Metagenome / Metatranscriptome Family F040480

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F040480
Family Type	Metagenome / Metatranscriptome
Number of Sequences	161
Average Sequence Length	38 residues
Representative Sequence	METGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE
Number of Associated Samples	94
Number of Associated Scaffolds	161

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	55.28 %
% of genes from short scaffolds (< 2000 bps)	81.99 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (34.783 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (29.192 % of family members)
Environment Ontology (ENVO)	Unclassified (49.689 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (49.689 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 161 Family Scaffolds
PF00565	SNase	12.42
PF01764	Lipase_3	3.73
PF13529	Peptidase_C39_2	2.48
PF00959	Phage_lysozyme	2.48
PF07068	Gp23	1.24
PF00124	Photo_RC	0.62
PF01755	Glyco_transf_25	0.62
PF06841	Phage_T4_gp19	0.62
PF03797	Autotransporter	0.62
PF08534	Redoxin	0.62
PF03237	Terminase_6N	0.62
PF13640	2OG-FeII_Oxy_3	0.62
PF02867	Ribonuc_red_lgC	0.62
PF08406	CbbQ_C	0.62
PF00462	Glutaredoxin	0.62

COG ID	Name	Functional Category	% Frequency in 161 Family Scaffolds
COG0209	Ribonucleotide reductase alpha subunit	Nucleotide transport and metabolism [F]	0.62
COG0714	MoxR-like ATPase	General function prediction only [R]	0.62
COG3306	Glycosyltransferase involved in LPS biosynthesis, GR25 family	Cell wall/membrane/envelope biogenesis [M]	0.62

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	65.22 %
Unclassified	root	N/A	34.78 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	63.98 %
Unclassified	root	N/A	34.78 %
cellular organisms	root	All Organisms → cellular organisms	1.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.78 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	29.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.09 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.78 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	29.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.09 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.62 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.78 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	29.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.09 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.62 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.78 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	29.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.09 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.62 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.09 %
Kyanoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae	13.66 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	12.42 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	0.62 %
Pseudoalteromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.09 %
unclassified Kyanoviridae	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae	12.42 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	2.48 %
Pseudoalteromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas	0.62 %
Prochlorococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.09 %
Synechococcus phage S-SRM01	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	12.42 %
Nodensvirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus	0.62 %
Pseudoalteromonas fuliginea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → Pseudoalteromonas fuliginea	0.62 %
unclassified Myoviridae	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae	0.62 %
Prochlorococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.09 %
Synechococcus phage S-SRM01	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	12.42 %
Synechococcus virus SPM2	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2	0.62 %
Synechococcus phage S-CBM2	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2	0.62 %
Pseudoalteromonas fuliginea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → Pseudoalteromonas fuliginea	0.62 %
Prochlorococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	26.09 %
Synechococcus phage S-SRM01	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	12.42 %
Synechococcus phage S-PM2	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 → Synechococcus phage S-PM2	0.62 %
Synechococcus phage S-CBM2	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2	0.62 %
Pseudoalteromonas fuliginea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → Pseudoalteromonas fuliginea	0.62 %
Prochlorococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae	0.62 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001255\|B570J13889_100787	Not Available	772	Open in IMG/M
3300001843\|RCM34_1018959	Not Available	515	Open in IMG/M
3300001847\|RCM41_1009970	All Organisms → Viruses → Predicted Viral	1650	Open in IMG/M
3300001848\|RCM47_1074255	All Organisms → Viruses → Predicted Viral	1240	Open in IMG/M
3300001968\|GOS2236_1093264	All Organisms → Viruses → Predicted Viral	3007	Open in IMG/M
3300002144\|M2t2BS2_10567370	Not Available	897	Open in IMG/M
3300005527\|Ga0068876_10023438	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3885	Open in IMG/M
