Basic Information | |
---|---|
Family ID | F040288 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 162 |
Average Sequence Length | 45 residues |
Representative Sequence | LLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA |
Number of Associated Samples | 143 |
Number of Associated Scaffolds | 162 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.62 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 93.21 % |
Associated GOLD sequencing projects | 140 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.444 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.457 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.975 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.24% β-sheet: 0.00% Coil/Unstructured: 56.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 162 Family Scaffolds |
---|---|---|
PF13596 | PAS_10 | 91.36 |
PF00072 | Response_reg | 1.85 |
PF00196 | GerE | 1.23 |
PF13191 | AAA_16 | 0.62 |
PF12697 | Abhydrolase_6 | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.44 % |
Unclassified | root | N/A | 5.56 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459008|GA8OVOZ01EKXUT | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300005178|Ga0066688_10706820 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300005332|Ga0066388_105978628 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005332|Ga0066388_108547001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 509 | Open in IMG/M |
3300005336|Ga0070680_101975514 | Not Available | 505 | Open in IMG/M |
3300005363|Ga0008090_14785690 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300005436|Ga0070713_100774950 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300005436|Ga0070713_102126754 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005440|Ga0070705_100813244 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300005445|Ga0070708_100353956 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300005446|Ga0066686_10357877 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300005471|Ga0070698_100810540 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300005471|Ga0070698_101062821 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300005518|Ga0070699_101587429 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300005536|Ga0070697_101223008 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300005549|Ga0070704_100618879 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300005568|Ga0066703_10008141 | All Organisms → cellular organisms → Bacteria | 4894 | Open in IMG/M |
3300005598|Ga0066706_11517711 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005602|Ga0070762_11053401 | Not Available | 559 | Open in IMG/M |
3300005610|Ga0070763_10368074 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300005764|Ga0066903_103308119 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300005764|Ga0066903_104823762 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005844|Ga0068862_101238310 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300006028|Ga0070717_10741641 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300006046|Ga0066652_101496108 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300006173|Ga0070716_100246354 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300006852|Ga0075433_10486849 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300006854|Ga0075425_102077194 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300006871|Ga0075434_102546022 | Not Available | 512 | Open in IMG/M |
3300006914|Ga0075436_100895219 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300007255|Ga0099791_10279532 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300009038|Ga0099829_10313014 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300009088|Ga0099830_10157558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1751 | Open in IMG/M |
