NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040298

Metagenome / Metatranscriptome Family F040298

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040298
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 40 residues
Representative Sequence VNLGGYLAALAPLAVVPVKMELADAANAVDTMLRLIEERRRRS
Number of Associated Samples 147
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.62 %
% of genes near scaffold ends (potentially truncated) 99.38 %
% of genes from short scaffolds (< 2000 bps) 87.65 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.494 % of family members)
Environment Ontology (ENVO) Unclassified
(20.370 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.383 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 32.39%    β-sheet: 0.00%    Coil/Unstructured: 67.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF00294PfkB 85.19
PF01467CTP_transf_like 4.32
PF01075Glyco_transf_9 3.09
PF04191PEMT 2.47
PF02606LpxK 0.62
PF00472RF-1 0.62
PF06537DHOR 0.62
PF00691OmpA 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 162 Family Scaffolds
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 3.09
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.62
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.62
COG1663Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase)Cell wall/membrane/envelope biogenesis [M] 0.62
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908043|A2_c1_ConsensusfromContig58760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300001471|JGI12712J15308_10208866All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300001593|JGI12635J15846_10442103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium776Open in IMG/M
3300001867|JGI12627J18819_10028958All Organisms → cellular organisms → Bacteria2285Open in IMG/M
3300002245|JGIcombinedJ26739_100530691All Organisms → cellular organisms → Bacteria → Acidobacteria1054Open in IMG/M
3300002568|C688J35102_119849611All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium793Open in IMG/M
3300004082|Ga0062384_101478037All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300004091|Ga0062387_100214730All Organisms → cellular organisms → Bacteria → Acidobacteria1173Open in IMG/M
3300004091|Ga0062387_100867974All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300004152|Ga0062386_100440241All Organisms → cellular organisms → Bacteria → Acidobacteria1053Open in IMG/M
3300005332|Ga0066388_100828334All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300005345|Ga0070692_11360223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300005434|Ga0070709_11169109All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300005561|Ga0066699_10589542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300005569|Ga0066705_10770862All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300005602|Ga0070762_10623343All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300005712|Ga0070764_11027035All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300005921|Ga0070766_10299128All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300006047|Ga0075024_100830494All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300006173|Ga0070716_100047118All Organisms → cellular organisms → Bacteria2430Open in IMG/M
3300006174|Ga0075014_100684993All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300006358|Ga0068871_100054128All Organisms → cellular organisms → Bacteria3254Open in IMG/M
3300006358|Ga0068871_102236921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300006797|Ga0066659_11029939All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300006800|Ga0066660_10484589All Organisms → cellular organisms → Bacteria → Acidobacteria1038Open in IMG/M
3300006800|Ga0066660_10728638All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300006954|Ga0079219_12075637All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300009038|Ga0099829_10010676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5952Open in IMG/M