3300005581\|Ga0049081_10281401	Not Available	577	Open in IMG/M
3300005805\|Ga0079957_1006380	Not Available	9436	Open in IMG/M
3300005805\|Ga0079957_1019098	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae	4846	Open in IMG/M
3300005805\|Ga0079957_1039405	All Organisms → Viruses → Predicted Viral	3016	Open in IMG/M
3300007539\|Ga0099849_1138836	Not Available	946	Open in IMG/M
3300007541\|Ga0099848_1045128	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2	1792	Open in IMG/M
3300007541\|Ga0099848_1115030	All Organisms → Viruses → Predicted Viral	1021	Open in IMG/M
3300007541\|Ga0099848_1218090	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	678	Open in IMG/M
3300007541\|Ga0099848_1263127	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	600	Open in IMG/M
3300007542\|Ga0099846_1133914	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	899	Open in IMG/M
3300007625\|Ga0102870_1119631	Not Available	763	Open in IMG/M
3300007960\|Ga0099850_1056224	All Organisms → Viruses → Predicted Viral	1671	Open in IMG/M
3300007960\|Ga0099850_1085650	All Organisms → Viruses → Predicted Viral	1312	Open in IMG/M
3300007960\|Ga0099850_1204275	All Organisms → Viruses	776	Open in IMG/M
3300007960\|Ga0099850_1225051	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae	730	Open in IMG/M
3300008055\|Ga0108970_10473864	All Organisms → Viruses	6603	Open in IMG/M
3300008107\|Ga0114340_1140871	All Organisms → Viruses → Predicted Viral	1426	Open in IMG/M
3300008113\|Ga0114346_1078003	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2043	Open in IMG/M
3300008262\|Ga0114337_1220235	Not Available	754	Open in IMG/M
3300008448\|Ga0114876_1003868	Not Available	9941	Open in IMG/M
3300008448\|Ga0114876_1118382	All Organisms → Viruses → Predicted Viral	1020	Open in IMG/M
3300009160\|Ga0114981_10045632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → Pseudoalteromonas fuliginea	2468	Open in IMG/M
3300009183\|Ga0114974_10502326	Not Available	680	Open in IMG/M
3300010299\|Ga0129342_1042421	All Organisms → Viruses → Predicted Viral	1805	Open in IMG/M
3300010299\|Ga0129342_1088453	Not Available	1171	Open in IMG/M
3300010299\|Ga0129342_1099457	All Organisms → Viruses → Predicted Viral	1092	Open in IMG/M
3300010354\|Ga0129333_10021786	All Organisms → Viruses	6085	Open in IMG/M
3300010354\|Ga0129333_10075124	Not Available	3139	Open in IMG/M
3300010354\|Ga0129333_10179486	All Organisms → Viruses → Predicted Viral	1933	Open in IMG/M
3300010354\|Ga0129333_10187763	All Organisms → Viruses → Predicted Viral	1884	Open in IMG/M
3300010354\|Ga0129333_10293262	All Organisms → Viruses → Predicted Viral	1457	Open in IMG/M
3300010354\|Ga0129333_10335272	Not Available	1348	Open in IMG/M
3300010354\|Ga0129333_10364827	All Organisms → Viruses → Predicted Viral	1283	Open in IMG/M
3300010354\|Ga0129333_10436215	All Organisms → Viruses → Predicted Viral	1155	Open in IMG/M
3300010354\|Ga0129333_10482903	Not Available	1088	Open in IMG/M
3300010354\|Ga0129333_10537792	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	1020	Open in IMG/M
3300010354\|Ga0129333_10889916	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	754	Open in IMG/M
3300010354\|Ga0129333_10906607	Not Available	745	Open in IMG/M
3300010354\|Ga0129333_10945684	Not Available	727	Open in IMG/M
3300010354\|Ga0129333_10991368	Not Available	706	Open in IMG/M
3300010354\|Ga0129333_11673100	Not Available	518	Open in IMG/M
3300010370\|Ga0129336_10127329	All Organisms → Viruses → Predicted Viral	1482	Open in IMG/M
3300010370\|Ga0129336_10176499	Not Available	1225	Open in IMG/M
3300010370\|Ga0129336_10267885	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	956	Open in IMG/M
3300010370\|Ga0129336_10592719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	592	Open in IMG/M
3300010370\|Ga0129336_10651455	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	560	Open in IMG/M
3300011268\|Ga0151620_1006371	All Organisms → Viruses → Predicted Viral	4328	Open in IMG/M
3300012967\|Ga0129343_1455795	Not Available	829	Open in IMG/M
3300012968\|Ga0129337_1145789	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	796	Open in IMG/M
3300012970\|Ga0129338_1501772	All Organisms → Viruses	690	Open in IMG/M
3300013087\|Ga0163212_1106167	Not Available	901	Open in IMG/M
3300013087\|Ga0163212_1201990	All Organisms → Viruses	622	Open in IMG/M
3300013087\|Ga0163212_1260090	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	538	Open in IMG/M
(restricted) 3300013125\|Ga0172369_10231673	All Organisms → Viruses → Predicted Viral	1029	Open in IMG/M
(restricted) 3300013128\|Ga0172366_10309789	Not Available	979	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10705346	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	635	Open in IMG/M
3300017761\|Ga0181356_1092850	Not Available	991	Open in IMG/M
3300017777\|Ga0181357_1080813	All Organisms → Viruses → Predicted Viral	1243	Open in IMG/M
3300020074\|Ga0194113_10284482	All Organisms → Viruses → Predicted Viral	1263	Open in IMG/M
3300020074\|Ga0194113_10600250	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	776	Open in IMG/M