3300009094|Ga0111539_11218304 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300009100|Ga0075418_11996193 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300009147|Ga0114129_12120465 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300009147|Ga0114129_12404402 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300009551|Ga0105238_11687231 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300010040|Ga0126308_10846624 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300010041|Ga0126312_10370222 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300010046|Ga0126384_10440509 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300010048|Ga0126373_12577960 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300010159|Ga0099796_10114469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
3300010166|Ga0126306_10940175 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300010361|Ga0126378_13099156 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300010362|Ga0126377_10781739 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300010366|Ga0126379_13147632 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300010366|Ga0126379_13413435 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300010375|Ga0105239_12586617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 592 | Open in IMG/M |
3300010376|Ga0126381_101650252 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300010379|Ga0136449_100632043 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
3300010396|Ga0134126_10381644 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
3300010398|Ga0126383_13021810 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300010399|Ga0134127_10144714 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
3300012089|Ga0153924_1116219 | Not Available | 547 | Open in IMG/M |
3300012096|Ga0137389_10534077 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300012096|Ga0137389_11281821 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300012199|Ga0137383_10478159 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300012199|Ga0137383_10538648 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300012200|Ga0137382_11342530 | Not Available | 503 | Open in IMG/M |
3300012201|Ga0137365_10566340 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300012203|Ga0137399_11151443 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300012204|Ga0137374_11285866 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300012205|Ga0137362_10322019 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
3300012205|Ga0137362_11480851 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300012208|Ga0137376_10470351 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300012209|Ga0137379_11396091 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300012350|Ga0137372_11124792 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300012582|Ga0137358_10832870 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300012917|Ga0137395_10197511 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300012923|Ga0137359_10274194 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300012923|Ga0137359_11471470 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012925|Ga0137419_11833637 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300012929|Ga0137404_10450339 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300012930|Ga0137407_11982985 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012948|Ga0126375_10973734 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300012955|Ga0164298_10452353 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300012971|Ga0126369_10800424 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300012971|Ga0126369_11848284 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300012986|Ga0164304_10536744 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300012989|Ga0164305_10417138 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300014154|Ga0134075_10100193 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300014167|Ga0181528_10547510 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300014497|Ga0182008_10550704 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300014877|Ga0180074_1015660 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