3300009038|Ga0099829_10076997All Organisms → cellular organisms → Bacteria → Acidobacteria2543Open in IMG/M
3300009038|Ga0099829_11518056All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300009088|Ga0099830_11419720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300009143|Ga0099792_11244173All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300009147|Ga0114129_11077845All Organisms → cellular organisms → Bacteria → Acidobacteria1007Open in IMG/M
3300009621|Ga0116116_1057860All Organisms → cellular organisms → Bacteria → Acidobacteria1143Open in IMG/M
3300009635|Ga0116117_1156496All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300009665|Ga0116135_1017728All Organisms → cellular organisms → Bacteria2464Open in IMG/M
3300009665|Ga0116135_1126775All Organisms → cellular organisms → Bacteria → Acidobacteria941Open in IMG/M
3300009824|Ga0116219_10314368All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300009839|Ga0116223_10070153All Organisms → cellular organisms → Bacteria → Acidobacteria2249Open in IMG/M
3300010043|Ga0126380_10973491All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300010325|Ga0134064_10401523All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300010333|Ga0134080_10577953All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300010360|Ga0126372_11859625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300010376|Ga0126381_103008480All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300011269|Ga0137392_10276438All Organisms → cellular organisms → Bacteria → Acidobacteria1385Open in IMG/M
3300012362|Ga0137361_10274984All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300012469|Ga0150984_120712935All Organisms → cellular organisms → Bacteria → Acidobacteria1197Open in IMG/M
3300012960|Ga0164301_10378228All Organisms → cellular organisms → Bacteria → Acidobacteria983Open in IMG/M
3300012985|Ga0164308_10865454All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300012985|Ga0164308_11463602All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300013105|Ga0157369_10987561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium862Open in IMG/M
3300013296|Ga0157374_10110768All Organisms → cellular organisms → Bacteria → Acidobacteria2640Open in IMG/M
3300014154|Ga0134075_10475289All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300014165|Ga0181523_10205578All Organisms → cellular organisms → Bacteria → Acidobacteria1138Open in IMG/M
3300014657|Ga0181522_10163058All Organisms → cellular organisms → Bacteria → Acidobacteria1306Open in IMG/M
3300015241|Ga0137418_10014358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7311Open in IMG/M
3300015242|Ga0137412_10238588All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300015262|Ga0182007_10210728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300015372|Ga0132256_102426220All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300016270|Ga0182036_10336893All Organisms → cellular organisms → Bacteria → Acidobacteria1158Open in IMG/M
3300017656|Ga0134112_10171530All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300017822|Ga0187802_10096679All Organisms → cellular organisms → Bacteria → Acidobacteria1109Open in IMG/M
3300017928|Ga0187806_1351626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300017933|Ga0187801_10427865All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300017935|Ga0187848_10038168All Organisms → cellular organisms → Bacteria → Acidobacteria2378Open in IMG/M
3300017936|Ga0187821_10228737All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300017942|Ga0187808_10201527All Organisms → cellular organisms → Bacteria → Acidobacteria885Open in IMG/M
3300017943|Ga0187819_10396460All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300017961|Ga0187778_10011032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5629Open in IMG/M
