLCRRFIT |
Ga0314795_066069_1_141 | 3300034670 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARA |
Ga0314801_122272_437_583 | 3300034676 | Soil | MQEGDALNALTFPALALAGLLRRTRLFIPVRRRRGIITTTAARTARAF |
Ga0370541_036371_484_609 | 3300034680 | Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSA |
Ga0373959_0149253_204_350 | 3300034820 | Rhizosphere Soil | MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGLITTTAAGTARAF |
⦗Top⦘ |