3300020074\|Ga0194113_10731545	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	683	Open in IMG/M
3300020083\|Ga0194111_10338651	All Organisms → Viruses → Predicted Viral	1018	Open in IMG/M
3300020083\|Ga0194111_10359850	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	977	Open in IMG/M
3300020084\|Ga0194110_10011265	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	9857	Open in IMG/M
3300020084\|Ga0194110_10321930	All Organisms → Viruses → Predicted Viral	1081	Open in IMG/M
3300020084\|Ga0194110_10565205	Not Available	728	Open in IMG/M
3300020109\|Ga0194112_10013922	All Organisms → Viruses	9663	Open in IMG/M
3300020109\|Ga0194112_10348055	All Organisms → Viruses → Predicted Viral	1096	Open in IMG/M
3300020109\|Ga0194112_10443051	Not Available	926	Open in IMG/M
3300020161\|Ga0211726_10097556	Not Available	1445	Open in IMG/M
3300020161\|Ga0211726_10397593	Not Available	504	Open in IMG/M
3300020172\|Ga0211729_10621773	Not Available	1036	Open in IMG/M
3300020179\|Ga0194134_10001207	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	35862	Open in IMG/M
3300020179\|Ga0194134_10161588	All Organisms → Viruses	1003	Open in IMG/M
3300020179\|Ga0194134_10290063	Not Available	650	Open in IMG/M
3300020183\|Ga0194115_10044902	All Organisms → Viruses → Predicted Viral	2870	Open in IMG/M
3300020183\|Ga0194115_10068892	All Organisms → Viruses → Predicted Viral	2111	Open in IMG/M
3300020183\|Ga0194115_10120747	All Organisms → Viruses → Predicted Viral	1419	Open in IMG/M
3300020183\|Ga0194115_10160223	All Organisms → Viruses → Predicted Viral	1159	Open in IMG/M
3300020183\|Ga0194115_10437472	Not Available	551	Open in IMG/M
3300020190\|Ga0194118_10121233	All Organisms → Viruses → Predicted Viral	1574	Open in IMG/M
3300020190\|Ga0194118_10322471	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	815	Open in IMG/M
3300020190\|Ga0194118_10438701	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	647	Open in IMG/M
3300020193\|Ga0194131_10450991	Not Available	575	Open in IMG/M
3300020197\|Ga0194128_10237893	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	947	Open in IMG/M
3300020197\|Ga0194128_10380607	Not Available	677	Open in IMG/M
3300020198\|Ga0194120_10255649	Not Available	913	Open in IMG/M
3300020200\|Ga0194121_10258908	Not Available	904	Open in IMG/M
3300020204\|Ga0194116_10001242	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	37523	Open in IMG/M
3300020204\|Ga0194116_10068545	All Organisms → Viruses	2398	Open in IMG/M
3300020205\|Ga0211731_11056388	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	623	Open in IMG/M
3300020214\|Ga0194132_10217896	All Organisms → Viruses → Predicted Viral	1065	Open in IMG/M
3300020214\|Ga0194132_10341574	Not Available	781	Open in IMG/M
3300020221\|Ga0194127_10271382	Not Available	1157	Open in IMG/M
3300020578\|Ga0194129_10619545	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	502	Open in IMG/M
3300020603\|Ga0194126_10005855	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	17876	Open in IMG/M
3300021091\|Ga0194133_10221552	All Organisms → Viruses → Predicted Viral	1235	Open in IMG/M
3300021092\|Ga0194122_10440661	Not Available	654	Open in IMG/M
3300021093\|Ga0194123_10162208	All Organisms → Viruses → Predicted Viral	1189	Open in IMG/M
3300021093\|Ga0194123_10217098	Not Available	965	Open in IMG/M
3300021376\|Ga0194130_10198228	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	1188	Open in IMG/M
3300021376\|Ga0194130_10378711	Not Available	758	Open in IMG/M
3300021376\|Ga0194130_10606847	Not Available	542	Open in IMG/M
3300021424\|Ga0194117_10059684	All Organisms → Viruses → Predicted Viral	2162	Open in IMG/M
3300021424\|Ga0194117_10229562	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	902	Open in IMG/M
3300021424\|Ga0194117_10475576	Not Available	561	Open in IMG/M
3300021424\|Ga0194117_10500501	Not Available	542	Open in IMG/M
3300021959\|Ga0222716_10181852	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1346	Open in IMG/M
3300021960\|Ga0222715_10167004	All Organisms → Viruses → Predicted Viral	1348	Open in IMG/M
3300021961\|Ga0222714_10008091	Not Available	9469	Open in IMG/M
3300021961\|Ga0222714_10008156	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	9408	Open in IMG/M
3300021961\|Ga0222714_10106467	All Organisms → Viruses → Predicted Viral	1762	Open in IMG/M
3300021961\|Ga0222714_10243268	All Organisms → Viruses → Predicted Viral	1013	Open in IMG/M
3300021961\|Ga0222714_10400825	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	724	Open in IMG/M
3300021962\|Ga0222713_10161849	All Organisms → Viruses → Predicted Viral	1532	Open in IMG/M
3300021962\|Ga0222713_10782295	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae	534	Open in IMG/M
3300021962\|Ga0222713_10806717	Not Available	523	Open in IMG/M
3300021963\|Ga0222712_10000153	All Organisms → Viruses	97015	Open in IMG/M
3300022198\|Ga0196905_1184930	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	526	Open in IMG/M
3300022200\|Ga0196901_1136591	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	827	Open in IMG/M
3300022200\|Ga0196901_1166463	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	725	Open in IMG/M
3300022221\|Ga0224506_10430687	Not Available	579	Open in IMG/M