3300017966|Ga0187776_11358859All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300017975|Ga0187782_10238339All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300017999|Ga0187767_10195439All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300018006|Ga0187804_10054950All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1567Open in IMG/M
3300018013|Ga0187873_1240637All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300018023|Ga0187889_10323601All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300018025|Ga0187885_10022162All Organisms → cellular organisms → Bacteria → Acidobacteria3602Open in IMG/M
3300018035|Ga0187875_10358310All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300018044|Ga0187890_10874035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300018085|Ga0187772_10640487All Organisms → cellular organisms → Bacteria → Acidobacteria759Open in IMG/M
3300018431|Ga0066655_10506577All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300018482|Ga0066669_11601285All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300019361|Ga0173482_10693324All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300020579|Ga0210407_10821127All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300021170|Ga0210400_10832763All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300021180|Ga0210396_10701424All Organisms → cellular organisms → Bacteria → Acidobacteria874Open in IMG/M
3300021181|Ga0210388_10193729All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1777Open in IMG/M
3300021402|Ga0210385_11304126All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300021403|Ga0210397_10247272All Organisms → cellular organisms → Bacteria → Acidobacteria1293Open in IMG/M
3300021403|Ga0210397_11079446All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300021405|Ga0210387_10385416All Organisms → cellular organisms → Bacteria → Acidobacteria1241Open in IMG/M
3300021406|Ga0210386_10601799All Organisms → cellular organisms → Bacteria → Acidobacteria949Open in IMG/M
3300021420|Ga0210394_10432121All Organisms → cellular organisms → Bacteria → Acidobacteria1159Open in IMG/M
3300021420|Ga0210394_11578615All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300021433|Ga0210391_11115457All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300021477|Ga0210398_10371489All Organisms → cellular organisms → Bacteria → Acidobacteria1166Open in IMG/M
3300021477|Ga0210398_11052987All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300022557|Ga0212123_10574881All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300024271|Ga0224564_1046487All Organisms → cellular organisms → Bacteria → Acidobacteria841Open in IMG/M
3300025406|Ga0208035_1021980All Organisms → cellular organisms → Bacteria → Acidobacteria1028Open in IMG/M
3300025419|Ga0208036_1018449All Organisms → cellular organisms → Bacteria → Acidobacteria1459Open in IMG/M
3300025457|Ga0208850_1072958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300025906|Ga0207699_11005010All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300025916|Ga0207663_10379281All Organisms → cellular organisms → Bacteria → Acidobacteria1077Open in IMG/M
3300025928|Ga0207700_11841737All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300025929|Ga0207664_11150245All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300025939|Ga0207665_10039012All Organisms → cellular organisms → Bacteria3165Open in IMG/M
3300025981|Ga0207640_11714795All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300026215|Ga0209849_1029914All Organisms → cellular organisms → Bacteria → Acidobacteria937Open in IMG/M
3300026306|Ga0209468_1053668All Organisms → cellular organisms → Bacteria → Acidobacteria1363Open in IMG/M
3300026310|Ga0209239_1017168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3665Open in IMG/M
3300026481|Ga0257155_1022521All Organisms → cellular organisms → Bacteria → Acidobacteria909Open in IMG/M
