NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040609

Metagenome / Metatranscriptome Family F040609

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040609
Family Type Metagenome / Metatranscriptome
Number of Sequences 161
Average Sequence Length 46 residues
Representative Sequence MQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF
Number of Associated Samples 158
Number of Associated Scaffolds 161

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 98.05 %
% of genes near scaffold ends (potentially truncated) 24.22 %
% of genes from short scaffolds (< 2000 bps) 93.79 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (70.186 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.255 % of family members)
Environment Ontology (ENVO) Unclassified
(24.224 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.373 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 59.21%    β-sheet: 0.00%    Coil/Unstructured: 40.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 161 Family Scaffolds
PF01176eIF-1a 87.58
PF00313CSD 3.11
PF13400Tad 1.24
PF04116FA_hydroxylase 0.62
PF07811TadE 0.62
PF05853BKACE 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 161 Family Scaffolds
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 87.58
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.62
COG3246Uncharacterized conserved protein, DUF849 familyFunction unknown [S] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.65 %
UnclassifiedrootN/A4.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_9088202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1124Open in IMG/M
2170459016|G1P06HT02GBX3ZAll Organisms → cellular organisms → Bacteria583Open in IMG/M
2170459021|G14TP7Y02FPTYRAll Organisms → cellular organisms → Bacteria714Open in IMG/M
3300001991|JGI24743J22301_10060932All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum777Open in IMG/M
3300002074|JGI24748J21848_1011228All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum1055Open in IMG/M
3300005104|Ga0066818_1002811All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum1040Open in IMG/M
3300005172|Ga0066683_10501131All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum742Open in IMG/M
3300005335|Ga0070666_10548641All Organisms → cellular organisms → Eukaryota841Open in IMG/M
3300005339|Ga0070660_100631583All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum896Open in IMG/M
3300005441|Ga0070700_100578642All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum876Open in IMG/M
3300005441|Ga0070700_101123529All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005445|Ga0070708_101049924All Organisms → cellular organisms → Eukaryota763Open in IMG/M
3300005466|Ga0070685_10264870All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300005466|Ga0070685_11016842All Organisms → cellular organisms → Eukaryota622Open in IMG/M
3300005519|Ga0077119_10208493All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum841Open in IMG/M
3300005530|Ga0070679_101631277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus593Open in IMG/M
3300005547|Ga0070693_100406364All Organisms → cellular organisms → Eukaryota945Open in IMG/M
3300005557|Ga0066704_10944663All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005564|Ga0070664_100863693All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum847Open in IMG/M
3300005569|Ga0066705_10501558All Organisms → cellular organisms → Eukaryota760Open in IMG/M
3300005829|Ga0074479_11066367All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum570Open in IMG/M
3300005834|Ga0068851_10396217All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum811Open in IMG/M
3300005834|Ga0068851_10618538All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300005842|Ga0068858_100954330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae839Open in IMG/M
3300005844|Ga0068862_102564108All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300006050|Ga0075028_100890631All Organisms → cellular organisms → Eukaryota548Open in IMG/M
3300006575|Ga0074053_11934459All Organisms → cellular organisms → Eukaryota946Open in IMG/M
3300006606|Ga0074062_10026930All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum849Open in IMG/M
3300006800|Ga0066660_10855183All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum741Open in IMG/M
3300006852|Ga0075433_10361913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1281Open in IMG/M