3300022223\|Ga0224501_10279608	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	869	Open in IMG/M
3300024239\|Ga0247724_1025960	All Organisms → Viruses	851	Open in IMG/M
3300024343\|Ga0244777_10436860	Not Available	811	Open in IMG/M
3300024351\|Ga0255141_1036677	Not Available	732	Open in IMG/M
3300027123\|Ga0255090_1050843	Not Available	620	Open in IMG/M
3300027155\|Ga0255081_1084154	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	615	Open in IMG/M
3300027747\|Ga0209189_1121472	All Organisms → Viruses → Predicted Viral	1145	Open in IMG/M
3300027782\|Ga0209500_10262523	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	748	Open in IMG/M
3300027797\|Ga0209107_10490832	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 → Synechococcus phage S-PM2	547	Open in IMG/M
3300027816\|Ga0209990_10006487	Not Available	7738	Open in IMG/M
3300029930\|Ga0119944_1018744	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	957	Open in IMG/M
3300029930\|Ga0119944_1036334	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	620	Open in IMG/M
3300029930\|Ga0119944_1041740	All Organisms → Viruses	566	Open in IMG/M
3300031539\|Ga0307380_10689049	Not Available	863	Open in IMG/M
3300031707\|Ga0315291_11347349	Not Available	572	Open in IMG/M
3300031758\|Ga0315907_10246489	Not Available	1483	Open in IMG/M
3300031784\|Ga0315899_10228624	All Organisms → Viruses	1864	Open in IMG/M
3300031857\|Ga0315909_10819076	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	586	Open in IMG/M
3300032050\|Ga0315906_10010692	All Organisms → Viruses	10754	Open in IMG/M
3300032116\|Ga0315903_10572701	Not Available	874	Open in IMG/M
3300033233\|Ga0334722_10386419	All Organisms → Viruses → Predicted Viral	1012	Open in IMG/M
3300033978\|Ga0334977_0586862	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	500	Open in IMG/M
3300033994\|Ga0334996_0016460	All Organisms → Viruses → Predicted Viral	4827	Open in IMG/M
3300033994\|Ga0334996_0078652	Not Available	1969	Open in IMG/M
3300034101\|Ga0335027_0074722	All Organisms → Viruses → Predicted Viral	2654	Open in IMG/M
3300034102\|Ga0335029_0118340	All Organisms → Viruses → Predicted Viral	1849	Open in IMG/M
3300034106\|Ga0335036_0831061	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	531	Open in IMG/M
3300034112\|Ga0335066_0069106	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2300	Open in IMG/M
3300034112\|Ga0335066_0650804	Not Available	538	Open in IMG/M
3300034116\|Ga0335068_0305398	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	791	Open in IMG/M
3300034272\|Ga0335049_0591585	Not Available	690	Open in IMG/M
3300034374\|Ga0348335_131198	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	722	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.38%
Host-Associated	Host-Associated	0.62%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.14%
Terrestrial	Environmental → Terrestrial	1.24%
Plants	Host-Associated → Plants	0.62%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	62.73%
Marine	Environmental → Aquatic → Marine	34.78%
Unclassified	Environmental → Aquatic → Unclassified	0.62%
Soil	Environmental → Terrestrial → Soil	0.62%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.62%
Leaf	Host-Associated → Plants → Leaf	0.62%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	49.07%
Coastal	Environmental → Aquatic → Marine → Coastal	24.84%
Unclassified	Environmental → Aquatic → Marine → Unclassified	6.83%
Lentic	Environmental → Aquatic → Freshwater → Lentic	4.35%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	3.11%
Lotic	Environmental → Aquatic → Freshwater → Lotic	2.48%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	1.86%
River	Environmental → Aquatic → Freshwater → River	1.86%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.86%
Sediment	Environmental → Aquatic → Marine → Sediment	1.24%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.62%
Clay	Environmental → Terrestrial → Soil → Clay	0.62%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.62%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	47.21%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	24.84%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	6.83%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	3.11%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	3.11%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	2.48%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.86%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	1.86%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.86%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.24%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	1.24%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.62%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.62%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.62%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.62%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.62%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.62%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	29.19%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	14.29%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	