3300026552|Ga0209577_10509059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium795Open in IMG/M
3300026839|Ga0207764_112595All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300027072|Ga0208238_1026043All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300027583|Ga0209527_1074587All Organisms → cellular organisms → Bacteria → Acidobacteria763Open in IMG/M
3300027609|Ga0209221_1111127All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300027895|Ga0209624_10162743All Organisms → cellular organisms → Bacteria → Acidobacteria1477Open in IMG/M
3300027915|Ga0209069_10679888All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300028572|Ga0302152_10121310All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300028673|Ga0257175_1067356All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300028806|Ga0302221_10032530All Organisms → cellular organisms → Bacteria → Acidobacteria2469Open in IMG/M
3300028866|Ga0302278_10500872All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300028906|Ga0308309_11856774All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300029945|Ga0311330_10727986All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300029986|Ga0302188_10251391All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300029993|Ga0302304_10092223All Organisms → cellular organisms → Bacteria → Acidobacteria1166Open in IMG/M
3300029994|Ga0302283_1159227All Organisms → cellular organisms → Bacteria → Acidobacteria872Open in IMG/M
3300029999|Ga0311339_10700948All Organisms → cellular organisms → Bacteria → Acidobacteria990Open in IMG/M
3300030007|Ga0311338_10736891All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300030056|Ga0302181_10307345All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300030580|Ga0311355_10242089All Organisms → cellular organisms → Bacteria1853Open in IMG/M
3300030659|Ga0316363_10123522All Organisms → cellular organisms → Bacteria → Acidobacteria1130Open in IMG/M
3300030879|Ga0265765_1049753All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300031122|Ga0170822_11839594All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300031170|Ga0307498_10353504All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300031233|Ga0302307_10247306All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300031247|Ga0265340_10362382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300031344|Ga0265316_10061079All Organisms → cellular organisms → Bacteria → Acidobacteria2928Open in IMG/M
3300031708|Ga0310686_118139670All Organisms → cellular organisms → Bacteria3294Open in IMG/M
3300031718|Ga0307474_10246493All Organisms → cellular organisms → Bacteria → Acidobacteria1367Open in IMG/M
3300031720|Ga0307469_10014675All Organisms → cellular organisms → Bacteria → Acidobacteria4021Open in IMG/M
3300031720|Ga0307469_11189667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300031720|Ga0307469_12514218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300031753|Ga0307477_10319146All Organisms → cellular organisms → Bacteria → Acidobacteria1071Open in IMG/M
3300031820|Ga0307473_11295807All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300031833|Ga0310917_10586660All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300032076|Ga0306924_11214585All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300032076|Ga0306924_11641555All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300032160|Ga0311301_11040942All Organisms → cellular organisms → Bacteria → Acidobacteria1075Open in IMG/M
3300032160|Ga0311301_11932453All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300032180|Ga0307471_103200650All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300032205|Ga0307472_101386621All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300032205|Ga0307472_102423454All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300032782|Ga0335082_10827823All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300032783|Ga0335079_11027393All Organisms → cellular organisms → Bacteria → Acidobacteria839Open in IMG/M