3300014881|Ga0180094_1010738 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
3300015245|Ga0137409_10720475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
3300016294|Ga0182041_10789614 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300016319|Ga0182033_10331198 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300016319|Ga0182033_10895441 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300016357|Ga0182032_11983119 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300016371|Ga0182034_10647135 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300016387|Ga0182040_11289273 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300016422|Ga0182039_11233695 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300016445|Ga0182038_10516554 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300017659|Ga0134083_10004073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4573 | Open in IMG/M |
3300017924|Ga0187820_1147889 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300017932|Ga0187814_10216548 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300018064|Ga0187773_10713571 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300018084|Ga0184629_10286960 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300018429|Ga0190272_10541169 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300019377|Ga0190264_10343622 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300019886|Ga0193727_1014200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2986 | Open in IMG/M |
3300020140|Ga0179590_1220682 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300021046|Ga0215015_10099574 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300021046|Ga0215015_10437987 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300021078|Ga0210381_10005243 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
3300021180|Ga0210396_10240669 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300021474|Ga0210390_11275673 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300021560|Ga0126371_12243600 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300021560|Ga0126371_13288960 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300022915|Ga0247790_10179893 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300023261|Ga0247796_1089444 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300025917|Ga0207660_11596161 | Not Available | 526 | Open in IMG/M |
3300025922|Ga0207646_10234351 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
3300025922|Ga0207646_10555126 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300026296|Ga0209235_1181535 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300026298|Ga0209236_1264178 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300026532|Ga0209160_1084550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1660 | Open in IMG/M |
3300026536|Ga0209058_1199582 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300026551|Ga0209648_10091378 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
3300027527|Ga0209684_1014787 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300027567|Ga0209115_1104791 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300027873|Ga0209814_10456946 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300027882|Ga0209590_10135831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1510 | Open in IMG/M |
3300027884|Ga0209275_10759845 | Not Available | 559 | Open in IMG/M |
3300028047|Ga0209526_10977984 | Not Available | 508 | Open in IMG/M |
3300030496|Ga0268240_10109615 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300031198|Ga0307500_10265544 | Not Available | 534 | Open in IMG/M |
3300031544|Ga0318534_10804945 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031573|Ga0310915_10016443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4416 | Open in IMG/M |