10.56%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	9.32%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	6.83%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	3.11%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	2.48%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.48%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.48%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.86%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.86%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.86%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	1.86%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	1.86%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.86%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.24%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	1.24%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.62%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.62%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.62%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.62%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.62%
Marine	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine	0.62%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.62%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.62%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.62%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001255	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion	Environmental	Open in IMG/M
3300001843	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b	Environmental	Open in IMG/M
3300001847	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a	Environmental	Open in IMG/M
3300001848	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a	Environmental	Open in IMG/M
3300001968	Marine microbial communities from Lake Gatun, Panama - GS020	Environmental	Open in IMG/M
3300002144	Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300007539	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG	Environmental	Open in IMG/M
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental	Open in IMG/M
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental	Open in IMG/M
3300007625	Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02	Environmental	Open in IMG/M
3300007960	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008262	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300010299	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300011268	Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555	Environmental	Open in IMG/M
3300012967	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012968	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012970	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013087	Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L	Environmental	Open in IMG/M
3300013125 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m	Environmental	Open in IMG/M
3300013128 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm	Environmental	Open in IMG/M
3300013137 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020083	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m	Environmental	Open in IMG/M
3300020084	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m	Environmental	Open in IMG/M
3300020109	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020179	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m	Environmental	Open in IMG/M
3300020183	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface	Environmental	Open in IMG/M
3300020190	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface	Environmental	Open in IMG/M
3300020193	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m	Environmental	Open in IMG/M
3300020197	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m	Environmental	Open in IMG/M
3300020198	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m	Environmental	Open in IMG/M
3300020200	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m	Environmental	Open in IMG/M
3300020204	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020214	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m	Environmental	Open in IMG/M
3300020221	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m	Environmental	Open in IMG/M
3300020578	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m	Environmental	Open in IMG/M
3300020603	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m	Environmental	Open in IMG/M
3300021091	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m	Environmental	Open in IMG/M
3300021092	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m	Environmental	Open in IMG/M
3300021093	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface	Environmental	Open in IMG/M
3300021376	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface	Environmental	Open in IMG/M
3300021424	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface	Environmental	Open in IMG/M
3300021959	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D	Environmental	Open in IMG/M
3300021960	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022198	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)	Environmental	Open in IMG/M
3300022200	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)	Environmental	Open in IMG/M