3300032828|Ga0335080_10115570All Organisms → cellular organisms → Bacteria → Acidobacteria2978Open in IMG/M
3300032892|Ga0335081_12014806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300032897|Ga0335071_11605526All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300032898|Ga0335072_10143376All Organisms → cellular organisms → Bacteria → Acidobacteria2946Open in IMG/M
3300033807|Ga0314866_018948All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300034124|Ga0370483_0024309All Organisms → cellular organisms → Bacteria → Acidobacteria1808Open in IMG/M
3300034125|Ga0370484_0085776All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.49%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.32%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.32%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.70%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.09%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.09%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.47%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.47%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.47%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.47%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.85%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.23%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.23%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.23%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.23%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.62%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.62%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.62%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.62%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.62%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026839Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes)EnvironmentalOpen in IMG/M
3300027072Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029994Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2_c1_009796202124908043SoilVNLGAYHSALQPLSVVLVKMELSDAANAVDTMLHKIGERKLRA
JGI12712J15308_1020886613300001471Forest SoilNLGAYLSALQPLCVVPVRMELSDAANALDTMLRVIEERRRRA*
JGI12635J15846_1044210323300001593Forest SoilALAPLAVLAVRMELSDAANAVDTILHKIAERKPPA*
JGI12627J18819_1002895843300001867Forest SoilINLGGYFSTLQPLAVVPVKMELADAANALDTMLRIIGERNKRP*
JGIcombinedJ26739_10053069123300002245Forest SoilLSALRPLAVVPVRMVLADAANALDTILRKIEERTRRP*
C688J35102_11984961113300002568SoilYLSALEPLAVVPVKMELTDAANALDTMLRKIDERQGRIS*
Ga0062384_10147803723300004082Bog Forest SoilNLGGLLSALEPIAVVPVKMELADAANAVDTMLRVIAERTQQT*
Ga0062387_10021473023300004091Bog Forest SoilGLLGALDPLAVVPVKMELTDAANAMDTMLRVIAERRRQS*
Ga0062387_10086797423300004091Bog Forest SoilINLGTWMPALNPIAVVPVKMELIDAANAVDTMLRVIAERTRLS*
Ga0062386_10044024113300004152Bog Forest SoilPYVSALEPLAVVPVRMELSDAANALDTMLRAIAERKRKA*
Ga0066388_10082833433300005332Tropical Forest SoilLGGYFSSLQPLAVVPVKMELADAANAVDTMLRIVHERTKLP*
Ga0070692_1136022313300005345Corn, Switchgrass And Miscanthus RhizosphereINLGGYLSALQPLAMASVTMELIDATNAIDTMLRIIEERRQRT*
Ga0070709_1116910913300005434Corn, Switchgrass And Miscanthus RhizosphereDLINLGQHQEYLQPLAVVPVKMKILDAANVVDTMLQVIEERRR*
Ga0066699_1058954223300005561SoilNLDGYFAALEPIAVVPVKMELADAANILDTMLRHIEEGRRKT*
Ga0066705_1077086223300005569SoilFSALEPIAVIPVAMDLADAAKAVDTMLRIVGERKNPA*
Ga0070762_1062334313300005602SoilLGGYLAALAPLVVVRVKMELADAANSVDTMLRVIEERRRHS*
Ga0070764_1102703523300005712SoilLGGFLSALQPTTVVPVKMELVDAANAVDTMLRRIEERRGNA*
Ga0070766_1029912813300005921SoilEKDAVNLGGYLDALAPLAVVPVKMELSDADNAMDTMLRVIEERRRRS*
Ga0075024_10083049413300006047WatershedsFLSALEPVAVVPVKMDLVDAANAVDTMLRVVEERRRRA*
Ga0070716_10004711813300006173Corn, Switchgrass And Miscanthus RhizosphereEKDAVNLGGYLAALAPLGVVPVKMDLADAANGIDTMLHKINERKPRP*
Ga0075014_10068499323300006174WatershedsINLGGYFSALQPLAVVPVKMELADAANTVDTMLRIVGERTRRP*
Ga0068871_10005412813300006358Miscanthus RhizosphereLAALAPLAVVPVKMELTDAANAVDTILARIAERSRQP*
Ga0068871_10223692123300006358Miscanthus RhizosphereLAPLGVVPVKMELADAANAVDTMLHKINERTPRP*
Ga0066659_1102993923300006797SoilGEYLSALQPLAVVLVKMELRDAANAVDTLLAAISGRRQSA*
Ga0066660_1048458923300006800SoilSYLSALEPLSVIQVKMELADTANAVDTILRTIAERKGRIR*
Ga0066660_1072863833300006800SoilSALEPISVIPVKMELADAANAVDTMLRTIEERKRRA*
Ga0079219_1207563713300006954Agricultural SoilGYLAALAPLAVVPVKMELTDAANAVDTILARIAERSRQP*
Ga0099829_1001067693300009038Vadose Zone SoilLKPLAVVPVKMELTDAANAVDTMLARIADRTQLA*
Ga0099829_1007699743300009038Vadose Zone SoilLAPLAVVPVKMELADAANGVDTMLRVIEERRRRS*
Ga0099829_1151805613300009038Vadose Zone SoilTEKDAMNLGGYLDELAPLAVVPVKMELSDAANAVDTMLRVIEERRRRS*
Ga0099830_1141972013300009088Vadose Zone SoilHAPLAVVPVQMELSDAANAVDTMLHKIGEQKPRA*
Ga0099792_1124417323300009143Vadose Zone SoilVNLGGYLDALAPLAVVPVKMKLADAANGVDTMLRVIEERRRRS*
Ga0114129_1107784513300009147Populus RhizosphereNLGPHIFALQPLSVIPVRMELVDAANAVDTMLRTIEERRRSA*
Ga0116116_105786013300009621PeatlandLGPLAVVPVKMELADEANAVDTMLRVIEERRGRS*
Ga0116117_115649623300009635PeatlandGGYFSALAPLSVIPVKMELADSANAVDTMLRVIEGRRRRS*
Ga0116135_101772813300009665PeatlandNLGVYLSALAPLAVVAVKMELADAANAVDTMLQKIGERKRGT*
Ga0116135_112677513300009665PeatlandLGSLGPLAVVPVKMELADAANAVDTMLRVIEERRGHS*
Ga0116219_1031436813300009824Peatlands SoilALQPLTVVPVKMELMDAANALDTMLRMIEERRRPT*
Ga0116223_1007015343300009839Peatlands SoilGGLLGALAPLAVVPVKMELAAAANAVDTMLGVIAERKRQS*
Ga0126380_1097349113300010043Tropical Forest SoilSLSRLQPVAVVPVKMELIDSANAVDTMLRIINERKPQA*
Ga0134064_1040152313300010325Grasslands SoilLFALQPLTVLPVRMELMDAANAVDTMLRMINDRRRSA*
Ga0134080_1057795323300010333Grasslands SoilEFLTALVPLAVVPVKMELLDADNALDTMFRTIEERRRPA*
Ga0126372_1185962513300010360Tropical Forest SoilSALEPLSVILVRMELENAANAVDTILRKIGSRTDRA*
Ga0126381_10300848013300010376Tropical Forest SoilGPYLAALESLSVVRVRMELDGAANALDTMLRTIEQRRRGA*
Ga0137392_1027643823300011269Vadose Zone SoilVNLSGYLDALAPLAVVPVKMELADAANGVDTMLRVIEERRRRS*
Ga0137361_1027498413300012362Vadose Zone SoilDAMNLGGYLDALAPLAVVPVKMELSDAANALDTMLRVIEERRRRS*
Ga0150984_12071293523300012469Avena Fatua RhizosphereLSPLAVVPVKMDLIDAPNVVDTMLRIVEERRLPA*
Ga0164301_1037822823300012960SoilLAALEPLAVVPVNMELADAANAVDTMLARIAERTPSA*
Ga0164308_1086545423300012985SoilLGGYLATLQPLAVVPVKMELTGAANAVDTMLAMIAERRRKP*
Ga0164308_1146360213300012985SoilLGPLAVVPVKMELTDAANAVDTILARIAERSRQP*
Ga0157369_1098756113300013105Corn RhizospherePYLSALEPLSVIQVKMELADAANAVDTILRTIAERKGRIR*
Ga0157374_1011076843300013296Miscanthus RhizosphereAALEPLAVIPVKMELADAANAVDTMLAMIAERRRKP*
Ga0134075_1047528923300014154Grasslands SoilHLFALQPLTVLPVRMELVDAANAVDTMLRVINDRSA*
Ga0181523_1020557813300014165BogKDAVNLGGYLSALAPLAVVPAKMELTDAANAVDTMLHKIDERKRGA*
Ga0181522_1016305813300014657BogALHPLSVVPVKMELQDAANAVDTMLGVIGERKRPA*
Ga0137418_1001435813300015241Vadose Zone SoilLAGYFSALEPLAVVPVKMELADAANAVDTMLRILDERGNRP*
Ga0137412_1023858813300015242Vadose Zone SoilEKDAVNLGGYLDALAPLAIVQVKMQLADEDNAVDTMLRVIEERRRRS*
Ga0182007_1021072823300015262RhizosphereLGPYLSALESLSVVQVKMELADAANAVDTILRTIAERKGRIR*
Ga0132256_10242622023300015372Arabidopsis RhizosphereSALAPLGVVPVKMELADAANVVDTILHKISDRKPRP*
Ga0182036_1033689313300016270SoilSAVAPLAVVPVRMELMDSANAVDTMLRKIEERQRSA
Ga0134112_1017153013300017656Grasslands SoilLGPHLFALQPLTVLPVRMELMDAANAVDTMLRMINDRRRSA
Ga0187802_1009667913300017822Freshwater SedimentALEPICVVPVRMELAEAANAVDTMLRMIEERKHRA
Ga0187806_135162623300017928Freshwater SedimentSALDPICVVPVRMELAEAANAVDTMLRMIEERKHRA
Ga0187801_1042786513300017933Freshwater SedimentTEKDAVNLGGLFAALEPISVVPVKMELADAANAVGTMLRKIEERRRGA
Ga0187848_1003816813300017935PeatlandAVNLGGYLGSLGPLAVVPVKMELADAANAVDTMLRVIEERRGHS
Ga0187821_1022873713300017936Freshwater SedimentNLGGYLAALAPLGVVPVKMELADAANAIDTMLQKINERKPRP
Ga0187808_1020152723300017942Freshwater SedimentFSALEPIAVVPVKMELSDAANAVDTMLRVIAERSQQS