3300031573|Ga0310915_11274080 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031708|Ga0310686_105885437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 1310 | Open in IMG/M |
3300031719|Ga0306917_10968546 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300031740|Ga0307468_100896634 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300031751|Ga0318494_10602592 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031754|Ga0307475_10678782 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300031788|Ga0302319_10406925 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
3300031793|Ga0318548_10449040 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300031833|Ga0310917_10792262 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300031912|Ga0306921_12222348 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031942|Ga0310916_10533589 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300031945|Ga0310913_10615061 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300031947|Ga0310909_11085483 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300031962|Ga0307479_11934163 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300032001|Ga0306922_10890917 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300032055|Ga0318575_10105310 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300032059|Ga0318533_10938604 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300032063|Ga0318504_10614850 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300032180|Ga0307471_101016711 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300032180|Ga0307471_102751262 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300032205|Ga0307472_102562163 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300032261|Ga0306920_100391884 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
3300032261|Ga0306920_103662022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 565 | Open in IMG/M |
3300032261|Ga0306920_104219946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 518 | Open in IMG/M |
3300032770|Ga0335085_12054790 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300032805|Ga0335078_10096745 | All Organisms → cellular organisms → Bacteria | 4271 | Open in IMG/M |
3300032892|Ga0335081_10220037 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
3300033289|Ga0310914_10963602 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300033405|Ga0326727_10526435 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300033433|Ga0326726_11011495 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300033475|Ga0310811_10158306 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.02% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.79% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.32% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.09% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.23% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.23% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.23% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.23% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.23% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.23% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.23% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.23% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.62% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.62% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.62% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.62% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459008 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F48_07482950 | 2170459008 | Grass Soil | HMPRAQALLLALRQFLPAVADPVLERSRNLYGASGAAG |
Ga0066688_107068201 | 3300005178 | Soil | EARVLETRLLSDYRPPFSMPRAQALLLALRQVLPTAADPVLQRSRTLYTGPRAAR* |
Ga0066388_1059786282 | 3300005332 | Tropical Forest Soil | SRYRPPFNMPRAQALLLALRQVLPTVADPVLQRSRNLYTAAAGAA* |
Ga0066388_1085470011 | 3300005332 | Tropical Forest Soil | PPFNMPRAQALLLALRQVLPTVADPVLQRSRTFYTASGLVP* |
Ga0070680_1019755142 | 3300005336 | Corn Rhizosphere | PFSMPPAQALLLALRQVVPTIANPVLQRSRELYTAGAAAR* |
Ga0008090_147856902 | 3300005363 | Tropical Rainforest Soil | ALEGQLLSDYREPFAMPRAQALLLALRQALPAVADPVLERSRELYVAAGAA* |
Ga0070713_1007749501 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ELLSRYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYIASGTL* |
Ga0070713_1021267542 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SDYRQPFEMPRAQALLLALRQVIPAVADPVLERSRTLYTASEAA* |
Ga0070705_1008132441 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RVLDNELLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA* |
Ga0070708_1003539562 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RLLSDYRQPFDMPRAQALLLALRQVLPTVADPVLQRSRSLYTASGAA* |
Ga0066686_103578772 | 3300005446 | Soil | SDYRPPFSMPRAQALLLGLRQILPTVADPVLQRSRNLYMASEADR* |
Ga0070698_1008105401 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA* |
Ga0070698_1010628211 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYSASGTA* |
Ga0070699_1015874292 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EARVLDNELLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA* |
Ga0070697_1012230081 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RALESKLLFNYQPPFDMPRAQALLLALRQVLPAVADPVLQRSRKLYRASGGP* |
Ga0070704_1006188791 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RLLSDYRPPFSMPRAQALLLALRQILPTAADPVLQRSRKLYMAAGG* |
Ga0066703_100081411 | 3300005568 | Soil | ARYRPPFKMPPSQALLLALRQFLPTVADPVLQRSRNLYTASAAAT* |
Ga0066706_115177111 | 3300005598 | Soil | PRAQALLLGLRQILPTVADPVLQRSRNLYMASEADR* |
Ga0070762_110534012 | 3300005602 | Soil | FRMPRAQSLLLALRQALPAVADPVLQRSRNLYAASAVA* |
Ga0070763_103680742 | 3300005610 | Soil | LESRLLSDYRPPFKMPRAQSLLLALRQVLPSVADPVLQRSRNLYTASALT* |
Ga0066903_1033081192 | 3300005764 | Tropical Forest Soil | VLESRLLSDYRPPFNMPRAQALLLALRQVLPTLADPVLHRSRNLYTASGAG* |
Ga0066903_1048237621 | 3300005764 | Tropical Forest Soil | QYRPPFNMPRSQALLLALRQFLPTLADPVLQHSRNLYTGSGSA* |
Ga0068862_1012383102 | 3300005844 | Switchgrass Rhizosphere | LSRYRPPFNMPRSQALLLAMRQFLPTVADPVLQRSRELYIASGTA* |
Ga0070717_107416412 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PVLESRLLSRYRPPFNMPPAQALLLALRQFLPTVADPVLRRSRELYSASGAA* |
Ga0066652_1014961082 | 3300006046 | Soil | DQLLSRYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYTAFGTA* |
Ga0070716_1002463542 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EGRVLESQLLSRYRPPFNMPRSQALLLALRQFLPTVADSVLQRSRELYAASGTA* |
Ga0075433_104868492 | 3300006852 | Populus Rhizosphere | SRLLSQYRPPYNMPRAQALLLALRQILPTVADPVLQRSRNLYTASGAA* |
Ga0075425_1020771942 | 3300006854 | Populus Rhizosphere | YRPPYNMPRAQALLLALRQILPTVADPVLQRSRNLYTASRAA* |
Ga0075434_1025460221 | 3300006871 | Populus Rhizosphere | PFNMPRAQALLLALRQTLPAIADTVLQRSRSLYAVPGASHDAAR* |
Ga0075436_1008952192 | 3300006914 | Populus Rhizosphere | PRAQALLLALRQILPTVADPVLQRSRTLYTASGAA* |
Ga0099791_102795321 | 3300007255 | Vadose Zone Soil | FKMPPSQALLLALRQFLPTVADPVLHRSRELYTASAAAR* |
Ga0099829_103130141 | 3300009038 | Vadose Zone Soil | EARVLESRLLSRYRPPFKMPPSQALLLALRQFLPTVADPVLHRSRELYTASAAAR* |
Ga0099830_101575581 | 3300009088 | Vadose Zone Soil | PPFKMPPSQALLLALRQFLPTVADPVLQRSRNLYTASAAAR* |
Ga0111539_112183042 | 3300009094 | Populus Rhizosphere | AQALLLALRQVLPTVADPVLQRSRKLYAASEAAR* |
Ga0075418_119961931 | 3300009100 | Populus Rhizosphere | RLLSGYRQAFDMPRAEALLLALRQVRPNVADAVLQRSGELYATSGAA* |
Ga0114129_121204651 | 3300009147 | Populus Rhizosphere | EGRVVESQLLSRYRPAFNMPRSQALLLALRQFLPTVADSVLQRSRELYAASGTA* |
Ga0114129_124044022 | 3300009147 | Populus Rhizosphere | SQYRPPYNMPRAQALLLALRQILPTVADPVLQRSRNLYTASEAA* |
Ga0105238_116872312 | 3300009551 | Corn Rhizosphere | KMPRAQALLLALRQVLPTVADPVLNRSRTLYAGSRAS* |
Ga0126308_108466241 | 3300010040 | Serpentine Soil | AGVLESKLLSQYRLPLNMPRAQALLLALRQVLPTVADTVLQSSRKLYTASGAAR* |
Ga0126312_103702221 | 3300010041 | Serpentine Soil | PRAQALLLALRQVLPKVADPVLQRSRELYSASGAA* |
Ga0126384_104405091 | 3300010046 | Tropical Forest Soil | PRAQALLLALRQIPPTVADPGLQRSRNLYTASRAA* |
Ga0126373_125779602 | 3300010048 | Tropical Forest Soil | SRYRPPYSMPRSEALLLALRQFLPTVADPVLRRSRELYSASDAA* |
Ga0099796_101144691 | 3300010159 | Vadose Zone Soil | GQLLSKYESPFNMPRAQALLLALRQALPEVAGPVLQRSRDLYTGSSAIK* |
Ga0126306_109401751 | 3300010166 | Serpentine Soil | SDLESRLLSDYQQSFKMPRAQALLLALREALPAVADSVLLRSRELYSEAA* |
Ga0126378_130991561 | 3300010361 | Tropical Forest Soil | MPRAQALLLALRQVFPAVADPVLERSRKLYFVSEAA* |
Ga0126377_107817392 | 3300010362 | Tropical Forest Soil | LEDRLLSEYRQAFDMPRAEALLLALRQVRPAVADRVLQRTGELYATSGAA* |
Ga0126379_131476321 | 3300010366 | Tropical Forest Soil | SDYRPPFNMPRAQALLLALRQVLPTVADPVLQRSRNLYSASGAVR* |
Ga0126379_134134352 | 3300010366 | Tropical Forest Soil | PDEARILEGRLLSQYRPPFKMPRSQALLLALRQVLPTVADPVLQRSRTLYTA* |
Ga0105239_125866171 | 3300010375 | Corn Rhizosphere | LTRYRPPFNMPHSQALLLALRQFLPTVADPVLQRSRELYTASGTA* |
Ga0126381_1016502522 | 3300010376 | Tropical Forest Soil | SRYRPPFNMPRSQALLLALRQFLPTLADPVLRRSRELYSASGAAR* |
Ga0136449_1006320435 | 3300010379 | Peatlands Soil | VLESQLLSRYRPPFNMPPAQALLLALRRFLPTVADPVLRRSRELYSAAGGA* |
Ga0134126_103816442 | 3300010396 | Terrestrial Soil | PPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGAA* |
Ga0126383_130218101 | 3300010398 | Tropical Forest Soil | RSQALLLALRQFLPTVADPVLQRSRELYTASGTV* |
Ga0134127_101447143 | 3300010399 | Terrestrial Soil | VLDNELLSRYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYAASGTA* |
Ga0153924_11162192 | 3300012089 | Attine Ant Fungus Gardens | SGYQAPFQMPPAQALLLALRQTLPTVAESVLAKSRHLYNAGPEHR* |
Ga0137389_105340771 | 3300012096 | Vadose Zone Soil | YRPPFNMPRAQALLLALRQILPTVADPVLQRSRNLYTASGAA* |
Ga0137389_112818211 | 3300012096 | Vadose Zone Soil | RPPFKMPPSQALLLALRQFLPTVADPVLHRSRELYTASAAAR* |
Ga0137383_104781591 | 3300012199 | Vadose Zone Soil | MPRAQALLLALHQVVPTVANPVLQRSRELYTAASGAAG* |
Ga0137383_105386482 | 3300012199 | Vadose Zone Soil | VLDNELLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA* |
Ga0137382_113425302 | 3300012200 | Vadose Zone Soil | EYSEPFSMPRAQALLLALREALPRVANPVLQRSRELYTAASGAAG* |
Ga0137365_105663401 | 3300012201 | Vadose Zone Soil | PFDMPRAQALLLALHQVVPTVANPVLQRSRELYTAASGAAG* |
Ga0137399_111514432 | 3300012203 | Vadose Zone Soil | YRPPFKMPPSQALLLALRQFLPTVADPVLQRSRNLYTASAAAR* |
Ga0137374_112858662 | 3300012204 | Vadose Zone Soil | RYRPPFNMPRSQALLLALRQFLPTVADPVLHRSRELYTASGTA* |
Ga0137362_103220192 | 3300012205 | Vadose Zone Soil | RAQALLLALRQVLPAVADPVLQRSRELYIASRAAR* |
Ga0137362_114808511 | 3300012205 | Vadose Zone Soil | PPFNMPRAQALLLGLRQILPTVADPVLQRSRNLYTASAAAR* |
Ga0137376_104703512 | 3300012208 | Vadose Zone Soil | LSRYRPPFNMPPAQALLLALRQFLPTVADPVLRRSRELYSAAGVA* |
Ga0137379_113960912 | 3300012209 | Vadose Zone Soil | RLLSDYRAPFDMPRAQALLLALRQVLPAVADPVLQRSRRLYSASGAAGAA* |
Ga0137372_111247921 | 3300012350 | Vadose Zone Soil | AQALLLGLRQILPTVADPVLQRSRNLYMASEADR* |
Ga0137358_108328701 | 3300012582 | Vadose Zone Soil | RYRPPFKMPPSQALLLALRQFLPTVADPVLQRSRDLYTASAAAR* |
Ga0137395_101975112 | 3300012917 | Vadose Zone Soil | FNMPRSQALLLALRQFLPTVADPVLRRSRELYTASGTA* |
Ga0137359_102741942 | 3300012923 | Vadose Zone Soil | RAQALLLALRQVLPAVADPVLQRSRELYVASGAAR* |
Ga0137359_114714702 | 3300012923 | Vadose Zone Soil | PDEARVLDNELLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA* |
Ga0137419_118336371 | 3300012925 | Vadose Zone Soil | MPPSQALLLALRQFLPTVADPVLQRSRDLYAASGAAR* |
Ga0137404_104503391 | 3300012929 | Vadose Zone Soil | SRYRPPFKMPPSQALLLALRQFLPTVADPVLQRSRDLYTASAAAR* |
Ga0137407_119829852 | 3300012930 | Vadose Zone Soil | LLSRYRPPFKMPPSQALLLALRQFLPTVADPVLQRSRDLYTASAAAT* |
Ga0126375_109737342 | 3300012948 | Tropical Forest Soil | SQYRPPYNMPRAQALLLALRQILPTVADPVLQRSRNLYTASGAA* |
Ga0164298_104523532 | 3300012955 | Soil | YRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYIASGTA* |
Ga0126369_108004241 | 3300012971 | Tropical Forest Soil | RPPFNMPRAQALLLALRQFLPTVADPVLRRSRELYAASGTA* |
Ga0126369_118482842 | 3300012971 | Tropical Forest Soil | LSDYRPPFNMPRAQALLLALRQVLPTVADPVLQRSRNLYTASGARL* |
Ga0164304_105367442 | 3300012986 | Soil | SRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYIASGTA* |
Ga0164305_104171382 | 3300012989 | Soil | RAEALLLALRQVRPSVADSVLQRSGELYAASGAG* |
Ga0134075_101001931 | 3300014154 | Grasslands Soil | RLLSRYRPPFKMPPSQALLLALRQFLPTVADPVLQRSRNLYTASAAAR* |
Ga0181528_105475102 | 3300014167 | Bog | ESRLLSDYRRPFDMPRAQALLLALRQVLPTVADPVLQRSRTLYAASQAV* |
Ga0182008_105507042 | 3300014497 | Rhizosphere | SEYQQPFDMPRGQALLLALRQVLPTVADPVLERSRDLYTASEAA* |
Ga0180074_10156601 | 3300014877 | Soil | EARVLETRLLSDYRPPFNMPRAQALLLALRQVLPSVADPVLLRSRKLYNASEAA* |
Ga0180094_10107381 | 3300014881 | Soil | LEGRLLSGYEPPFDMPRAQSLLLALRQLLPTVADSVLHRSRQLYTA* |
Ga0137409_107204752 | 3300015245 | Vadose Zone Soil | VDAADEGRVVESQLLSQYRPPFNMPRSQALLLALRQFLPTVADSVLQRSRE |
Ga0182041_107896141 | 3300016294 | Soil | RAEALLLALRRVLPAVADPVLQRSRNLYTASRPAP |
Ga0182033_103311982 | 3300016319 | Soil | DYRPPFNMPRAQALLLALRQVLPTVADPVLQRSRTFYTASGVVP |
Ga0182033_108954411 | 3300016319 | Soil | SRLLARYRPPFNMPPAQALLLALRQFLPTVADPVVRRSRELCSGAGAA |
Ga0182032_119831192 | 3300016357 | Soil | ESQLLSRYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYSASGAA |
Ga0182034_106471351 | 3300016371 | Soil | RYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYSASGAA |
Ga0182040_112892731 | 3300016387 | Soil | SRLLSDYRPPFSMPRAQALLLALRQVLPTVADPVLQRSRTFYTASGVVP |
Ga0182039_112336951 | 3300016422 | Soil | EAPALESRMLSDYRPPFVMPRAQALLLALRQVLPTLADPVLQLSRTLYLAAGRA |
Ga0182038_105165542 | 3300016445 | Soil | PPFNMPPAQALLLAMRQFLPTVADPVLRRSRELYSASGAP |
Ga0134083_100040731 | 3300017659 | Grasslands Soil | ARVLEGRLLSDYRAPFDMPRAQALLLALRQVLPTVADPVLQRSRRLYSASGAAGAA |
Ga0187820_11478891 | 3300017924 | Freshwater Sediment | MPRSQALLLALRQFLPTVADPVLRRSRDLYSASGAAR |
Ga0187814_102165481 | 3300017932 | Freshwater Sediment | EARVLESQLLSRYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYFASGAA |
Ga0187773_107135711 | 3300018064 | Tropical Peatland | EPFAMPRAQALLLALRQALPAVADPVLERSRELYVAAGAA |
Ga0184629_102869601 | 3300018084 | Groundwater Sediment | PPFSMPRAQALLLALRQALPTVADPVLQRSRNLYTASGADR |
Ga0190272_105411691 | 3300018429 | Soil | LLTDYQAPFKMPRAQALLLALRQVIPTVADSVLQRSRTLYTASGG |
Ga0190264_103436222 | 3300019377 | Soil | LLSDYAAPFKMPRAQALLLALRQVLPTVADPVLQRSRTLYSAREQGNDG |
Ga0193727_10142001 | 3300019886 | Soil | EGQILSRYPAPFHMPRPQALLLALRQVLPLVADAVLQRSRTLYAAS |
Ga0179590_12206821 | 3300020140 | Vadose Zone Soil | DEARVLDNELLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA |
Ga0215015_100995741 | 3300021046 | Soil | RQLESRLLSRYRPPFKMPPSQALLLALRQFLPTVADPVLQRSRSLYTAAAAA |
Ga0215015_104379871 | 3300021046 | Soil | MCIRDSSQALLLALRQFIPTVADPVLRRSRELYTASGTA |
Ga0210381_100052431 | 3300021078 | Groundwater Sediment | NRLLSNYQQPFQMPRAQALLLALRQVVPTVADPVLQRSRTLYNASQALA |
Ga0210396_102406692 | 3300021180 | Soil | ALESRLLSDYRPPFKMPRAQSLLLALRQVLPSVADPVLQRSRNLYTAPAVA |
Ga0210390_112756732 | 3300021474 | Soil | PPFKMPRAQSLLLALRQALPSVAEPVLQRSRNLYTASAVA |
Ga0126371_122436002 | 3300021560 | Tropical Forest Soil | VLEDRLLSEYRQTFDMPRAQALLLALRQVRPTVADRVLQRTGELYATSGAA |
Ga0126371_132889602 | 3300021560 | Tropical Forest Soil | DEALVLENRLLSHYQPPFNMPRSQALLLALRQFLPAVADSVLERSRNLYTTSRAA |
Ga0247790_101798932 | 3300022915 | Soil | PFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA |
Ga0247796_10894441 | 3300023261 | Soil | ELLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA |
Ga0207660_115961611 | 3300025917 | Corn Rhizosphere | LLSEYQQPFSMPPAQALLLALRQVVPTIANPVLQRSRELYTAGAAAR |
Ga0207646_102343512 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LSQYRPPYNMPRAQALLLALRQILPTVADPVLQRSRNLYTASGAA |
Ga0207646_105551262 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLESRLLSHYRPPFNMPRPQALLLALRQFLPTVADPVLQRSRDLYTAATAAR |
Ga0209235_11815352 | 3300026296 | Grasslands Soil | PFDMPRAQALLLALRQVLPAVADPVLQRSRKLYSPSGAAGAA |
Ga0209236_12641782 | 3300026298 | Grasslands Soil | EARVLESRLLSRYRPPFKMPPSQALLLALRQFLPTVADPVLQRSRNLYTASAAAR |
Ga0209160_10845502 | 3300026532 | Soil | PFKMPPSQALLLALRQFLPTVADPVLQRSRNLYTASAAAT |
Ga0209058_11995822 | 3300026536 | Soil | MPRAQTLLLALRQVLPAVADPVLQRCRRLYSASRAGR |
Ga0209648_100913784 | 3300026551 | Grasslands Soil | PRSQALLLALRQFLPTVADPVLRRSRELYTAFGTA |
Ga0209684_10147871 | 3300027527 | Tropical Forest Soil | SRLLSRYRPPFDMPRSQALLLALRQFLPTVADPVLRRSRELYCASGAA |
Ga0209115_11047911 | 3300027567 | Forest Soil | ADAGVLEGQLLTRYAAPFNMPRSQAMLLALRETLPLVADTVLQRSRNLYGGAAQST |
Ga0209814_104569461 | 3300027873 | Populus Rhizosphere | VLESRLLSQYRPPYNMPRAQALLLALRQILPTVADPVLQRSRNLYTASGAA |
Ga0209590_101358312 | 3300027882 | Vadose Zone Soil | LSRYRPPFKMPPSQALLLALRQFLPTVADPVLQRSRDLYTASAAAR |
Ga0209275_107598451 | 3300027884 | Soil | FRMPRAQSLLLALRQALPAVADPVLQRSRNLYAASAVA |
Ga0209526_109779841 | 3300028047 | Forest Soil | EARVLEGQLLSQYQAPFKMPRAQSLLLALRQVLPTVAEPVLKRSRSLYAESGAAR |
Ga0268240_101096152 | 3300030496 | Soil | VLETRLLSQYQPPFRMPRAQALLMALRQVLPTVADPVLQRSSSLYAASEAH |
Ga0307500_102655441 | 3300031198 | Soil | EDQLLSKYQAPFNMPRAQALLLALRQVLPEVAGPVLQRSRDLYTGASAIK |
Ga0318534_108049452 | 3300031544 | Soil | QLLSRYRPPFTMPRSEALLLALRQFLPSVADPVLRRSRELYSASGAA |
Ga0310915_100164431 | 3300031573 | Soil | HYRPPFNMPPAQALLLAMRQFLPTVADPVLRRSRELYSASGAP |
Ga0310915_112740801 | 3300031573 | Soil | SRYQPPFKMPRPQALLLALRQFLPAVADPVLRRSRELYSASGAA |
Ga0310686_1058854374 | 3300031708 | Soil | VLESQMLSRYWPPYSMPRSEALLLALRQFLPTVADPVLRRSRELYSASDAA |
Ga0306917_109685461 | 3300031719 | Soil | LLSDYRPPFNMPRAQALLLALRQVLPTVADPVLQRSRTFYTASGAVP |
Ga0307468_1008966341 | 3300031740 | Hardwood Forest Soil | QYQAPFNMPRAQALLLALRQVLPTIADPVLKRSRGLYAAES |
Ga0318494_106025922 | 3300031751 | Soil | LSRYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYSASGAA |
Ga0307475_106787821 | 3300031754 | Hardwood Forest Soil | LLSRYRPPFNMPPAQALLLALRQFLPTVADPVLRRSHELYSASGAAL |
Ga0302319_104069251 | 3300031788 | Bog | SDYRQPFNMPRAQALLLALRQVLPTVADPVLQRSRTLYAASQAV |
Ga0318548_104490401 | 3300031793 | Soil | LESQLLSRYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYSASGAA |
Ga0310917_107922622 | 3300031833 | Soil | QPPFNMPPAQAMLLALRRYLPAVANPVLRRSRELYAASGAA |
Ga0306921_122223481 | 3300031912 | Soil | NMPPAQALLLALRRFLPTVADPVLRRSRELYSASSAG |
Ga0310916_105335892 | 3300031942 | Soil | PVLESRLLSDYRPPFEMPRAEALLLALRRVLPAVADPVLQRSRNLYTASRPAP |
Ga0310913_106150611 | 3300031945 | Soil | NMPPAQALLLAMRQFLPTVADPVLRRSRELYSASGAP |
Ga0310909_110854832 | 3300031947 | Soil | FNMPRAQALLLALRQFLPTVADPVLRRSRELYAASGTA |
Ga0307479_119341631 | 3300031962 | Hardwood Forest Soil | RYRPPFNMPPAQALLLALRQFLPTVADPVLRRSRELYSAVGAA |
Ga0306922_108909172 | 3300032001 | Soil | LLSRYQPPFKMPRPQALLLALRQFLPAVADPVLRRSRELYSASGAA |
Ga0318575_101053102 | 3300032055 | Soil | PFNMPPAQALLLAMRQFLPTVADPVLRRSRELYSASGAP |
Ga0318533_109386042 | 3300032059 | Soil | LESRLLSRYRPPFNMPPAQALLLALRRFLPTVADPVLRRSRELYSASSAG |
Ga0318504_106148501 | 3300032063 | Soil | ESRLLSRYRPPFSMPPAQALLLAMRQFLPTVADPVLRRSRELYSASGAA |
Ga0307471_1010167112 | 3300032180 | Hardwood Forest Soil | ASVLESRLLSHYQPPFHMPRAQALLLALRQFLPAVADPVLERSRNLYGASGAAG |
Ga0307471_1027512621 | 3300032180 | Hardwood Forest Soil | LLFDYRPPYNMPRAQALLLALRQVLPAVAEPVLQRSRKLYSNSGGP |
Ga0307472_1025621631 | 3300032205 | Hardwood Forest Soil | RYRPPFNMPRPQALLLALRQFVPTIADPVLQRSRNLYTASGAAA |
Ga0306920_1003918841 | 3300032261 | Soil | PFEMPRAEALLLALRRVLPAVADPVLQRSRNLYSGPRAAP |
Ga0306920_1036620221 | 3300032261 | Soil | LSDYRPPFNMPRAQALLLALRQVLPTVADPVLQRSRTFYTASGVVP |
Ga0306920_1042199461 | 3300032261 | Soil | SRYQPPFNMPRSQALLLALRQFLPAVADPVLQRSRNLYTASRAA |
Ga0335085_120547902 | 3300032770 | Soil | RYRPPFNMPPAQAMLLALRRYLPAVADPVLRRSRELYAASGAA |
Ga0335078_100967457 | 3300032805 | Soil | EARVLESQLLSRYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYSASGAAR |
Ga0335081_102200371 | 3300032892 | Soil | ARVLESQLLSRYRPPFNMPRSQALLLALRQFLPTVADPVLRRSRELYSASGAAR |
Ga0310914_109636022 | 3300033289 | Soil | PRAQTLLLALRQVLPTVADPVLQLSRNLYSASGAVR |
Ga0326727_105264351 | 3300033405 | Peat Soil | QNEARVLTSRLLSEYKAPFNMPRAQALLQALCQAFPTIATPVLQRSRNLYTTVG |
Ga0326726_110114951 | 3300033433 | Peat Soil | ARVLESRLLSHYRPPFNMPRAQALLLALRQMLPAVADPVLQRSRNLYTVSGAG |
Ga0310811_101583061 | 3300033475 | Soil | LDSELLSRYRPPFNMPRSQALLLALRQFLPTVADPVLQRSRELYTASGTA |
⦗Top⦘ |