3300022221	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1	Environmental	Open in IMG/M
3300022223	Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1	Environmental	Open in IMG/M
3300024239	Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300024351	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h	Environmental	Open in IMG/M
3300027123	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d	Environmental	Open in IMG/M
3300027155	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h	Environmental	Open in IMG/M
3300027747	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300029930	Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031707	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental	Open in IMG/M
3300034374	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J13889_1007872	3300001255	Freshwater	EHIKAYVKTGDDWHLSQAETLRKYVKDLKVWIHHQEGRE*
RCM34_10189591	3300001843	Marine Plankton	NYVKTGDEWHLSQAEILRNYVKDLKVWIHKQEGWWNE*
RCM41_10099705	3300001847	Marine Plankton	MKTGDYWHEEQAQLLRKYVKDLKVWIHKEEGWWNE*
RCM47_10742552	3300001848	Marine Plankton	MSTSRHYVKTGDEWHLSQAEILRNYVKDLKVWIHKQEGRE*
GOS2236_10932643	3300001968	Marine	METGDHWHEEQAQILRKYIKDLKVWIHKEEGWWNE*
M2t2BS2_105673701	3300002144	Marine	DEHIRQHLKTGDEWHLSQAEILRTYVKDLKVWIHKKEGRE*
Ga0068876_100234386	3300005527	Freshwater Lake	METGDFWHEEQAQILRKYVKDLKIWIHKQEGVWDE*
Ga0049081_102814011	3300005581	Freshwater Lentic	RLHLETGNFWHEEQAQILRKYVKDLKIFIHKEEGWND*
Ga0079957_100638010	3300005805	Lake	METGDFWHEEQAQILRKYVKDLKIWIHKQEGWWDE*
Ga0079957_10190981	3300005805	Lake	IDNHTRLWMETGDYWHEDQANILRNYLRNLKNWIHEEEKK*
Ga0079957_10394052	3300005805	Lake	MKTGDVWHEEQAELLRNYVKDLKVWIHKQEEWWDE*
Ga0099849_11388361	3300007539	Aqueous	METGDSWHEEQAQILRKYIKDLKVWIHKEEGWWNE*
Ga0099848_10451282	3300007541	Aqueous	MLWFETGDEWHLEQQKILRNYVKELKVWIHKQEGCWDE*
Ga0099848_11150301	3300007541	Aqueous	EHVSLYLSTGDVWHLEQAAVLRCYVADLKTWIHGQEGKT*
Ga0099848_12180902	3300007541	Aqueous	METGDSWHEEQAEILRKYVKDLKVWIHKQEGWWNE*
Ga0099848_12631271	3300007541	Aqueous	IDNHTRLFMETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE*
Ga0099846_11339141	3300007542	Aqueous	NHTRLYFETGDFWHMEQADILRKYVKDLKVWIHKEEGWWDE*
Ga0102870_11196312	3300007625	Estuarine	METGDIWHEEQAQILRKYVKDLKVWIHKEEGWWNE*
Ga0099850_10562242	3300007960	Aqueous	MKTGDFWHEEQAQMLRKYIKDLKVWIHKEEGWWDE*
Ga0099850_10856502	3300007960	Aqueous	METGDFWHMEQADILRKYVKDLKVWIHKEEGWWNE*
Ga0099850_12042751	3300007960	Aqueous	IDNHTMLWFETGDEWHLEQQQILRKYVKDLKVWIHKQEGCWDE*
Ga0099850_12250511	3300007960	Aqueous	HTRIGMQTGDPWHEEQAEILRKYVKDLKVWIHKEEGWWGE*
Ga0108970_104738649	3300008055	Estuary	METGDIWHEEQAQILRKYVKDLKVWIHKQEGWWNE*
Ga0114340_11408711	3300008107	Freshwater, Plankton	ETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE*
Ga0114346_10780033	3300008113	Freshwater, Plankton	MPREWKETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE*
Ga0114337_12202352	3300008262	Freshwater, Plankton	ETGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE*
Ga0114876_100386812	3300008448	Freshwater Lake	METGDFWHEEQAQILRKYVKDLKVFIHKQEGWWDE*
Ga0114876_11183823	3300008448	Freshwater Lake	METGDYWHEEQAQILRKYVKDLKVWIHKEEGVWDE*
Ga0114981_100456321	3300009160	Freshwater Lake	HTRLHLETGDFWHEEQAQILRKYVKDLKVFIHKEEGRE*
Ga0114974_105023263	3300009183	Freshwater Lake	DNHTRLHLETGDFWHEEQAQILRKYVKDLKVFIHKEEEWNE*
Ga0129342_10424214	3300010299	Freshwater To Marine Saline Gradient	METGDLWHEEQAQMLRKYIKDLKVWIHKEEGWWDE*
Ga0129342_10884533	3300010299	Freshwater To Marine Saline Gradient	METGDYWHEEQAQILREYVKNLKIWIHKEEGWWDE*
Ga0129342_10994571	3300010299	Freshwater To Marine Saline Gradient	ETGDFWHEEQAEILRKYVKDLKVWIHKQEGWWDE*
Ga0129333_100217865	3300010354	Freshwater To Marine Saline Gradient	METGDIWHEEQAQILRKYVRDLKVWIHKEEGWWNE*
Ga0129333_100751247	3300010354	Freshwater To Marine Saline Gradient	METGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE*
Ga0129333_101794862	3300010354	Freshwater To Marine Saline Gradient	METGDFWHEEQAQILRNYVKDLKVWIHKQEGWWDE*
Ga0129333_101877632	3300010354	Freshwater To Marine Saline Gradient	MSTGDYWHEEQAEILRKYVKGLKVWIHKEEGWWDE*
Ga0129333_102932625	3300010354	Freshwater To Marine Saline Gradient	METGDFWHEEQAQILRKYVKDLKVWIHKQEGVWNE*
Ga0129333_103352721	3300010354	Freshwater To Marine Saline Gradient	NHTRLHMETGDFWHEQQAQILRNYVKDLKVWIHKQEGWWDE*
Ga0129333_103648271	3300010354	Freshwater To Marine Saline Gradient	AYVKTGDDWHLSQAEILRKYVKDLKVWIHKQEGKE*
Ga0129333_104362151	3300010354	Freshwater To Marine Saline Gradient	TRIWMDTGDYWHEQQAQILRKYVMDLKIWIHKEEGWWDE*
Ga0129333_104829032	3300010354	Freshwater To Marine Saline Gradient	MMWFETGDEWHLQQQEILRKYVKDLKVWIHKQEGCWDE*
Ga0129333_105377924	3300010354	Freshwater To Marine Saline Gradient	METGDFWHEEQAQILRKYVKDLKVFIHKQEGWWNE*
Ga0129333_108899163	3300010354	Freshwater To Marine Saline Gradient	MQTGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE*
Ga0129333_109066071	3300010354	Freshwater To Marine Saline Gradient	LHMETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWDE*
Ga0129333_109456841	3300010354	Freshwater To Marine Saline Gradient	ETGDFWHEEQAQILRKYVKDLKIWIHKEEGWWNE*