Ga0187819_1039646013300017943Freshwater SedimentQALQPLAVIPVKMELVDAANVVDTMLRMIAERRRKA
Ga0187778_1001103213300017961Tropical PeatlandLFSALSPLAVVPVRMELADVANALDTMLGTIEERRRRT
Ga0187776_1135885933300017966Tropical PeatlandSSLQPLAVVPVKMELADAANAVDTMLARIAERQRVP
Ga0187782_1023833913300017975Tropical PeatlandPYLAALEPVSVVPVRMELADAANAVDTMLRKIAERKGRIS
Ga0187767_1019543923300017999Tropical PeatlandLGGFLAALQPIAVVRVRMELSEAANAVDTMLRVVSERKAEA
Ga0187804_1005495013300018006Freshwater SedimentPYLSALEPLSVVPVRMELADAANALDTMLARIAERKRQA
Ga0187873_124063713300018013PeatlandKDAVNLGRYLDALGPLAVVPVKMELADEANAVDTMLRVIEERRGRS
Ga0187889_1032360113300018023PeatlandKDAVNLGGYLGSLGPLAVVPVKMELADAANAVDTMLRVIEERRGHS
Ga0187885_1002216253300018025PeatlandGGYLDALTPLAVVRVKMELADAANAVDTMLRVIEERRSRS
Ga0187875_1035831023300018035PeatlandAVNLGPYLAALGPLAVVRVTMELADADHVVETILRTLAERRRCS
Ga0187890_1087403513300018044PeatlandRWSALEPLTVVPVKMELADAANAVDTMLHRIDERRRGA
Ga0187772_1064048723300018085Tropical PeatlandVNLGGYFDAVAPLAVIPVTMELADAASAVDAMLGAIEERRSSA
Ga0066655_1050657733300018431Grasslands SoilTEKDAVNLGGYLSALDPISMVPVKMELADAANAVDTMLRTIEERRRRP
Ga0066669_1160128523300018482Grasslands SoilSALDPLAVVPVTMELTGAANAVDTILARIAERTRPA
Ga0173482_1069332413300019361SoilLGGCLAALAPLAVVPVKMELTDAANAVDTILARIAERSRQP
Ga0210407_1082112713300020579SoilGYLAALVPLAVVPVKMELADAANAVDTMLRVIEEPRCRS
Ga0210400_1083276313300021170SoilEKDAVNLGGYLAALAPLAVVAVKMELIDAANAVDTMLARIAERRRSA
Ga0210396_1070142423300021180SoilDAVNLGGYLDALAPLAVIPVRMDLAEADNAVDTMLRTIEERRLRS
Ga0210388_1019372913300021181SoilKDAVNLAGYLGALAPLAVVPVKMEVADAANTVDTMLRVIEERRSRS
Ga0210385_1130412623300021402SoilGFLEALAPLTVVPVTMELADADNAMDTMLRVIEERRRRT
Ga0210397_1024727223300021403SoilNLGPYLSALAPLAVVRVRMELVDAANGVDTVLRKIEERRSGA
Ga0210397_1107944613300021403SoilLGPYLSALEPLSVVQVRMELADAPNAVDTVLRKIAERKRGA
Ga0210387_1038541613300021405SoilDAVNLGGYLAALVPLAVVPVKMELADAANAVDTMLRVIEEPRCRS
Ga0210386_1060179913300021406SoilGGYLDALAPLAVIPVRMDLAEADNAVDTMLRTIEERRLRS
Ga0210394_1043212113300021420SoilALAPLAVVPVKMELTDAANAVDTILHKITEQNRDP
Ga0210394_1157861523300021420SoilLGGYLSSLEPLAVVPVTMELENADDAVDTMLRVIEERRRGS
Ga0210391_1111545713300021433SoilTEKDAVNLGGYLAALTPLAVVPVTMELADAANALDTMLRVIEERRRRS
Ga0210398_1037148913300021477SoilEKDAVNLGAYLSALAPLAVVPVKMELADAANAVDTMLHKIGERKRGT
Ga0210398_1105298713300021477SoilINLGGYFSALQPLTVVPVKMELADAANALDTMLRIVHERTKRP
Ga0212123_1057488113300022557Iron-Sulfur Acid SpringTEKDAVNLRGYLSVLEPLAVVPVKMELSDAASAIDTMLHKIDERKRQA
Ga0224564_104648713300024271SoilEKDAVNLGGYLDALAPLAVVPVKMELADAANAVDTMLRVIEERRRRS
Ga0208035_102198023300025406PeatlandTEKDAVNLGGYLGSLGPLAVVPVKMELADAANAVDTMLRVIEERRGHS
Ga0208036_101844933300025419PeatlandEKDAVNLGRYLDALGPLAVVPVKMELADEANAVDTMLRVIEERRGRS
Ga0208850_107295813300025457Arctic Peat SoilGGYLSTLAPLGVVPVKMELSDAANVIDTMLHKIEERRRGA
Ga0207699_1100501013300025906Corn, Switchgrass And Miscanthus RhizosphereDLINLGQHQEYLQPLAVVPVKMKILDAANVVDTMLQVIEERRR
Ga0207663_1037928123300025916Corn, Switchgrass And Miscanthus RhizosphereVNLGGYLSALAPLAVVPVKMELADAANAVDTMLARIAERRRQP
Ga0207700_1184173713300025928Corn, Switchgrass And Miscanthus RhizosphereALEPLSVVPVKMELGDAANAVDTMLRKIEERKRGA
Ga0207664_1115024513300025929Agricultural SoilLGPYLSALAPMAVVPVRMELLDAANALDTMLGKIKERRTRA
Ga0207665_1003901253300025939Corn, Switchgrass And Miscanthus RhizospherePYLSALTPLAVVPVRMELVDAANAVDTMLRKIEERRRGA
Ga0207640_1171479513300025981Corn RhizosphereCLAALAPLAVVPVKMELTDAANAVDTILARIAERSRQP
Ga0209849_102991423300026215SoilYLSALEPLVVVPVTMKLGDSANAVDTMLRQIEERKRGA
Ga0209468_105366813300026306SoilDAINLSEFLAALVPLAVVPVKMELLDADNALDTMLRTIEERRRPA
Ga0209239_101716813300026310Grasslands SoilGYLAALEPVAVVPVKMELLDAANAVDTMLRVIEERRRRA
Ga0257155_102252123300026481SoilLRGYLSVLEPLAVVPVKMELSDAASAIDTMLHKIDERKRQA
Ga0209577_1050905923300026552SoilINLGAYLSALQPLAVLPVKMDLLDAANAVNTMLRIIDERRRQP
Ga0207764_11259523300026839Tropical Forest SoilPYLSALAPLAIVPVRMELSDAANAVDTMLRKIEERKRGA
Ga0208238_102604313300027072Forest SoilVNLGGFLEALAPLTVVPVTMELADADNAMDTMLRVIEKRRARS
Ga0209527_107458713300027583Forest SoilSLEPLAVVPVKMELENADDAVDTMLRVIQERRRGA
Ga0209221_111112723300027609Forest SoilVNLGRFMGSLEPLSVVPVKMELADAANVVDTILRVIEGRQRRP
Ga0209624_1016274333300027895Forest SoilAVNLRGYLSVLEPLAVVPVKMELSDAASAIDTMLHKIDERKR
Ga0209069_1067988823300027915WatershedsFLSALEPVAVVPVKMDLVDAANAVDTMLRVVEERRRRA
Ga0302152_1012131023300028572BogTEKDAVNLEGYLDALQPLAVIPVKMELADAANVVDTMLRAIDEQRRHS
Ga0257175_106735623300028673SoilINLGGYLAALEPVAVVPVKMELLDAANAVDTMLRVIEERRRRA
Ga0302221_1003253013300028806PalsaNLGGYLDALTPLAVVPVKMELADADNAVNTILLVIEGRRRHS
Ga0302278_1050087213300028866BogNLEGYLDALQPLAVIPVKMELADAANVVDTMLRAIDEQRRHS
Ga0308309_1185677413300028906SoilGYLDALAALAVVPVKMELADAADVVDTMLRMIEERRGQS
Ga0311330_1072798623300029945BogTEKDAVNLGGYLGSLGPLAVVPVKMELADTANAVDTMLRVIEERRGHS
Ga0302188_1025139113300029986BogKDAVNLEGYLDALQPLAVIPVKMELADAANVVDTMLRAIDEQRRHS
Ga0302304_1009222323300029993PalsaLYALHPLSVVPVKMELQEAANAVDTMLRVIAERSPQT
Ga0302283_115922713300029994FenSLAPLAVIPVKMELADAANAVDTMLGVINERRGGS
Ga0311339_1070094813300029999PalsaGYLAALAPLVVVRVKMELADTANAVDTMLRVIEERRRHS
Ga0311338_1073689123300030007PalsaKRSEADGFIVTEKDAVNLGGYLDALVPLAVVPVKMELADAANAVDTMLRVIEERRGRS
Ga0302181_1030734523300030056PalsaLGGYLDALTPLAVVPVKMELADADNAVNTILLVIEGRRRHS
Ga0311355_1024208913300030580PalsaVNLGTHLSALAPLAVVPVKMELADAADAVDTMLRVIEKRRGKS
Ga0316363_1012352213300030659Peatlands SoilALEPLAVVPVRMELSDAANALDTMLRAIAERKRKA
Ga0265765_104975323300030879SoilALSPLAIVPVKMELADAANAVDTMLRVIDERRLRS
Ga0170822_1183959423300031122Forest SoilLGALAPLAVVPVKMQLEDAANVVDTTLRVIQEKRRRS
Ga0307498_1035350413300031170SoilALAPLAVVTVRMELVDAANAVDTILHKIEERRGGA
Ga0302307_1024730613300031233PalsaLGGYLAALAPLAVVPVKMELADAANAVDSMLRVIEERRGRS
Ga0265340_1036238213300031247RhizosphereLGGHLSALAPLAVVPVKMELSDVANPVDTILQKIDERKHGA
Ga0265316_1006107953300031344RhizosphereALEPLAVVPVKMELSDAANAIDTMLCKIEERRHGA
Ga0310686_11813967013300031708SoilTEKDAVNLGGYFEAFAPLAVVPVKMELANAAQAIDTMLRVIEERRRRS
Ga0307474_1024649333300031718Hardwood Forest SoilVLEPLAVVPVKMELSDAASAIDTMLHKIDERKRQA
Ga0307469_1001467513300031720Hardwood Forest SoilSTLEPLAVVPVKMELTDAANAVDTMLARIAERTHWA
Ga0307469_1118966713300031720Hardwood Forest SoilLAALAPLGVVPVKMELADAANAVDTMLHKINERTPRP
Ga0307469_1251421813300031720Hardwood Forest SoilTALEPLAVVPVKMELLDAANAVDTILRVIEERRRRA
Ga0307477_1031914623300031753Hardwood Forest SoilAVNLAGYLAVLGPLAVVPVKMELADAANAVDTMLRVIEERRRRS
Ga0307473_1129580713300031820Hardwood Forest SoilINLAGYLASLDPLAVVPVKMELVDAAHAVETLLSKIEERKRPA
Ga0310917_1058666023300031833SoilGLEPLAVVSVRMELMDAAHALDTMVRQIEERRRGA
Ga0306924_1121458513300032076SoilVSGLTPLSVVPVKMDLVDAANAVDTILRAVDERKRKA
Ga0306924_1164155513300032076SoilLGPHLAALEPLSVMQVRMELLDAANVVDTMLDTIEQRRRGA
Ga0311301_1104094213300032160Peatlands SoilVNLGGYLAALAPLAVVPVKMELADAANAVDTMLRLIEERRRRS
Ga0311301_1193245313300032160Peatlands SoilLGPYLSALEPLSVVPVRMDLADAANALDTMLRVIEERKRAT
Ga0307471_10320065013300032180Hardwood Forest SoilFALQPLTVLPARMELVDAANAVDTMLRVINDRRRSA
Ga0307472_10138662123300032205Hardwood Forest SoilALQPLAVVPVRMELADAANAVGTMLHTIEERRRRA
Ga0307472_10242345423300032205Hardwood Forest SoilLGAYYSALQPLAVVHVKMDLVDAANALDTMLRIISERKNRP
Ga0335082_1082782323300032782SoilAINLGTFMGQLQPMSIVPVKMELVDAANALDTMLRTINERRQNS
Ga0335079_1102739323300032783SoilALEPLSVVRVRMELDGAANAVDTILRAIEQRKRGA
Ga0335080_1011557053300032828SoilDAVNLGVYLSALHPLAVVPVKMELGDAANAVDTMLRKMEERRHGA
Ga0335081_1201480623300032892SoilTEKDAVNLGAYLSALQPLAVVPVKMELGDAANAVDTMLRMMEERRHRA
Ga0335071_1160552623300032897SoilTEKDAINLGAALERLRPVAVVPVTMELADADAALTAMLRVVEERRRGL
Ga0335072_1014337613300032898SoilNLGPHLSALQPLSIVPVRMELADAANVLDSMLRTVEERRREA
Ga0314866_018948_1_1233300033807PeatlandGPYLSALEPLSVIPVRMELADATNALDTMLRVIEERKRRA
Ga0370483_0024309_3_1133300034124Untreated Peat SoilDALAPLAVVPVKMELAGADNAVDSILRRIEERRGRS
Ga0370484_0085776_2_1393300034125Untreated Peat SoilDAVNLGGYLSALAPLAVVPVKMELSDVANPVDTILQKIDERKHGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.