3300006954|Ga0079219_12046549All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300009137|Ga0066709_102166806All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum767Open in IMG/M
3300009148|Ga0105243_11751828All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300009174|Ga0105241_10998432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus783Open in IMG/M
3300009610|Ga0105340_1430951All Organisms → cellular organisms → Eukaryota588Open in IMG/M
3300009795|Ga0105059_1009002All Organisms → cellular organisms → Eukaryota943Open in IMG/M
3300009840|Ga0126313_11176768All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum631Open in IMG/M
3300010038|Ga0126315_10406283All Organisms → cellular organisms → Eukaryota857Open in IMG/M
3300010045|Ga0126311_10811574All Organisms → cellular organisms → Eukaryota755Open in IMG/M
3300010117|Ga0127449_1160713All Organisms → cellular organisms → Eukaryota565Open in IMG/M
3300010321|Ga0134067_10412136All Organisms → cellular organisms → Eukaryota544Open in IMG/M
3300010323|Ga0134086_10207645All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum734Open in IMG/M
3300010333|Ga0134080_10599005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum536Open in IMG/M
3300010364|Ga0134066_10188427All Organisms → cellular organisms → Eukaryota676Open in IMG/M
3300010375|Ga0105239_13527787All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300010401|Ga0134121_12681732All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300010403|Ga0134123_11941002All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300010858|Ga0126345_1293136All Organisms → cellular organisms → Eukaryota729Open in IMG/M
3300010864|Ga0126357_1074778All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300010905|Ga0138112_1028082All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum569Open in IMG/M
3300011423|Ga0137436_1039044All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum1200Open in IMG/M
3300011442|Ga0137437_1293788All Organisms → cellular organisms → Eukaryota555Open in IMG/M
3300012038|Ga0137431_1187211All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300012096|Ga0137389_11527376All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300012207|Ga0137381_11643467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum533Open in IMG/M
3300012212|Ga0150985_104875543All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum570Open in IMG/M
3300012354|Ga0137366_10754447All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum692Open in IMG/M
3300012400|Ga0134048_1312942All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum630Open in IMG/M
3300012495|Ga0157323_1036596All Organisms → cellular organisms → Eukaryota545Open in IMG/M
3300012499|Ga0157350_1044845All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum542Open in IMG/M
3300012500|Ga0157314_1026438All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum626Open in IMG/M
3300012506|Ga0157324_1039874All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum570Open in IMG/M
3300012514|Ga0157330_1055954All Organisms → cellular organisms → Eukaryota573Open in IMG/M
3300012885|Ga0157287_1120276All Organisms → cellular organisms → Eukaryota510Open in IMG/M
3300012893|Ga0157284_10053902All Organisms → cellular organisms → Eukaryota927Open in IMG/M
3300012898|Ga0157293_10151721All Organisms → cellular organisms → Eukaryota655Open in IMG/M
3300012901|Ga0157288_10095447All Organisms → cellular organisms → Eukaryota797Open in IMG/M
3300012906|Ga0157295_10128545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria732Open in IMG/M
3300012909|Ga0157290_10201027All Organisms → cellular organisms → Eukaryota677Open in IMG/M
3300012910|Ga0157308_10135922All Organisms → cellular organisms → Eukaryota768Open in IMG/M
3300012911|Ga0157301_10205628All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum666Open in IMG/M
3300012912|Ga0157306_10040225All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum1123Open in IMG/M
3300012957|Ga0164303_10009329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3337Open in IMG/M
3300013096|Ga0157307_1191921All Organisms → cellular organisms → Eukaryota501Open in IMG/M
3300013100|Ga0157373_10272903All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300014150|Ga0134081_10169791All Organisms → cellular organisms → Eukaryota726Open in IMG/M
3300014166|Ga0134079_10144462All Organisms → cellular organisms → Eukaryota954Open in IMG/M
3300014325|Ga0163163_12991887All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum527Open in IMG/M
3300014326|Ga0157380_11079588All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum841Open in IMG/M
3300015024|Ga0167669_1115916All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum803Open in IMG/M
3300015077|Ga0173483_10519313All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum639Open in IMG/M
3300015241|Ga0137418_10219639All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300015262|Ga0182007_10266193All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum619Open in IMG/M
3300015356|Ga0134073_10401087All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum517Open in IMG/M
3300015358|Ga0134089_10264804All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum706Open in IMG/M
3300017965|Ga0190266_10476575All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum719Open in IMG/M
3300018027|Ga0184605_10354661All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum662Open in IMG/M
3300018028|Ga0184608_10089199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1274Open in IMG/M
3300018056|Ga0184623_10292736All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum737Open in IMG/M
3300018066|Ga0184617_1006376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2168Open in IMG/M
3300018081|Ga0184625_10318958All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum810Open in IMG/M
3300018431|Ga0066655_10856371All Organisms → cellular organisms → Eukaryota620Open in IMG/M
3300018469|Ga0190270_12651711All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300018481|Ga0190271_10012675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6114Open in IMG/M
3300018482|Ga0066669_11670659All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum584Open in IMG/M
3300019233|Ga0184645_1324178All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum522Open in IMG/M
3300019238|Ga0180112_1007159All Organisms → cellular organisms → Eukaryota557Open in IMG/M
3300019361|Ga0173482_10400336All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum638Open in IMG/M
3300019362|Ga0173479_10735154All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum537Open in IMG/M
3300019767|Ga0190267_11432343All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300019876|Ga0193703_1062969All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum556Open in IMG/M
3300021073|Ga0210378_10081034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1271Open in IMG/M
3300021445|Ga0182009_10680800All Organisms → cellular organisms → Eukaryota556Open in IMG/M
3300021947|Ga0213856_1117439All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum546Open in IMG/M
3300021951|Ga0222624_1451293All Organisms → cellular organisms → Eukaryota569Open in IMG/M
3300022195|Ga0222625_1007012All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum593Open in IMG/M
3300022694|Ga0222623_10241046All Organisms → cellular organisms → Eukaryota698Open in IMG/M
3300022886|Ga0247746_1074171All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum808Open in IMG/M
3300023066|Ga0247793_1095454All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum518Open in IMG/M
3300023264|Ga0247772_1009878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1769Open in IMG/M
3300024037|Ga0233355_103677All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum506Open in IMG/M
3300025242|Ga0209258_120579All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum689Open in IMG/M
3300025893|Ga0207682_10050375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1721Open in IMG/M
3300026023|Ga0207677_12246109All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300026035|Ga0207703_11849510All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum580Open in IMG/M
3300026295|Ga0209234_1290276All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum525Open in IMG/M
3300026297|Ga0209237_1228737All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum576Open in IMG/M
3300026310|Ga0209239_1061506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1664Open in IMG/M
3300026334|Ga0209377_1107210All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum1148Open in IMG/M
3300027523|Ga0208890_1015887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1047Open in IMG/M
3300027809|Ga0209574_10045470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1101Open in IMG/M
3300027870|Ga0209023_10603858All Organisms → cellular organisms → Eukaryota644Open in IMG/M
3300027873|Ga0209814_10129118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1079Open in IMG/M
3300028380|Ga0268265_11081152All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum795Open in IMG/M
3300028590|Ga0247823_10577135All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum847Open in IMG/M
3300028592|Ga0247822_10444307All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300028716|Ga0307311_10239034All Organisms → cellular organisms → Eukaryota538Open in IMG/M
3300028744|Ga0307318_10319979All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300028755|Ga0307316_10199346All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum721Open in IMG/M
3300028774|Ga0302208_10179323All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum522Open in IMG/M
3300029984|Ga0311332_10486452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae967Open in IMG/M
3300029990|Ga0311336_11238819All Organisms → cellular organisms → Eukaryota652Open in IMG/M
3300030516|Ga0268255_10079379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1008Open in IMG/M
3300030902|Ga0308202_1061601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum710Open in IMG/M
3300031058|Ga0308189_10284228All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum640Open in IMG/M
3300031095|Ga0308184_1024432All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum670Open in IMG/M
3300031170|Ga0307498_10112441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae855Open in IMG/M
3300031422|Ga0308186_1019134All Organisms → cellular organisms → Eukaryota651Open in IMG/M
3300031521|Ga0311364_12239224All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031649|Ga0307514_10335956All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum817Open in IMG/M
3300031902|Ga0302322_102751522All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum606Open in IMG/M
3300032157|Ga0315912_11194337All Organisms → cellular organisms → Eukaryota603Open in IMG/M
3300032179|Ga0310889_10410678All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum674Open in IMG/M
3300034151|Ga0364935_0182447All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum672Open in IMG/M
3300034156|Ga0370502_0095267All Organisms → cellular organisms → Eukaryota946Open in IMG/M
3300034161|Ga0370513_034678All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum1380Open in IMG/M
3300034447|Ga0370544_20650All Organisms → cellular organisms → Eukaryota535Open in IMG/M
3300034652|Ga0316598_136280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum688Open in IMG/M
3300034664|Ga0314786_121598All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum584Open in IMG/M
3300034666|Ga0314788_044895All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum852Open in IMG/M
3300034670|Ga0314795_066069All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum670Open in IMG/M
3300034676|Ga0314801_122272All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum605Open in IMG/M
3300034680|Ga0370541_036371All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum609Open in IMG/M
3300034820|Ga0373959_0149253All Organisms → cellular organisms → Bacteria590Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.25%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.73%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.11%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.11%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.11%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.48%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.86%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.24%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.24%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.24%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.24%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.24%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.24%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.24%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.24%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter1.24%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.24%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.62%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.62%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.62%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.62%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.62%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.62%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.62%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.62%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.62%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.62%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.62%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.62%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.62%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Arabidopsis RootHost-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root0.62%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.62%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.62%
Arabidopsis RootHost-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
2170459021Litter degradation NP4EngineeredOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005104Soil and rhizosphere microbial communities from Laval, Canada - mgHACEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005519Combined assembly of arab plate scrape CL_Col (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009795Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010864Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010905Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300012499Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610EnvironmentalOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015024Arctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021947Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023264Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6EnvironmentalOpen in IMG/M
3300024037Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-Q75EnvironmentalOpen in IMG/M
3300025242Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027870Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028774Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030516Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031095Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031422Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M
3300034156Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18EnvironmentalOpen in IMG/M
3300034161Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_18EnvironmentalOpen in IMG/M
3300034447Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034652Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034666Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034670Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034680Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_007889502088090015SoilMQEGDALNALTFPALAFAALLRRTRLFVPVRLCRRFITTTAARTARAF
2ZMR_053810602170459016Switchgrass, Maize And Mischanthus LitterMQEGDALNALALTGLALAALLRRALLLLVPARLRRGITTTSATGTARAF
4NP_005846602170459021Switchgrass, Maize And Mischanthus LitterMQEGDALNALALAGLLALAALLRRALLLLVPARLRRGIITTSAAGTARAF
JGI24743J22301_1006093213300001991Corn, Switchgrass And Miscanthus RhizosphereMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTXAGTARAF*
JGI24748J21848_101122833300002074Corn, Switchgrass And Miscanthus RhizosphereMQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTTAARTARAF*
JGI25404J52841_1001086153300003659Tabebuia Heterophylla RhizosphereMQEGDALNAFALADLRLTRRLMPVRLRRGIITTTAAASAR
Ga0066818_100281123300005104SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITPTSAGTARAF*
Ga0066683_1050113123300005172SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGSARAF*
Ga0070666_1054864123300005335Switchgrass RhizosphereMQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGITTTTAAGTARAF*
Ga0070660_10063158313300005339Corn RhizosphereMQEGYALNAFALTGLALATLLCRARLLVPVRLRRGIITTATAGTARAF*
Ga0070700_10057864223300005441Corn, Switchgrass And Miscanthus RhizosphereMQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTAAARTARAF*
Ga0070700_10112352923300005441Corn, Switchgrass And Miscanthus RhizosphereMQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGITTTTAAGTARAL*
Ga0070708_10104992423300005445Corn, Switchgrass And Miscanthus RhizosphereMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF*
Ga0070685_1026487023300005466Switchgrass RhizosphereMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSAGTARAF*
Ga0070685_1101684213300005466Switchgrass RhizosphereMQEGDALNAFTFPALALAGLLRRARLFVPVRLRRGIITTTAAGTARAF*
Ga0077119_1020849313300005519Arabidopsis RootMQEGDALNALTFPALAVAGLLRRTRLVVPVRLLRGLITTTAAGTARAF*
Ga0070679_10163127713300005530Corn RhizosphereMQEGDALNALAFPALALAGLLRRTRLFVPVRLRRGIITTT
Ga0070693_10040636413300005547Corn, Switchgrass And Miscanthus RhizosphereMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTSAARTARAF*
Ga0066704_1094466313300005557SoilGLSIRTALAMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGSARAF*
Ga0070664_10086369323300005564Corn RhizosphereMQEGDALNALTFPALAFAALLRRTRLFVPVRLCRRFITTTAARTARAF*
Ga0066705_1050155823300005569SoilMQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTAAGTARAF*
Ga0074479_1106636713300005829Sediment (Intertidal)MQEGDALNALTFPALAVAGLLRRTRLFVPVRLWRGIITTTAAGTARAF*
Ga0068851_1039621713300005834Corn RhizosphereMQEGDALNALAFPALALAGLLRRTRLFVPVRLRRGIITTTSAGTARAF*
Ga0068851_1061853823300005834Corn RhizosphereMQEGDALNAFAVTGLALAVLLRARLLVPVRLRRGIITTAAAGTARAF*
Ga0068858_10095433033300005842Switchgrass RhizosphereMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTT
Ga0068862_10256410813300005844Switchgrass RhizosphereMQEGDALNALAFPALALAGLLRRTRLFMPVRLRRGLITTTAPVTARAF*
Ga0075028_10089063113300006050WatershedsMQEGDALNAFALTGLALAALLPLARLLVPVRLRRGIITTAAAGTARAI*
Ga0074053_1193445913300006575SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGAARAF*
Ga0074062_1002693013300006606SoilMQEGDALNAFALPALALAGLLRRTRLFVPVRLRRGIITTTAAGAARTF*
Ga0066660_1085518333300006800SoilMQEGDALNALTFPALAFAGLMRRTRLFVPVRLRRGIITTTAAGSARAF*
Ga0075433_1036191333300006852Populus RhizosphereMQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTTAARRARAF*
Ga0079219_1204654913300006954Agricultural SoilTVGLSIRTALAMQEGDALNALAFPALALAGLLRRTRLFMPVRLRRGIITTTAPVTARAF*
Ga0066709_10216680623300009137Grasslands SoilMQEGDALNALTFPALALAGLLCRARLFVPVRLRRGIITTTAAGTARAF*
Ga0105243_1175182813300009148Miscanthus RhizosphereTFPALAVAGLLRRTRLFVPVRLRRGLITTTAAGTARAF*
Ga0105241_1099843223300009174Corn RhizosphereMQEGDALNALAFPALALAGLLRRTRLFVPVRLLRGIITTTAPGTARAF*
Ga0105340_143095123300009610SoilMQEGDALNALAFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF*
Ga0105059_100900213300009795Groundwater SandMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTSAAGTARAF*
Ga0126313_1117676813300009840Serpentine SoilMQEGDALNALTFPALAFAGLLRRTRLFVPVRLRRGI
Ga0126315_1040628323300010038Serpentine SoilMQEGDALNALTFPALALAGLLRRARLFVPVRLRRGIITTTAAGTARAF*
Ga0126311_1081157423300010045Serpentine SoilMQEGDALNAFTFPALAFASLLRRTRLFVPVRLRRGIVTTTAAGTARAF*
Ga0127449_116071323300010117Grasslands SoilMQEGDALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGTARAF*
Ga0134067_1041213623300010321Grasslands SoilMQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTAAGSARAF*
Ga0134086_1020764523300010323Grasslands SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAA
Ga0134080_1059900513300010333Grasslands SoilMQEGDALNALAVATLRRTRRLMQGRLRRGIITTTAAGTARAF
Ga0134066_1018842723300010364Grasslands SoilMQEGYALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGSARAF*
Ga0105239_1352778713300010375Corn RhizosphereMQEGDALNAFALTGLALAALLRRARLLVPVRLRRGIITTATAGTARAF*
Ga0134121_1268173213300010401Terrestrial SoilMQEGDALNPLTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF*
Ga0134123_1194100223300010403Terrestrial SoilMQEGDALNPLTFPALALAGLLRRTRLFVPVRLLRGIITTTAPGTARAF*
Ga0126345_129313613300010858Boreal Forest SoilMQEGDALNAFALTGLALAALLCRARLLVPVRLRRGIITTAAAGTARAF*
Ga0126357_107477833300010864Boreal Forest SoilMQEGDALNAFALTGLALAALLRRARLLVPVRLRRGIITTAAAGTARAF*
Ga0138112_102808223300010905Grasslands SoilMQEGDALNALTFPALALAGLLRRARLFVPVRLRRGIITTTAAGSARAF*
Ga0150983_1336413223300011120Forest SoilMQEGNALNSLVLAPLRRTRRLTTVRLRRGIITTAAAAAARAF*
Ga0137436_103904443300011423SoilMQEGDALNPLTFPALALAGLLHRTRLFVPVRLRRGIITTTAAGTARAF*
Ga0137437_129378823300011442SoilMQEGDALNALTFPALALTGLLRRTRLFVSVRLRRGIITT
Ga0137431_118721123300012038SoilMQEGDALNALTFPALALAGLLRRTRLFVSVRLRRGIITTSAAGTARAF*
Ga0137389_1152737623300012096Vadose Zone SoilMQEGDALNALAFAGLRRTRRILTVRLRRGIITTSAAVTARAF*
Ga0137383_1123956323300012199Vadose Zone SoilMQEGDALNAFAFATLRRTWRLATVRLRRGIITTSAAGTA
Ga0137381_1164346713300012207Vadose Zone SoilMQEGDALNALTFPALALAGLLCRTRLFVPVRLRRGIITTTAAGTARAF*
Ga0150985_10487554313300012212Avena Fatua RhizosphereMQEGDALNAFALTGLALATLLCRTRLLMPVRLRRGIITTAAAGTARAF*
Ga0137366_1075444723300012354Vadose Zone SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAPATARAF*
Ga0134048_131294223300012400Grasslands SoilMQEGDALNALTFPALAFAGLMRRTRLFVPVRLRNGIITTTAAGSARAF*
Ga0157323_103659623300012495Arabidopsis RhizosphereMQEGDALNALTFPALALAGLLRRTRLFMPVRLRRGIITTTAAGTARAF*
Ga0157350_104484523300012499Unplanted SoilMQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITT
Ga0157314_102643823300012500Arabidopsis RhizosphereMQEGDALNALTFPALALAGLLRRTRLLVPVRLRRGIITTSAAR
Ga0157324_103987423300012506Arabidopsis RhizosphereMQEGDALNALTFPTLALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF*
Ga0157330_105595423300012514SoilMQEGDALNALTFPALALAGLLRRTGLFVPVRLRRGIITTTSAGTARAF*
Ga0157287_112027613300012885SoilMQEGDALNALTFPALFHPLAVAGLLRRTRPFVPVRLRRGLITTTAAGTARAF*
Ga0157284_1005390223300012893SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGITTTTAAGTARAF*
Ga0157293_1015172123300012898SoilMQEGDALNALTFPALFHPLAVAGLLRRTRPFVPVRLRRGIITTTAAGTARAF*
Ga0157288_1009544723300012901SoilMQEGDALNALAFPALALAGLLRRTRPFVPVRLRRGIITTTAAGTARAF*
Ga0157295_1012854523300012906SoilMQEGDALNALTFPALALAGLLRRARLFVPVRLRRGIITTTSAGTARAF*
Ga0157290_1020102713300012909SoilMQEGDALNALTFPTLAVAGLLRRTRLFVPVRLRRGLITTTAAGTARAF*
Ga0157308_1013592223300012910SoilMQEGDALNALAFPALALAGLLRRTRLCVPVRLRRGITTTTAAGTARAF*
Ga0157301_1020562813300012911SoilMQEGDALNALTFPTLALAGLLRRTRLFVPVRLRRGIITTTSAGTA
Ga0157306_1004022543300012912SoilMQEGDALNALTFPALAFAGLLRRARLFVPVRLRRGFITTSA
Ga0164303_1000932913300012957SoilMQEGDALNALTFAALAFAGLLRRTRLFVPVRLRRGIITTTSAGTARAF*
Ga0157307_119192113300013096SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAPGTARAF*
Ga0157373_1027290323300013100Corn RhizosphereMQEGDALNALPFPALALAGLLRLTRLFVPVRLRRGIITTTAAGTARAF*
Ga0134081_1016979123300014150Grasslands SoilMQEGDALNALTFPALAVAGLLRRARLFVPVRLRRGIITTTAAGTARAF*
Ga0134079_1014446223300014166Grasslands SoilMQEGDALNALTFPALTLAGLLRRTRLFVPVRLRRGIITTTAAGTARAF*
Ga0163163_1299188713300014325Switchgrass RhizosphereMQEGEALNALTFPALAFASLLRRTRLFVPVRLRRGITTTTAAGTARAF*
Ga0157380_1107958813300014326Switchgrass RhizosphereMQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTAAAR
Ga0167669_111591613300015024Glacier Forefield SoilMQERDALNAFALTGLALATLLRRARLLVPVRLRRGIISTAATGTARAF*
Ga0173483_1051931313300015077SoilMQEGDALNALAFPALALAGLLRRTRLFVPVRLRRGIITTTAPGTARAF*
Ga0137418_1021963933300015241Vadose Zone SoilMQEGDALNAFTFPALAVAGLLRRTRLFVSVRLRRGIITTTAAGSARAF*
Ga0182007_1026619313300015262RhizosphereMQEGDALNALTFPALAVAGLLRRTRLVVPVRLLRGLITTTAPGTARAF*
Ga0134073_1040108713300015356Grasslands SoilMQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTSAGTARAF*
Ga0134089_1026480413300015358Grasslands SoilMQEGDALNALTFPALALAGLLRRPRLFVSVRLRRGIITTTAAGTARAF*
Ga0163161_1106695413300017792Switchgrass RhizosphereMQEGDALNALALAPLRRTRRLTTVRLRRDVITTAAAA
Ga0190266_1047657523300017965SoilMQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTTAARTARAF
Ga0184605_1035466123300018027Groundwater SedimentMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARTF
Ga0184608_1008919933300018028Groundwater SedimentMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF
Ga0184623_1029273613300018056Groundwater SedimentMQEGDALNTLTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARAF
Ga0184617_100637613300018066Groundwater SedimentMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSAGTARAF
Ga0184625_1031895813300018081Groundwater SedimentMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGT
Ga0066655_1085637123300018431Grasslands SoilMQEGDALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGSARAF
Ga0190270_1265171113300018469SoilMQEGDALNALTFPARALAGLLRRTRLFVSVRLRRGIITTSSAGTARAF
Ga0190271_1001267523300018481SoilMQEGDALNALTFPALALAGLLRRTRLLLPVRLRRGIITTTAARTARAF
Ga0066669_1167065913300018482Grasslands SoilMQEGDALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGTARAF
Ga0184645_132417823300019233Groundwater SedimentMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAVGTARTF
Ga0180112_100715913300019238Groundwater SedimentMQEGDALNALTFPALALTGLLRRTRLFVPVRLRRGIITTSAAGTARAF
Ga0173482_1040033613300019361SoilMQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTSAGTARAF
Ga0173479_1073515413300019362SoilMQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGLITTTAAGTARAF
Ga0190267_1143234313300019767SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRRRRGIITTTAARTARAF
Ga0193703_106296913300019876SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGNITTSSAGTARAF
Ga0210378_1008103433300021073Groundwater SedimentMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGITTTTAAGTARAF
Ga0182009_1068080023300021445SoilMQEGDALNALTFPALAVAGLLRRTRLVVPVRLLRGLITTTAAGTARAF
Ga0213856_111743923300021947WatershedsMQEGDALNTLTFPALAVAGLLRRTRLFVPVRLRRGIIT
Ga0222624_145129323300021951Groundwater SedimentMQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGITTTTAAGTARAF
Ga0222625_100701213300022195Groundwater SedimentMQEGDALNALTFPALALAGLLCRTRLFVPVRLRRGIITTTTAGTARAF
Ga0242662_1004903913300022533SoilMQEGNALNSLVLAPLRRTRRLTTVRLRRGIITTAAAAAARAF
Ga0222623_1024104623300022694Groundwater SedimentMQEGDALNALTFPALAFAGLLRRTRLFVPVRLRRGIITTTSAGTARAF
Ga0247746_107417113300022886SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTSAARTARAF
Ga0247793_109545423300023066SoilMQEGDALNALAFPALALAGLLRRTRLFVPVRLLRGIITTTAPGTARAF
Ga0247772_100987813300023264Plant LitterMQEGDALNALTFPTLAVAGLLRRTRLFVPVRLRRGLITTTAAGTARAF
Ga0233355_10367723300024037SoilMQEGDALNALTFPALAFAGLLRRTRLFVPVRLRRGITTTTAAGTARAF
Ga0209258_12057913300025242Arabidopsis RootMQEGDALNALTFPALAVAGLLRRTRLVVPVRLLRGLI
Ga0207682_1005037543300025893Miscanthus RhizosphereMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTAR
Ga0207677_1224610923300026023Miscanthus RhizosphereMQEGDALNAFTFPALALAGLLRRARLFVPVRLRRGIITTTSAGTARAF
Ga0207703_1184951023300026035Switchgrass RhizosphereMQEGDALNAFAVTGLALAVLLRARLLVPVRLRRGIITTAA
Ga0209234_129027623300026295Grasslands SoilMQEGDALNALTFPALAVAGLMRRTRLFVPVRLRRGIITTTAAGSA
Ga0209237_122873723300026297Grasslands SoilMQEGDALNALTFPALAVAGLLRRTRLFVPVRLRRGIITTTAAG
Ga0209239_106150613300026310Grasslands SoilMQEGDALNALTFPALAVAGLLRWTRLFVPVRLRRAIITT
Ga0209377_110721033300026334SoilMQEGDALNALTFPALALAGLLCRTRLFVPVRLRRGIITTTAAGTARAF
Ga0208890_101588733300027523SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSAGTAAVRRRTAGRDSAGAL
Ga0209574_1004547033300027809AgaveMQEGDALNALAFPALFHTLALAGLLRRTRLVVPVRLRRGLITTTPAG
Ga0209023_1060385813300027870Freshwater And SedimentMQEGDALNAFGLTGLALAALLGRARLLVPVRLRRGIITTAAAGTARAF
Ga0209814_1012911813300027873Populus RhizosphereMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTA
Ga0209488_1060290723300027903Vadose Zone SoilMQEGDALNALAVATLHRTRRLMPGRLRRRIITTTTAVAAR
Ga0268265_1108115213300028380Switchgrass RhizosphereMQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGI
Ga0247823_1057713513300028590SoilMQEGDALNALTFPALALAGLLRRTRLLVPVRLRRGIITTAAARTARAF
Ga0247822_1044430713300028592SoilMQEGDALNALAFPALALAGLLRRTRLLVPVRLRRGIITTTSARTARAF
Ga0307311_1023903423300028716SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSAG
Ga0307318_1031997923300028744SoilMQEGDALNALTFPALAFAGLLRRTRLFVPVRLRRGIITTTAAGTARAF
Ga0307316_1019934623300028755SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITT
Ga0302208_1017932323300028774FenMQEGDALNALALAGRLALAALLRRALLLLVPARLRRRIITTSAAGTARAF
Ga0311332_1048645213300029984FenMQEGDALNALTFPALALAGLLRRTRLFVPARLRRGIITTTSAGTARAF
Ga0311336_1123881913300029990FenMQEGDALNAFALACLALAALLRRARLLVPAWLRRGIITTAAAGTARAF
Ga0268255_1007937933300030516AgaveMQEGDALNALAVAGLALAALTRRTRPFMPVRLRRRIITTSA
Ga0308202_106160113300030902SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTSTAGTARAF
Ga0308189_1028422813300031058SoilMQEGDALNALTFPALAFASLLRRTRLFVPVRLRRGIITTTAAGTARAF
Ga0308184_102443213300031095SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTTAGTARAF
Ga0307498_1011244113300031170SoilMQEGDALNTLTFPALAVAGLLRRTRLFVPVRLRRGI
Ga0308186_101913413300031422SoilMQEGDALNALTFPALALAGLLRRTRLLVPVRLRRGIITTTSAGTARAF
Ga0311364_1223922413300031521FenMQEGDALNALALAGRLALAALLRRALLLLVPARLRRGIITTSAAGTARAF
Ga0307514_1033595623300031649EctomycorrhizaMQEGDALNALTFPALALAGLLRRTRLVLPVRLRRGLTTTTSAG
Ga0307473_1148061413300031820Hardwood Forest SoilMQEGDALNALAVATLRRTRRLMPGRLRRGIITTTAAG
Ga0302322_10275152223300031902FenMQEGDALDAFALTGLALAALLRRARLLVPVRLRRGIITTAAAG
Ga0315912_1119433713300032157SoilMQEGDALNALTFPALALAGLLRRTRLLVPVRLRRGIITTAAARSARAF
Ga0310889_1041067823300032179SoilMQEGDALNALAFPALALAGLLRRTRLFMPVRLRRGIITTTAPVTARAF
Ga0364935_0182447_457_6033300034151SedimentMQEGDALNALTFPALALAGLLRRTRLLLPVRLRRGIITTSAVRTARAF
Ga0370502_0095267_217_3633300034156Untreated Peat SoilMQEGDALNALTFPALAVAGLLRRTRLVVPVRLRRGTLTTTSAGTARAF
Ga0370513_034678_1131_12773300034161Untreated Peat SoilMQEGDALNALALTGLALAALLRRARLLVPVRLRRSIITTSAAGTARAF
Ga0370544_20650_2_1483300034447SoilMQEGDALNALTFPALALAGLLRRTRLFVPVWLRRGIITTTSAGTARAF
Ga0316598_136280_145_2913300034652Untreated Peat SoilMQEGDALNALTFPALALAGLLRRTRLVVPVRLRRGIITTTSAGTARAF
Ga0314786_121598_423_5693300034664SoilMQEGDALNPLTFPALALAGLLRRTRLFVPVRRRRGIITTAAARTARAF
Ga0314788_044895_738_8513300034666SoilMQEGDALNALTFPALAFAALLRRTRLFVPVRLCRRFIT
Ga0314795_066069_1_1413300034670SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTAAGTARA
Ga0314801_122272_437_5833300034676SoilMQEGDALNALTFPALALAGLLRRTRLFIPVRRRRGIITTTAARTARAF
Ga0370541_036371_484_6093300034680SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGIITTTSA
Ga0373959_0149253_204_3503300034820Rhizosphere SoilMQEGDALNALTFPALALAGLLRRTRLFVPVRLRRGLITTTAAGTARAF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.