Ga0129333_109913681	3300010354	Freshwater To Marine Saline Gradient	METGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE*
Ga0129333_116731001	3300010354	Freshwater To Marine Saline Gradient	NHTRLKMETGDEWHEEQAQILRKYVKDLKVWIHKEEGWWNE*
Ga0129336_101273292	3300010370	Freshwater To Marine Saline Gradient	METGDFWHEQQAQILRKYVKDLKVWIHKEEGWWDE*
Ga0129336_101764992	3300010370	Freshwater To Marine Saline Gradient	MLWVETGDEWHLQQQEILRKYVKDLKVWIHKQEGCWNE*
Ga0129336_102678851	3300010370	Freshwater To Marine Saline Gradient	EHIKAYVKTGDDWHLSQAEILRKYVKDLKVWIHKKEGWWDE*
Ga0129336_105927191	3300010370	Freshwater To Marine Saline Gradient	IDNHTRLHMETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWDE*
Ga0129336_106514554	3300010370	Freshwater To Marine Saline Gradient	METGDFWHEEQANILRKYVKDLKVWIHKQEGWWDE*
Ga0151620_10063719	3300011268	Freshwater	DNHTRLHMETGDFWHEEQAQILRKYVKDLKIWIHRQEGWWDE*
Ga0129343_14557952	3300012967	Aqueous	METGDFWHMEQADILRKYVKDLKVWIHKEEGWWDE*
Ga0129337_11457893	3300012968	Aqueous	METGDFWHEQQAQILRKYVKDLKVWIHKQEGWWDE*
Ga0129338_15017721	3300012970	Aqueous	KKCLDAVDEHIKAYIKTGDEWHLSQAEILRKYVKDLKVWIHKEEGW*
Ga0163212_11061672	3300013087	Freshwater	FYMKTGDTWHEEQAQILRKYVKDLKTWIHKQEGWWNE*
Ga0163212_12019901	3300013087	Freshwater	IDHHTRFYMKTGDTWHEEQAQILRKYVKDLKTWIHKQEGW*
Ga0163212_12600902	3300013087	Freshwater	MKTGDTWHEEQAQILRKYVKDLKIWIHKQEGWWNE*
(restricted) Ga0172369_102316732	3300013125	Freshwater	METGDTWHEEQAQILRKYVKDLKIWIHKEEGWWNE*
(restricted) Ga0172366_103097893	3300013128	Sediment	METGDFWHEEQAQILRKYVKDLKIWIHKEEGWWNE*
(restricted) Ga0172375_107053464	3300013137	Freshwater	MKTGDPWHEEQAQILRKYVKDLKIWIHKEEGWWNE*
Ga0181356_10928501	3300017761	Freshwater Lake	AIDNHTRLHLETGNFWHEEQAQILRTYVKELKVFIHEEERGQ
Ga0181357_10808131	3300017777	Freshwater Lake	QILKAIDNHTRLHLETGNFWHEEQAQILRTYVLGLKVFIHKEEGWND
Ga0194113_102844822	3300020074	Freshwater Lake	METGDFWHEEQAQILRKYVKDLKIWIHKQEGWWNE
Ga0194113_106002502	3300020074	Freshwater Lake	AIDHHTRLYMETGDFWHEEQAQILRKYVKDLKTWIHKQEGW
Ga0194113_107315452	3300020074	Freshwater Lake	METGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE
Ga0194111_103386511	3300020083	Freshwater Lake	RLYLETGDPWHEEQAQILRKYIKDLKIWIHKEEGWWNE
Ga0194111_103598502	3300020083	Freshwater Lake	METGDFWHEEQAQILRKYVKDLKIWIHKEEGWWNE
Ga0194110_100112651	3300020084	Freshwater Lake	IDHHTRFYMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE
Ga0194110_103219301	3300020084	Freshwater Lake	LETGDTWHEEQAQILRKYIKDLKIWIHKEEGWWNE
Ga0194110_105652054	3300020084	Freshwater Lake	AIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKVWIHKKEGWWNE
Ga0194112_100139221	3300020109	Freshwater Lake	HTRFYMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE
Ga0194112_103480552	3300020109	Freshwater Lake	MKTGDPWHEEQAQILRKYVKDLKIWIHKEEGWWNE
Ga0194112_104430511	3300020109	Freshwater Lake	TRFYMKTGDPWHEEQAQILRKYIKDLKIWIHKEEGWWNE
Ga0211726_100975564	3300020161	Freshwater	METGDYWHEEQAQMLREYVRDLKVWIHKQEGWWNE
Ga0211726_103975932	3300020161	Freshwater	LFMETGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE
Ga0211729_106217732	3300020172	Freshwater	METGDIWHEEQAQMLRKYVKDLKVWIHKEEGWWNE
Ga0194134_100012071	3300020179	Freshwater Lake	RFYMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE
Ga0194134_101615881	3300020179	Freshwater Lake	DNHTRLYLETGDIWHEEQAQILRKYIKDLKIWIHKEEGWWNE
Ga0194134_102900631	3300020179	Freshwater Lake	LKAIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKVWIHKKEGWWNE
Ga0194115_100449026	3300020183	Freshwater Lake	MKTGDTWHEEQAQILRKYVKDLKVWIHKQEGWWNE
Ga0194115_100688926	3300020183	Freshwater Lake	MKTGDFWHEEQAQILRKYVKDLKTWIHKEEGWWNE
Ga0194115_101207473	3300020183	Freshwater Lake	MKTGDPWHEEQAQILRKYVKDLKVWIHKQEGWWNE
Ga0194115_101602232	3300020183	Freshwater Lake	METGDPWHEEQAQILRKYIKDLKIWIHKEEGWWNE
Ga0194115_104374721	3300020183	Freshwater Lake	TRLYMETGDFWHEEQAQILRKYVKDLKIWIHKEEGWWNE
Ga0194118_101212334	3300020190	Freshwater Lake	METGDFWHEEQAQILRKYIKDLKVWIHKEEGWWNE
Ga0194118_103224712	3300020190	Freshwater Lake	AIDHHTRLYMETGDFWHEEQAQILRKYVKDLKTWIHKQEGWWNK
Ga0194118_104387012	3300020190	Freshwater Lake	MKTGDTWHEEQAQILRKYVKDLKTWIHKQEGWWNE
Ga0194131_104509911	3300020193	Freshwater Lake	HHTRFYMKTGDTWHEEQAQILRKYIKDLKIWIHKEEGWWNE
Ga0194128_102378931	3300020197	Freshwater Lake	KAIDHHTRLYLETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWDETTRR
Ga0194128_103806072	3300020197	Freshwater Lake	METGDFWHEEQAQILRKYVKDLKTWIHKQEGWWNE
Ga0194120_102556492	3300020198	Freshwater Lake	METGDFWHEEQAQILRKYVKDLKTWIHKQEGWWNK
Ga0194121_102589082	3300020200	Freshwater Lake	RLYLETGDFWHEEQAQILRKYVKDLKVWIHKEEGW
Ga0194116_100012421	3300020204	Freshwater Lake	YMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE
Ga0194116_100685452	3300020204	Freshwater Lake	MKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE
Ga0211731_110563882	3300020205	Freshwater	DNHTRLFMETGDFWHEEQAQILRKYVKDLKVWIHKEEGWWKE
Ga0194132_102178961	3300020214	Freshwater Lake	VDHHTRLYMETGDFWHEEQAQILRKYIKDLKVWIHKEEGWWNE
Ga0194132_103415744	3300020214	Freshwater Lake	LYLETGDTWHEEQAQILRKYVKDLKIWIHKKEGWKL
Ga0194127_102713821	3300020221	Freshwater Lake	HTRLYLETGDIWHEEQAQILRKYIKDLKIWIHKEEGWWNE
Ga0194129_106195452	3300020578	Freshwater Lake	METGDTWHEEQAQILRKYIKDLKIWIHKQEGWWNE
Ga0194126_100058551	3300020603	Freshwater Lake	TRFYMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE
Ga0194133_102215521	3300021091	Freshwater Lake	IHQILKAIDHHTRLWIETGDFWHEEQAQILRKYIKDLKIWIHKEEGW
Ga0194122_104406611	3300021092	Freshwater Lake	KILKAIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKVWIHKKEGWWNE
Ga0194123_101622084	3300021093	Freshwater Lake	AIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKVWIHKQEGW
Ga0194123_102170983	3300021093	Freshwater Lake	AIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKTWIHKQEGWWNE
Ga0194130_101982282	3300021376	Freshwater Lake	METGDFWHEEQAQILRKYIKDLKIWIHKQEGWWNE
Ga0194130_103787112	3300021376	Freshwater Lake	AIDHHTRLYMETGDFWHEEQAQILRKYVKDLKVWIHKQEGW
Ga0194130_106068471	3300021376	Freshwater Lake	AIDHHTRFYMKTGDTWHEEQAQILRKYVKDLKTWIHKQEGW
Ga0194117_100596847	3300021424	Freshwater Lake	RFYMKTGDPWHEEQAQILRKYVKDLKIWIHKEEGWWNE
Ga0194117_102295621	3300021424	Freshwater Lake	HKILKAIDHHTRFYMKTGDPWHEEQAQILRKYIKDLKIWIHKEEGWWNE
Ga0194117_104755761	3300021424	Freshwater Lake	RLYMETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE
Ga0194117_105005012	3300021424	Freshwater Lake	RLYLETGDTWHEEQAQILRKYIKDLKIWIHKEEGWWNE
Ga0222716_101818523	3300021959	Estuarine Water	METGDFWHEEQAQILREYVKNLKIWIHKEEGWFDE
Ga0222715_101670041	3300021960	Estuarine Water	RLWMETGDYWHEEQAQILRKYVKDLKVWIHRQEGK
Ga0222714_1000809111	3300021961	Estuarine Water	METGDFWHEEQAQILRKYVKDLKVWIHKQEGWWDE
Ga0222714_1000815619	3300021961	Estuarine Water	MKTGDYWHEEQAQMLRKYVKDLKVWIHKEEGWWNE
Ga0222714_101064671	3300021961	Estuarine Water	IDNHTRLHMETGDFWHEEQAQILRKYVKDLKIWIHKQEGWWDE
Ga0222714_102432683	3300021961	Estuarine Water	METGDIWHEEQAQILRKYVKDLKVWIHKQEGWWNE
Ga0222714_104008253	3300021961	Estuarine Water	IDNHTRLFMETGDFWHQEQSEILRKYVKDLKVWIHKEEGWWNE
Ga0222713_101618494	3300021962	Estuarine Water	METGDFWHEEQAQILRKYVKDLKIWIHKQEGWWDE
Ga0222713_107822951	3300021962	Estuarine Water	IDNHTRLFLETGDFWHQEQADILRKYIKDLKVWIHKEEGWWNE
Ga0222713_108067173	3300021962	Estuarine Water	IDNHTRLHLETGDFWHEEQAQILRKYVKELKVFIHKEEGR
Ga0222712_10000153172	3300021963	Estuarine Water	METGDFWHEEQAQILREYVKNLKIWIHKEEGWWDE
Ga0196905_11849302	3300022198	Aqueous	METGDLWHEEQAQMLRKYIKDLKVWIHKEEGWWDE
Ga0196901_11365911	3300022200	Aqueous	AIDNHTRLWMETGDFWHEEQAQILRKYVKDLKVFIHKQEGWWDE
Ga0196901_11664632	3300022200	Aqueous	METGDSWHEDQAEILRKYVKDLKVWIHKQEGWWNE
Ga0224506_104306874	3300022221	Sediment	FLETGDFWHQEQADILRKYIKDLKVWIHKEEGWWNE
Ga0224501_102796083	3300022223	Sediment	METGDMWHEEQANILRKYIKDLKVWIHKQEGWWDE
Ga0247724_10259601	3300024239	Deep Subsurface Sediment	KNYVKTGDNWHLSQAEILRKYVKDLKIWIHRQEGR
Ga0244777_104368602	3300024343	Estuarine	METGDIWHEEQAQILRKYVKDLKVWIHKEEGWWNE
Ga0255141_10366771	3300024351	Freshwater	DNHTRLFMETGDYWHEEQAQMLRKYVKDLKVWIHKQEGWWDE
Ga0255090_10508431	3300027123	Freshwater	CLDAVDEHTRQHMKTGDEWHLSQAEILRKYVKDLKVWIHKEEGWWNE
Ga0255081_10841541	3300027155	Freshwater	LDAVDEHTRQHMKTGDEWHLSQAEILRKYVKDLKVWIHHQEGRE
Ga0209189_11214721	3300027747	Freshwater Lake	DNHTDIYIKTGDTWHEEQAKYLRQYVYNLKDWIISQEN
Ga0209500_102625231	3300027782	Freshwater Lake	DNHTDIYIKTGDTWHEEQAKYLRQYVYRLKDWIISQEN
Ga0209107_104908321	3300027797	Freshwater And Sediment	HIKNYTKTGDEWHLSQAEVLRKYVKDLKIWIHKQEGR
Ga0209990_1000648716	3300027816	Freshwater Lake	METGDFWHEEQAQILRKYVKDLKIWIHKQEGVWDE
Ga0119944_10187443	3300029930	Aquatic	AVDEHTRQHMQTGDEWHISQAEILRKYVKDLKVWIHKQEGWWNE
Ga0119944_10363342	3300029930	Aquatic	LDAVDTHMKLHLETQDDWHLSQAEILRKYVKDLKVWIHKQEGWWDE
Ga0119944_10417402	3300029930	Aquatic	HMRQHLKTGDEWHLSKAEILRKYVKDLKVWIHKQEGWWDE
Ga0307380_106890492	3300031539	Soil	RLYIETGDVWHEEQAQILRKYIKDVKIWIHKEENWEL
Ga0315291_113473493	3300031707	Sediment	TRLHLETGNFWHEEQAQILRTYVKELKVFIHKEERGQ
Ga0315907_102464891	3300031758	Freshwater	RLWMETGDFWHEEQAQILRNYVKNLKVWIHKEEGWWDE
Ga0315899_102286241	3300031784	Freshwater	AVDEHVKAYIKTGDDWHLSQAEILRKYVKDLKVWIHKEEGR
Ga0315909_108190761	3300031857	Freshwater	METGDFWHEEQAQMLRKYIKDLKVWIHKEEGWWDE
Ga0315906_1001069213	3300032050	Freshwater	METGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE
Ga0315903_105727012	3300032116	Freshwater	TRLHMETGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE
Ga0334722_103864194	3300033233	Sediment	HTRLHLETGNFWHEEQAQILRTYVKELKVFIHKEERGQ
Ga0334977_0586862_107_214	3300033978	Freshwater	METGDFWHEEQSQILRKYVKDLKVWIHKQEGWWDE
Ga0334996_0016460_49_156	3300033994	Freshwater	METGDIWHEEQAQILRKYVRDLKVWIHKEEGWWNE
Ga0334996_0078652_1856_1963	3300033994	Freshwater	METGNFWHEEQAQMLRKYVKDLKVWIHKEEGWWNE
Ga0335027_0074722_2512_2625	3300034101	Freshwater	MRKHIKTGDDWHILQAEILRKYVKDLKVWIHKQEGRE
Ga0335029_0118340_934_1041	3300034102	Freshwater	METGDYWHEEQAQILRKYVKDLKVWIHKQEGVWNE
Ga0335036_0831061_94_201	3300034106	Freshwater	METGDFWHEEQAQILRKYVKDLKVWIHKQEGVWNE
Ga0335066_0069106_8_127	3300034112	Freshwater	MRLHLKTGDDWHLSQAETLRNYVKELKVWIHKQEGWWNE
Ga0335066_0650804_1_117	3300034112	Freshwater	RLYFETGDFWHEEQAQILRKYVKDLKVWIHKQEGRWDE
Ga0335068_0305398_423_530	3300034116	Freshwater	METGDFWHEQQAQILRKYVKDLKVWIHKQEGWWDE
Ga0335049_0591585_287_394	3300034272	Freshwater	METGDYWHEEQAQILRNYVMDLKVWIHKQEGWWDE
Ga0348335_131198_401_508	3300034374	Aqueous	METGDFWHHEQAEILRKYVKDLKVWIHKEEGWWNE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters