Metagenome / Metatranscriptome Family F039790

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F039790
Family Type	Metagenome / Metatranscriptome
Number of Sequences	163
Average Sequence Length	40 residues
Representative Sequence	DTVGQPPSAEIGVSNMPSLKAKKLRKLPQEKVLLEL
Number of Associated Samples	96
Number of Associated Scaffolds	163

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	11.18 %
% of genes near scaffold ends (potentially truncated)	88.34 %
% of genes from short scaffolds (< 2000 bps)	92.02 %
Associated GOLD sequencing projects	89
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (57.055 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (33.742 % of family members)
Environment Ontology (ENVO)	Unclassified (23.926 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (54.601 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 28.12% β-sheet: 0.00% Coil/Unstructured: 71.88%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.18
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 163 Family Scaffolds
PF01656	CbiA	1.84
PF05694	SBP56	1.84
PF00239	Resolvase	1.84
PF00078	RVT_1	1.84
PF04392	ABC_sub_bind	1.23
PF01348	Intron_maturas2	1.23
PF01548	DEDD_Tnp_IS110	1.23
PF13669	Glyoxalase_4	1.23
PF01844	HNH	1.23
PF13751	DDE_Tnp_1_6	0.61
PF13614	AAA_31	0.61
PF02452	PemK_toxin	0.61
PF14720	NiFe_hyd_SSU_C	0.61
PF02796	HTH_7	0.61
PF13384	HTH_23	0.61
PF00296	Bac_luciferase	0.61
PF02417	Chromate_transp	0.61
PF13546	DDE_5	0.61
PF13613	HTH_Tnp_4	0.61
PF03466	LysR_substrate	0.61
PF13358	DDE_3	0.61
PF11535	Calci_bind_CcbP	0.61
PF00484	Pro_CA	0.61
PF13649	Methyltransf_25	0.61
PF04326	AlbA_2	0.61
PF08241	Methyltransf_11	0.61
PF13340	DUF4096	0.61
PF01878	EVE	0.61
PF04014	MazE_antitoxin	0.61
PF07366	SnoaL	0.61
PF01593	Amino_oxidase	0.61
PF07452	CHRD	0.61
PF08028	Acyl-CoA_dh_2	0.61
PF06736	TMEM175	0.61
PF00140	Sigma70_r1_2	0.61
PF04075	F420H2_quin_red	0.61
PF14706	Tnp_DNA_bind	0.61
PF12680	SnoaL_2	0.61
PF05598	DUF772	0.61
PF01710	HTH_Tnp_IS630	0.61
PF03050	DDE_Tnp_IS66	0.61
PF01135	PCMT	0.61
PF13586	DDE_Tnp_1_2	0.61
PF13701	DDE_Tnp_1_4	0.61
PF02371	Transposase_20	0.61
PF03150	CCP_MauG	0.61
PF13604	AAA_30	0.61
PF03992	ABM	0.61
PF12706	Lactamase_B_2	0.61
PF00589	Phage_integrase	0.61
PF00563	EAL	0.61
PF13551	HTH_29	0.61

COG ID	Name	Functional Category	% Frequency in 163 Family Scaffolds
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	1.84
COG3547	Transposase	Mobilome: prophages, transposons [X]	1.84
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	1.84
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.23
COG2518	Protein-L-isoaspartate O-methyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.61
COG5001	Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain	Signal transduction mechanisms [T]	0.61
COG4943	Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains	Signal transduction mechanisms [T]	0.61
COG4122	tRNA 5-hydroxyU34 O-methylase TrmR/YrrM	Translation, ribosomal structure and biogenesis [J]	0.61
COG3548	Uncharacterized membrane protein	Function unknown [S]	0.61
COG3436	Transposase	Mobilome: prophages, transposons [X]	0.61
COG3434	c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains	Signal transduction mechanisms [T]	0.61
COG3415	CRISPR-associated protein Csa3, CARF domain	Defense mechanisms [V]	0.61
COG2947	Predicted RNA-binding protein, contains EVE domain	General function prediction only [R]	0.61
COG2865	Predicted transcriptional regulator, contains HTH domain	Transcription [K]	0.61
COG2519	tRNA A58 N-methylase Trm61	Translation, ribosomal structure and biogenesis [J]	0.61
COG0288	Carbonic anhydrase	Inorganic ion transport and metabolism [P]	0.61
COG2337	mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module	Defense mechanisms [V]	0.61
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.61
COG2200	EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)	Signal transduction mechanisms [T]	0.61
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.61
COG2059	Chromate transport protein ChrA	Inorganic ion transport and metabolism [P]	0.61
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.61
COG1858	Cytochrome c peroxidase	Posttranslational modification, protein turnover, chaperones [O]	0.61
COG1673	Predicted RNA-binding protein, contains PUA-like EVE domain	General function prediction only [R]	0.61
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.61

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
All Organisms	root	All Organisms	42.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
cellular organisms	root	All Organisms → cellular organisms	42.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	42.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	7.36 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.36 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.84 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	1.84 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.23 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.23 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	3.68 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.84 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	1.84 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.23 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.23 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.23 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.23 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.61 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.61 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.61 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3.68 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	1.84 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1.23 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	0.61 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.61 %
Candidatus Brocadiia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia	0.61 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	0.61 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.61 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.61 %
candidate division KSB3	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB3	0.61 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	0.61 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.61 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	2.45 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	0.61 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	0.61 %
candidate division KSB3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB3 → candidate division KSB3 bacterium	0.61 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	0.61 %
unclassified Candidatus Brocadiae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae	0.61 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.61 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.61 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.61 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.61 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.61 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.61 %
Thermomicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales	0.61 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.61 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.61 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.45 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.61 %
Rhizobiales bacterium GAS191	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191	0.61 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.61 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	0.61 %
Candidatus Brocadiae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium	0.61 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.61 %
Ralstonia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia	0.61 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.61 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples	0.61 %
unclassified Desulfuromonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales	0.61 %
Edaphobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter	0.61 %
candidate division KSB3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB3 → candidate division KSB3 bacterium	0.61 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.61 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.61 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.45 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.61 %
Desulfuromonadales bacterium C00003107	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium C00003107	0.61 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.61 %
Archangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae	0.61 %
Ralstonia pickettii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii	0.61 %
Edaphobacter aggregans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans	0.61 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.61 %
Rhizobiales bacterium GAS191	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191	0.61 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.61 %
Candidatus Brocadiae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium	0.61 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.61 %
candidate division KSB3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB3 → candidate division KSB3 bacterium	0.61 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.61 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.61 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.45 %
Stigmatella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella	0.61 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.61 %
Desulfuromonadales bacterium C00003107	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium C00003107	0.61 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.61 %
Ralstonia pickettii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii	0.61 %
Edaphobacter aggregans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans	0.61 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.61 %
Rhizobiales bacterium GAS191	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191	0.61 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.61 %
Candidatus Brocadiae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium	0.61 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.61 %
candidate division KSB3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB3 → candidate division KSB3 bacterium	0.61 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.61 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.61 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.06 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.45 %
Stigmatella aurantiaca	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca	0.61 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.61 %
Desulfuromonadales bacterium C00003107	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium C00003107	0.61 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.61 %
Ralstonia pickettii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii	0.61 %
Edaphobacter aggregans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans	0.61 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.61 %
Rhizobiales bacterium GAS191	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191	0.61 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.61 %
Candidatus Brocadiae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium	0.61 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.61 %
candidate division KSB3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB3 → candidate division KSB3 bacterium	0.61 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.61 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.61 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.61 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004633\|Ga0066395_10407358	Not Available	767	Open in IMG/M
3300005166\|Ga0066674_10303824	Not Available	750	Open in IMG/M
3300005289\|Ga0065704_10314357	Not Available	863	Open in IMG/M
3300005295\|Ga0065707_10024960	Not Available	1196	Open in IMG/M
3300005332\|Ga0066388_102199398	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300005332\|Ga0066388_104391627	Not Available	718	Open in IMG/M
3300005332\|Ga0066388_105418279	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300005347\|Ga0070668_100672021	Not Available	911	Open in IMG/M
3300005445\|Ga0070708_100242331	All Organisms → cellular organisms → Bacteria	1693	Open in IMG/M
3300005562\|Ga0058697_10433147	Not Available	658	Open in IMG/M
3300005574\|Ga0066694_10197416	Not Available	955	Open in IMG/M
3300005598\|Ga0066706_11191958	All Organisms → cellular organisms → Bacteria → Terrabacteria group	579	Open in IMG/M
3300005713\|Ga0066905_100515698	Not Available	997	Open in IMG/M
3300005713\|Ga0066905_101955964	Not Available	543	Open in IMG/M
3300005719\|Ga0068861_100579890	Not Available	1026	Open in IMG/M
3300005764\|Ga0066903_100469567	All Organisms → cellular organisms → Bacteria	2114	Open in IMG/M
3300005764\|Ga0066903_100472786	All Organisms → cellular organisms → Bacteria	2108	Open in IMG/M
3300005764\|Ga0066903_103207659	Not Available	884	Open in IMG/M
3300005764\|Ga0066903_107437298	All Organisms → cellular organisms → Bacteria → Proteobacteria	565	Open in IMG/M
3300005764\|Ga0066903_108515322	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300005842\|Ga0068858_101488467	Not Available	667	Open in IMG/M
3300006032\|Ga0066696_10551668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii	753	Open in IMG/M
3300006032\|Ga0066696_10831444	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300006049\|Ga0075417_10036933	All Organisms → cellular organisms → Bacteria	2054	Open in IMG/M
3300006049\|Ga0075417_10066635	Not Available	1586	Open in IMG/M
3300006049\|Ga0075417_10072299	Not Available	1528	Open in IMG/M
3300006049\|Ga0075417_10138676	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB3 → candidate division KSB3 bacterium	1126	Open in IMG/M
3300006049\|Ga0075417_10369111	Not Available	706	Open in IMG/M
3300006049\|Ga0075417_10415001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191	668	Open in IMG/M
3300006049\|Ga0075417_10483768	Not Available	620	Open in IMG/M
3300006058\|Ga0075432_10208321	All Organisms → cellular organisms → Bacteria → PVC group	777	Open in IMG/M
3300006173\|Ga0070716_100389577	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	998	Open in IMG/M
3300006173\|Ga0070716_101521223	Not Available	548	Open in IMG/M
3300006194\|Ga0075427_10012507	Not Available	1288	Open in IMG/M
3300006844\|Ga0075428_100351309	Not Available	1582	Open in IMG/M
3300006844\|Ga0075428_100806886	Not Available	997	Open in IMG/M
3300006844\|Ga0075428_100905409	Not Available	935	Open in IMG/M
3300006844\|Ga0075428_101106963	Not Available	836	Open in IMG/M
3300006844\|Ga0075428_101288728	All Organisms → cellular organisms → Bacteria	769	Open in IMG/M
3300006845\|Ga0075421_100322883	All Organisms → cellular organisms → Bacteria	1871	Open in IMG/M
3300006845\|Ga0075421_101557402	Not Available	721	Open in IMG/M
3300006845\|Ga0075421_101908453	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300006845\|Ga0075421_102347429	Not Available	559	Open in IMG/M
3300006845\|Ga0075421_102740486	Not Available	509	Open in IMG/M
3300006846\|Ga0075430_100211429	All Organisms → cellular organisms → Bacteria	1609	Open in IMG/M
3300006847\|Ga0075431_100227696	All Organisms → cellular organisms → Bacteria	1900	Open in IMG/M
3300006847\|Ga0075431_100512621	Not Available	1189	Open in IMG/M
3300006852\|Ga0075433_10214697	All Organisms → cellular organisms → Bacteria	1709	Open in IMG/M
3300006852\|Ga0075433_10786576	Not Available	832	Open in IMG/M
3300006853\|Ga0075420_100318514	Not Available	1347	Open in IMG/M
3300006853\|Ga0075420_101078842	Not Available	691	Open in IMG/M
3300006853\|Ga0075420_101276489	Not Available	630	Open in IMG/M
3300006854\|Ga0075425_101722257	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300006871\|Ga0075434_100900726	All Organisms → cellular organisms → Bacteria → Terrabacteria group	899	Open in IMG/M
3300006871\|Ga0075434_102534898	Not Available	514	Open in IMG/M
3300006904\|Ga0075424_100224223	All Organisms → cellular organisms → Bacteria → Proteobacteria	1997	Open in IMG/M
3300006904\|Ga0075424_100589168	Not Available	1187	Open in IMG/M
3300006904\|Ga0075424_101287426	Not Available	777	Open in IMG/M
3300006914\|Ga0075436_100439737	Not Available	948	Open in IMG/M
3300006969\|Ga0075419_10131001	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1629	Open in IMG/M
3300007790\|Ga0105679_10526868	All Organisms → cellular organisms → Bacteria → Proteobacteria	1420	Open in IMG/M
3300009090\|Ga0099827_10592729	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	955	Open in IMG/M
3300009090\|Ga0099827_11744854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	542	Open in IMG/M
3300009094\|Ga0111539_12953012	Not Available	550	Open in IMG/M
3300009094\|Ga0111539_13284937	Not Available	521	Open in IMG/M
3300009100\|Ga0075418_10165907	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2351	Open in IMG/M
3300009100\|Ga0075418_10615200	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1169	Open in IMG/M
3300009100\|Ga0075418_12656931	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	547	Open in IMG/M
3300009100\|Ga0075418_12668714	Not Available	545	Open in IMG/M
3300009100\|Ga0075418_12696574	Not Available	543	Open in IMG/M
3300009100\|Ga0075418_12987874	Not Available	516	Open in IMG/M
3300009137\|Ga0066709_102830059	Not Available	643	Open in IMG/M
3300009147\|Ga0114129_10299955	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium C00003107	2142	Open in IMG/M
3300009147\|Ga0114129_10723835	Not Available	1277	Open in IMG/M
3300009156\|Ga0111538_12701489	Not Available	622	Open in IMG/M
3300009156\|Ga0111538_13589499	Not Available	538	Open in IMG/M
3300009156\|Ga0111538_13691556	Not Available	530	Open in IMG/M
3300009162\|Ga0075423_10543194	All Organisms → cellular organisms → Bacteria	1223	Open in IMG/M
3300009162\|Ga0075423_12172654	Not Available	603	Open in IMG/M
3300009545\|Ga0105237_11714293	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300009553\|Ga0105249_10123170	All Organisms → cellular organisms → Bacteria	2467	Open in IMG/M
3300009553\|Ga0105249_10263381	Not Available	1714	Open in IMG/M
3300009553\|Ga0105249_10424512	All Organisms → cellular organisms → Bacteria	1364	Open in IMG/M
3300009553\|Ga0105249_11572182	Not Available	730	Open in IMG/M
3300009789\|Ga0126307_11394213	Not Available	568	Open in IMG/M
3300009792\|Ga0126374_10667798	Not Available	777	Open in IMG/M
3300009811\|Ga0105084_1093790	Not Available	562	Open in IMG/M
3300009837\|Ga0105058_1150406	Not Available	565	Open in IMG/M
3300010041\|Ga0126312_10630318	Not Available	772	Open in IMG/M
3300010041\|Ga0126312_10689490	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300010041\|Ga0126312_11143177	Not Available	573	Open in IMG/M
3300010043\|Ga0126380_10198858	Not Available	1340	Open in IMG/M
3300010046\|Ga0126384_11422689	Not Available	647	Open in IMG/M
3300010046\|Ga0126384_12089040	Not Available	543	Open in IMG/M
3300010046\|Ga0126384_12101023	All Organisms → cellular organisms → Bacteria → Terrabacteria group	542	Open in IMG/M
3300010047\|Ga0126382_12332624	Not Available	518	Open in IMG/M
3300010047\|Ga0126382_12519713	All Organisms → cellular organisms → Bacteria → Terrabacteria group	502	Open in IMG/M
3300010145\|Ga0126321_1071032	All Organisms → cellular organisms → Bacteria	1690	Open in IMG/M
3300010145\|Ga0126321_1074832	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2845	Open in IMG/M
3300010303\|Ga0134082_10542961	Not Available	511	Open in IMG/M
3300010322\|Ga0134084_10195523	All Organisms → cellular organisms → Bacteria → Terrabacteria group	705	Open in IMG/M
3300010358\|Ga0126370_11453053	Not Available	650	Open in IMG/M
3300010359\|Ga0126376_10718773	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca	964	Open in IMG/M
3300010359\|Ga0126376_13013838	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300010361\|Ga0126378_13092354	Not Available	530	Open in IMG/M
3300010362\|Ga0126377_10869813	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	963	Open in IMG/M
3300010362\|Ga0126377_12515905	Not Available	590	Open in IMG/M
3300010362\|Ga0126377_12988540	Not Available	546	Open in IMG/M
3300010362\|Ga0126377_13329479	Not Available	519	Open in IMG/M
3300010366\|Ga0126379_11700553	Not Available	736	Open in IMG/M
3300010366\|Ga0126379_13194049	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300010366\|Ga0126379_13726419	Not Available	511	Open in IMG/M
3300010398\|Ga0126383_11918902	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	680	Open in IMG/M
3300010398\|Ga0126383_12033887	Not Available	662	Open in IMG/M
3300010398\|Ga0126383_12762718	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300011270\|Ga0137391_10104985	All Organisms → cellular organisms → Bacteria	2448	Open in IMG/M
3300012203\|Ga0137399_10824462	Not Available	781	Open in IMG/M
3300012212\|Ga0150985_108887986	All Organisms → cellular organisms → Bacteria → Terrabacteria group	974	Open in IMG/M
3300012349\|Ga0137387_11128092	Not Available	557	Open in IMG/M
3300012356\|Ga0137371_10355386	All Organisms → cellular organisms → Bacteria	1138	Open in IMG/M
3300012359\|Ga0137385_10454518	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1087	Open in IMG/M
3300012361\|Ga0137360_10165064	All Organisms → cellular organisms → Bacteria	1769	Open in IMG/M
3300012363\|Ga0137390_11638478	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300012469\|Ga0150984_106155611	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	776	Open in IMG/M
3300012506\|Ga0157324_1052249	Not Available	535	Open in IMG/M
3300012922\|Ga0137394_10802628	Not Available	789	Open in IMG/M
3300012930\|Ga0137407_12108374	Not Available	538	Open in IMG/M
3300012971\|Ga0126369_11127559	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300012971\|Ga0126369_12514134	Not Available	600	Open in IMG/M
3300012971\|Ga0126369_13583946	Not Available	509	Open in IMG/M
3300013306\|Ga0163162_10536102	Not Available	1299	Open in IMG/M
3300013306\|Ga0163162_12312905	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	617	Open in IMG/M
3300015372\|Ga0132256_102164570	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	661	Open in IMG/M
3300015373\|Ga0132257_100336255	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1822	Open in IMG/M
3300015373\|Ga0132257_104152300	Not Available	527	Open in IMG/M
3300016357\|Ga0182032_10552355	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300016387\|Ga0182040_10653797	Not Available	856	Open in IMG/M
3300016422\|Ga0182039_10779007	Not Available	848	Open in IMG/M
3300016445\|Ga0182038_10907650	Not Available	776	Open in IMG/M
3300016445\|Ga0182038_12025672	Not Available	521	Open in IMG/M
3300018076\|Ga0184609_10255471	Not Available	819	Open in IMG/M
3300018433\|Ga0066667_11300139	Not Available	635	Open in IMG/M
3300018468\|Ga0066662_12552083	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	539	Open in IMG/M
3300019356\|Ga0173481_10462669	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	637	Open in IMG/M
3300021073\|Ga0210378_10233789	Not Available	698	Open in IMG/M
3300022195\|Ga0222625_1682486	All Organisms → cellular organisms → Bacteria	1579	Open in IMG/M
3300026358\|Ga0257166_1001896	Not Available	2041	Open in IMG/M
3300027577\|Ga0209874_1131969	Not Available	575	Open in IMG/M
3300027873\|Ga0209814_10065929	Not Available	1518	Open in IMG/M
3300027880\|Ga0209481_10382837	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium	720	Open in IMG/M
3300027903\|Ga0209488_10035752	All Organisms → cellular organisms → Bacteria	3629	Open in IMG/M
3300027903\|Ga0209488_10719376	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	714	Open in IMG/M
3300027907\|Ga0207428_10155847	All Organisms → cellular organisms → Bacteria	1737	Open in IMG/M
3300027907\|Ga0207428_10881997	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans	633	Open in IMG/M
3300027909\|Ga0209382_10871175	All Organisms → cellular organisms → Bacteria	951	Open in IMG/M
3300028608\|Ga0247819_10612748	Not Available	657	Open in IMG/M
3300031114\|Ga0308187_10010782	Not Available	1871	Open in IMG/M
3300031796\|Ga0318576_10045379	Not Available	1886	Open in IMG/M
3300031995\|Ga0307409_100019347	All Organisms → cellular organisms → Bacteria	4607	Open in IMG/M
3300032002\|Ga0307416_100236103	Not Available	1767	Open in IMG/M
3300033551\|Ga0247830_10335895	Not Available	1165	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	53.99%
Host-Associated	Host-Associated	46.01%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	50.92%
Plants	Host-Associated → Plants	46.01%
Aquatic	Environmental → Aquatic	3.07%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere	39.88%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.52%
Freshwater	Environmental → Aquatic → Freshwater	2.45%
Sediment	Environmental → Aquatic → Sediment	0.61%
Phylloplane	Host-Associated → Plants → Phylloplane	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	38.04%
Loam	Environmental → Terrestrial → Soil → Loam	8.59%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.07%
Sand	Environmental → Terrestrial → Soil → Sand	2.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.45%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.84%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.23%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.23%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.61%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	38.04%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.45%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.75%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.29%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.91%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.07%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.45%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.84%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.84%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.23%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.23%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.23%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.61%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.61%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	33.74%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	15.34%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.98%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	6.75%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.45%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.84%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.84%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.84%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.23%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	1.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.23%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.23%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.23%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.23%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.23%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.23%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.61%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.61%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.61%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.61%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.61%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.61%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.61%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.61%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.61%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006194	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007790	Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009811	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010145	Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012506	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610	Host-Associated	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental	Open in IMG/M
3300022195	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300026358	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B	Environmental	Open in IMG/M
3300027577	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028608	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6	Environmental	Open in IMG/M
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031796	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0066395_104073581	3300004633	Tropical Forest Soil	KRADTVGQPPSAEIGVLNMPSLKAKKLRKPSQEKVLLEL*
Ga0066674_103038241	3300005166	Soil	LKKGRDTVGELTSAEMCVSHMPSWKAKKLGKLTQEKVLPEL*
Ga0065704_103143571	3300005289	Switchgrass Rhizosphere	TYGVDEKRPDTVGELKSANICVSHMPSWKAKKRGRLPQENVLLEL*
Ga0065707_100249601	3300005295	Switchgrass Rhizosphere	KRPDTVGEPRSVEICLSNMPSLKAKKRGKCAPEKVLLEP*
Ga0066388_1021993981	3300005332	Tropical Forest Soil	MSLKLHDTVGELGSAVLCVSYMSSLKAKKLEKLTREKAVLER*
Ga0066388_1043916272	3300005332	Tropical Forest Soil	SVPIRKRPDTVGELRSAKICMSYMPSLKARKLEMLAPEKVVLER*
Ga0066388_1054182791	3300005332	Tropical Forest Soil	KRPDTVGQPPSAEIGVLNMPFLQAKKLRKPSQEKVLLEL*
Ga0070668_1006720213	3300005347	Switchgrass Rhizosphere	MARSQHVENLPDTVGELRTAEFCVSYMPSLKAKKLEKLTQEKAVLER*
Ga0070708_1002423312	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	CLTKPPDTVGELKSADMCVSHMPSVKAKKRGKRAQDKVLLEP*
Ga0058697_104331471	3300005562	Agave	DTVGQPPSTEIGVLNMSSWKAKKLRKFPQEKVLLEL*
Ga0066694_101974163	3300005574	Soil	DTVGELKSAEIYVSDMPSLKAKKLGKLPQEEVLLEL*
Ga0066706_111919582	3300005598	Soil	DTVGELGSAEICVSHMPSWKAKKLGKLTQEKVLLEL*
Ga0066905_1005156982	3300005713	Tropical Forest Soil	DTVGQPPSAEICVYNMPSLEVKKLWKLTQEKVLLEL*
Ga0066905_1019559641	3300005713	Tropical Forest Soil	DTVGQPPGTEISVSTMPSWKAKKLGKLPQEKVLLEL*
Ga0068861_1005798901	3300005719	Switchgrass Rhizosphere	PDTVGELRTAEFCVSYMPSLKAKKLEKLTQEKAVLER*
Ga0066903_1004695674	3300005764	Tropical Forest Soil	VHDKRPDTVGQPLSTEISVPNIPSLKAKKLIKLSREKVLLEL*
Ga0066903_1004727861	3300005764	Tropical Forest Soil	PDTVGQPPSTEIGVAIMPTLKAKRLRKPPQEKVLLEL*
Ga0066903_1032076592	3300005764	Tropical Forest Soil	DTVGQPPSAEIGVLNMPSLKAKKLRKPSQEKVLLEL*
Ga0066903_1074372981	3300005764	Tropical Forest Soil	MHENRPDTVGQPSSAEIRVANMPSLKAKKLGKLPREKVLLEL*
Ga0066903_1085153222	3300005764	Tropical Forest Soil	DTVGQPPDTEIGVPNIPSLKAKKLGKLPREKVLLEL*
Ga0068858_1014884672	3300005842	Switchgrass Rhizosphere	DTVGEPRSVEICLSNMPSLKAKKRGKCAPEKVLLEP*
Ga0066696_105516683	3300006032	Soil	DTVGELKSAEICGSHMPSLKAKKLGELAPEKVLLEL*
Ga0066696_108314441	3300006032	Soil	VSKKRADTVGQPPSTEIGVSNMPSLKAKKLRKLPREKVLLEL*
Ga0075417_100369335	3300006049	Populus Rhizosphere	MSTKRADTVGQPPGAEICVSNMPALKAKKLGKLPQEKVL
Ga0075417_100666351	3300006049	Populus Rhizosphere	MTGESLSLTKRLDTVGQPPGTKIGVPNMPSLKAKKLRKLPREKVLLEL*
Ga0075417_100722992	3300006049	Populus Rhizosphere	DTVGELKSAEICVSHIPSLKAKNLGKLPQEKVLLEL*
Ga0075417_101386761	3300006049	Populus Rhizosphere	PDTVGQPPSTEIGVPNMPSLKAKKLSKLPREKVLLEP*
Ga0075417_103691112	3300006049	Populus Rhizosphere	DTVGELGSAEICVSHMPAWKAKKLETLTQEKVLLER*
Ga0075417_104150011	3300006049	Populus Rhizosphere	TDTVGQPPSTEIGVPNMPSLKAKKLRKLPQEKVLLEL*
Ga0075417_104837682	3300006049	Populus Rhizosphere	DTVGQPPSTEIGVPNMPALKAKKLRKLPQEKVLLEL*
Ga0075432_102083211	3300006058	Populus Rhizosphere	KRPDTVGELKSAEIGVSQMPSLKAKKRGKRVQEKVLLEP*
Ga0070716_1003895772	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	DTVGQPPSAEIGVSNMPSLKAKKLRKLPQEKVLLEL*
Ga0070716_1015212231	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	DTVGELKSAEICVSHMPSWKAKKLGKLTQEKVLLEL*
Ga0075427_100125072	3300006194	Populus Rhizosphere	PDTVGEPPSAEMGVSHMPSLKAKTLGKLTQEKVLLEL*
Ga0075428_1003513092	3300006844	Populus Rhizosphere	MSRFIHVLDYRPDTVGEFKSAEICVSHMPSWKAKKPGKLTQEKVLLEFE
Ga0075428_1008068862	3300006844	Populus Rhizosphere	MHEKRSDTVGQPPGAEICVSNMPSKKAKKLEKISQEKVLLEP*
Ga0075428_1009054091	3300006844	Populus Rhizosphere	MVLLRLPHELSSISLEKRTDTVGQPPSTEIGVLNMPSWKAKKLGKLSQEKVLLEL*
Ga0075428_1011069631	3300006844	Populus Rhizosphere	DTVGQPPRAEICVPNMPSWKAKKLRKLPQEKVLLEL*
Ga0075428_1012887281	3300006844	Populus Rhizosphere	TDTVGQPPSTEIGVLNMPSLKAKKLRKLPRDKVLLEL*
Ga0075421_1003228831	3300006845	Populus Rhizosphere	RPDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEL*
Ga0075421_1015574021	3300006845	Populus Rhizosphere	KKRADTVGQPPSTEIGVSNMPSLKAKKLRQLPRDKVLLEL*
Ga0075421_1019084532	3300006845	Populus Rhizosphere	TDTVGQPPSTEIGVPNMPSLKAKKLGKLAQEKVLLER*
Ga0075421_1023474291	3300006845	Populus Rhizosphere	VRTKRADTVGEFKSAEMGVLYLPALKAKKRGKLAQEKVL
Ga0075421_1027404862	3300006845	Populus Rhizosphere	DTVGELKSAEICVSHMPAWKAKKLGTLAQEKVLLEP*
Ga0075430_1002114293	3300006846	Populus Rhizosphere	RPDTVGELGSAEICVSHMPAWKAKKLETLTQEKVLLER*
Ga0075431_1002276962	3300006847	Populus Rhizosphere	DTVGEPPSAEMGVSHMPSLKAKTLGKLTQEKVLLEL*
Ga0075431_1005126213	3300006847	Populus Rhizosphere	KRADTVGQPQSTEMGVPNMLSLKAKKLRKLLQAKVLLER*
Ga0075433_102146973	3300006852	Populus Rhizosphere	PDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEL*
Ga0075433_107865762	3300006852	Populus Rhizosphere	DTVGEFKSAEICVSHMPSWMAKTLGKLTQEKALLEP*
Ga0075420_1003185141	3300006853	Populus Rhizosphere	MTGESLSLTKRLDTVGQPPSTKIGVPNMPSLKAKKLSKLPREKVLLEL*
Ga0075420_1010788422	3300006853	Populus Rhizosphere	DTVGEFKSAEMGVPHMPAWKAKTLGKLTQERVLLEP*
Ga0075420_1012764892	3300006853	Populus Rhizosphere	RPDTVGEPPSAEICVSHMPAWKAKKLGKLLQEKVLLEL*
Ga0075425_1017222571	3300006854	Populus Rhizosphere	KRPDTVGQPPRTEIGVLNMPSLKAKKLRNLPREKVLLEP*
Ga0075434_1009007263	3300006871	Populus Rhizosphere	LTNSIRADTVGQPPSTEIGVPNMPSWKAKKPGKLTQEKVLLE
Ga0075434_1025348981	3300006871	Populus Rhizosphere	KRPDTVGQPPGAEICVSNMPALKAKKLGKLPQEKVLLEL*
Ga0075424_1002242234	3300006904	Populus Rhizosphere	LSLENPPDTVGEPPSAEMGVSHMPSLKAKTLGKLTQEKVLLE
Ga0075424_1005891681	3300006904	Populus Rhizosphere	DTVGEFKSAEMCVSHMPALKAKKRRKLAQEKVLLEP*
Ga0075424_1012874262	3300006904	Populus Rhizosphere	MKRSDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEFE
Ga0075436_1004397371	3300006914	Populus Rhizosphere	TVGEFKSAEICVSHLPSKKAKKLGKLAPEKVLLEL*
Ga0075419_101310012	3300006969	Populus Rhizosphere	DTVGQPPSAEICVSNMPSLKAKKLRKLPRDKVLLEL*
Ga0105679_105268682	3300007790	Soil	MLMPEKRADTVGELKSAEIYVFDMPSWQALKLGKPSQEKVLLEL*
Ga0099827_105927291	3300009090	Vadose Zone Soil	MSLLEAQSKKRPDTVGELRSAEICVSYMPSLKAKKLEKLTQEKAVLER*
Ga0099827_117448542	3300009090	Vadose Zone Soil	TVGQPPSAEIYVSNMPALKAKKLGKLPQEKVLLEL*
Ga0111539_129530121	3300009094	Populus Rhizosphere	MKVRESLPKPPDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVL
Ga0111539_132849372	3300009094	Populus Rhizosphere	RVDTVGQPPSTEIGVLNMSSGKAKKLRKLPQEKVLLEL*
Ga0075418_101659071	3300009100	Populus Rhizosphere	MLTNSLTKGGDTVGQPPGAEICVSNMPSKKAKKLEKISQEK
Ga0075418_106152002	3300009100	Populus Rhizosphere	MGLEKPPDTVGEPPSAEICVSHMPAWKAKKLGKLLQEKVLLEL*
Ga0075418_126569312	3300009100	Populus Rhizosphere	GDTVGQPPSTEIGVLNMSSWKAKKLRKLPQEKVLLEL*
Ga0075418_126687142	3300009100	Populus Rhizosphere	DTVGQPPSTEIGMPNMPSLKAKKLSKLPREKVLLEL*
Ga0075418_126965741	3300009100	Populus Rhizosphere	DTVGQPPSAEIGVPNLPSLKAKRLSKLPRENVLLEL*
Ga0075418_129878742	3300009100	Populus Rhizosphere	LEDREKVTDTVGQPPSAEIGVSNIPSLKAKKLRKLLQEEVLLEL*
Ga0066709_1028300591	3300009137	Grasslands Soil	KRPDTVGQPPSTEISVLNMPSLKAKKLRKLPRDKVLLEL*
Ga0114129_102999551	3300009147	Populus Rhizosphere	DTVGQPPSAEIGVPNMPALKVKKPRKLPQDKVRLEP*
Ga0114129_107238352	3300009147	Populus Rhizosphere	PPPSPRSLPREKRPDTVGELRSAKICVADMSSLKAKKLIKLPQEKVLLEL*
Ga0111538_127014891	3300009156	Populus Rhizosphere	GLRKPDTVGELPSAETCLSNMPSLKAKKRGKRAPEKVLLEP*
Ga0111538_135894991	3300009156	Populus Rhizosphere	DTVGQPPSTEIGVLNMSSWKAKKLRKLPQEKVLLEL*
Ga0111538_136915561	3300009156	Populus Rhizosphere	LLLSENLFASNYPGAATKPPDTVGELKSAAIGVSHMPSLKAKKLRKLLQEKVCLEL*
Ga0075423_105431942	3300009162	Populus Rhizosphere	DTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEL*
Ga0075423_121726542	3300009162	Populus Rhizosphere	LVGQPPRAEICVPNMPSGKAKKLRKLPQEKVLLEL*
Ga0105237_117142932	3300009545	Corn Rhizosphere	MTRAARCSNRADTVGELPSAETCLSNMSSLKAKKRGKRAPEKVLL
Ga0105249_101231702	3300009553	Switchgrass Rhizosphere	MYSKWADNVGELRNDKFCVSYMPSLKAKKLEKLTQEKAVLER*
Ga0105249_102633811	3300009553	Switchgrass Rhizosphere	DTVGQPPGAEICVSNMPALKAKKLGKLPQEKVLLEL*
Ga0105249_104245121	3300009553	Switchgrass Rhizosphere	PCDTVGEIKSPEVCVFHMPSWKAKTLEKLKQEKVLLEL*
Ga0105249_115721821	3300009553	Switchgrass Rhizosphere	MPKNRPDTVGELRTAEFCVSYMPSLKAKKLEKLTQEKAVLER
Ga0126307_113942131	3300009789	Serpentine Soil	PDTVGQPPSTEIRVLNMSSWKAKKLRKLPQEKVLLEL*
Ga0126374_106677981	3300009792	Tropical Forest Soil	DTVGQPPSAEIWVSKIPSLKAKKLRILPQEKVLLEL*
Ga0105084_10937901	3300009811	Groundwater Sand	RFTCLKNPPDTVGELRSAKMSVPYMPSWKAKKLGTLAQEKVLLEP*
Ga0105058_11504062	3300009837	Groundwater Sand	MDTVGELKSAEICVSHMPSLKAKKLGKLAQEKVLLEL*
Ga0126312_106303181	3300010041	Serpentine Soil	KCCLEKPSDTVGQPPSAEIGVTHMPSLKAKKLGKLPQEKVLLEL*
Ga0126312_106894901	3300010041	Serpentine Soil	MSLEKGPDTVGELRTAEICVSYVPSLKAKKLRKLTQEKAVLER
Ga0126312_109651711	3300010041	Serpentine Soil	MRFVYGSLKNRPDTVGQPLSAEIGVLNMPAWKAKKLEKLPRDKVLLEL*
Ga0126312_111431771	3300010041	Serpentine Soil	DSNFPGAADTVGELKSAEICVSHISSLKAKKRGKFTQEKVLLEL*
Ga0126380_101988581	3300010043	Tropical Forest Soil	MANSIRADAVGELRTAEICVSSMPSLKAKKLEKLTQAKAVLE
Ga0126384_114226891	3300010046	Tropical Forest Soil	MESINWKKRAVTVGEPPSTEIGVPNMPSLKAKKLSKLPREKVFLEL*
Ga0126384_120890401	3300010046	Tropical Forest Soil	YVADVSSLSKNRADTVGQPLSAEIGVLNMPSWKTKKLRKLPREKVLLKL*
Ga0126384_121010232	3300010046	Tropical Forest Soil	CLENPPDTVGQPPSTEIGVPNMASLKAKKLRKLLQEKVLLEL*
Ga0126382_123326241	3300010047	Tropical Forest Soil	GTDTVGQPPNSEIGVPDLPSWKAKKLSKLSREKVLLEL*
Ga0126382_125197132	3300010047	Tropical Forest Soil	DTVGEPPSAEIGVSHMPSLKAKTLGKLTQEKVLLEL*
Ga0126321_10710323	3300010145	Soil	DTVGELKSAEICVSHVPSWKAKKRGNLTQEEVLLEP*
Ga0126321_10748321	3300010145	Soil	RDTVGELKSAEIYVSHVPSLKAKKLRKLPQEKLLLEL*
Ga0134082_105429611	3300010303	Grasslands Soil	LSQKRGDTVGQPPRAEIWVSNMPSLKAKKLRKLPQEKVLIEL*
Ga0134084_101955232	3300010322	Grasslands Soil	FRWCLTKPPDTVGEFKSAEIGASHMLSWKAKKLGELTQEKVLLEL*
Ga0126370_114530531	3300010358	Tropical Forest Soil	STEFSACLVKGPDTVGEPPSAEICASHMPSWKAKKLGKLAQEKVLLEP*
Ga0126376_107187732	3300010359	Tropical Forest Soil	MSITNPPDTVGQPPGIEIDVPDMPSLKAKKLSKLPREKVLL
Ga0126376_130138381	3300010359	Tropical Forest Soil	RKRGSVKKRADTVGQPPSAEIGVLNMPALKAKKLRKPSQEKYF*
Ga0126378_130923541	3300010361	Tropical Forest Soil	HPYGLTNFGQEPTDTVGEPPSAENGASHMPSWKAKKRGKLTQEKVLLEL*
Ga0126377_107242071	3300010362	Tropical Forest Soil	DLQLCLANPPDTVGEPKSAEVCLSHMPSLKAKKLGKLSREKVLLEL*
Ga0126377_108698131	3300010362	Tropical Forest Soil	DPADVSKNGGDTVGELKSAEICVPYMPSWKTNKLGKLAQEKVLLEP*
Ga0126377_125159051	3300010362	Tropical Forest Soil	RPDTVGELRSAEICVSHMPSWKAKKLGELPQEKALLEL*
Ga0126377_129885402	3300010362	Tropical Forest Soil	TVGQPPSAEICVYNMPSLEVKKLRKLAQEKVLLEL*
Ga0126377_133294792	3300010362	Tropical Forest Soil	GQTPDTVGHPPSTEIGVPNMPSLKAKKLNKLPQEKVLLEL*
Ga0126379_117005532	3300010366	Tropical Forest Soil	QKGWDTVGQPPSTEIGVLNMPSLKAKKLRKPPQEKVLLEL*
Ga0126379_131940491	3300010366	Tropical Forest Soil	VGEPPGAEICVSHMPSRKAKKLGKLPQEKVLLEL*
Ga0126379_137264192	3300010366	Tropical Forest Soil	DTVGEFKSAEMCVSHMPALKAKKRGKLAQEKVLLEL*
Ga0126383_119189023	3300010398	Tropical Forest Soil	VGQPPGIEIDVPDMPSLKAKKLSKLPREKVLLER*
Ga0126383_120338871	3300010398	Tropical Forest Soil	KLLCLENPPDTVGELKSAEICVPHMPSLKAKKLGKLSREKVLLEL*
Ga0126383_127627181	3300010398	Tropical Forest Soil	NRPDTVGELKSAKICVSHMPSLKAKKLGKLTREKVLLEL*
Ga0137391_101049854	3300011270	Vadose Zone Soil	DIVGELKGAEMCVSHMPSWKAEKLGKRTQEKVLLEL*
Ga0137399_108244621	3300012203	Vadose Zone Soil	FVKRPDTVGQPPDAETCVSDTPFLKAKKLRKLPQEKVLLEL*
Ga0150985_1088879861	3300012212	Avena Fatua Rhizosphere	EKGTDTVGELKSAEICVPHMPSLKAKQLGKLSREKVLLEL*
Ga0137387_111280921	3300012349	Vadose Zone Soil	DTVGQPPSTEIGVPNMPSLKAKKLRKLPREKVLLEL*
Ga0137371_103553861	3300012356	Vadose Zone Soil	DTVGQPPSTEIGVLNMPSLKAKKLRKLPRDKVLLEL*
Ga0137385_104545182	3300012359	Vadose Zone Soil	PDTVGELKSAEVCGSYKPSLKAKKLGKLTQEKEVLER*
Ga0137360_101650641	3300012361	Vadose Zone Soil	LQKPTDTVGELKSAEICVSYMPSLKAKKLGALTQEKVLLEL*
Ga0137390_116384782	3300012363	Vadose Zone Soil	DTVGELKSAEMGVPPMPSLKAKKLGKLMRQRVLLEL*
Ga0150984_1061556113	3300012469	Avena Fatua Rhizosphere	VITVSNRRDTVGELKSAEICVSHMPSWKAKKLEKLTQEKVLLEL*
Ga0157324_10522491	3300012506	Arabidopsis Rhizosphere	PDTVGESPRADICVSNMPSWKARKLGKLPQEKVLLEL*
Ga0137394_108026281	3300012922	Vadose Zone Soil	DTVGELRSSAICVSYMPSLKAKKLEKLTQEKTVLAR*
Ga0137407_121083741	3300012930	Vadose Zone Soil	GSDTVGELKSAEICVSHMPSWKAKKLGKLAQEKVLLEL*
Ga0126369_111275593	3300012971	Tropical Forest Soil	DTVDQPPSAEIGVLNMPSLQAKKLRKPSPEKVLLEL*
Ga0126369_125141342	3300012971	Tropical Forest Soil	DTVGQPLSTEIGVPNMPSLKAKKLNKLPREKVLLEL*
Ga0126369_135839461	3300012971	Tropical Forest Soil	IRPDTVGQPPSTEIGVPNMPSLKAKKLRELPQDKVLLEL*
Ga0163162_105361022	3300013306	Switchgrass Rhizosphere	DTVGELRTAEFCVSYMPSLKAKKLEKLTQEKAVLER*
Ga0163162_123129051	3300013306	Switchgrass Rhizosphere	DTVGESPSAEIGVSHMPSLKAKKLGKLTQEKVLLEL*
Ga0132256_1021645701	3300015372	Arabidopsis Rhizosphere	PDTVGQPPIAEIGVPHMPSLKAKKLGKLSRENVLLEL*
Ga0132257_1003362553	3300015373	Arabidopsis Rhizosphere	TDTVGEPPGTEIRVSHMPSWKAKKLGKLPQEKKYF*
Ga0132257_1041523001	3300015373	Arabidopsis Rhizosphere	PDTVGQPPGAAICVSNLPALKAKKLGKLPQEKVLLGL*
Ga0182032_105523551	3300016357	Soil	KNPPDTVGEFKSAEMGVPHMPAWKAKTLGKLTQEKVLLEP
Ga0182040_106537971	3300016387	Soil	KPPDTVGHPSSAESGVLNMPSWKAQKLGKLPQEKGRLEL
Ga0182039_107790071	3300016422	Soil	PDTVGELKSAAICVSHMPSLKAKKLRKLSQEKVRLEL
Ga0182038_109076501	3300016445	Soil	LILCLENPPDTVGQPPSTALGVPNMPSWQAKQLRKLPREKVLLEL
Ga0182038_120256722	3300016445	Soil	WVTVGEPQSADMCVSHMPALKAKKRGIRALEKVLLEP
Ga0184609_102554712	3300018076	Groundwater Sediment	LIKGMDTVSELKSAEIYVSHLPSWKAKKLGKLTQEKVLLEL
Ga0066667_113001391	3300018433	Grasslands Soil	SLQKRPDTVGELRTAEVCVSYMPSLKAKKLAKLTQEKAVLER
Ga0066662_125520832	3300018468	Grasslands Soil	DTVGEPPSAEICVSHMPSWKAKKLGKLPQEKVLLEL
Ga0173481_104626691	3300019356	Soil	LYRKRADTVGQPPSAEICVSNMPSLKAKKLRKLPQEKVLLEL
Ga0210378_102337892	3300021073	Groundwater Sediment	PPDTVGELKSAEICVSHMPSLKAKKLGKLTQEKVLLEP
Ga0222625_16824863	3300022195	Groundwater Sediment	SDTVGELKSAEICVSYIPSLKAKKLEKLTQGKVVLKR
Ga0257166_10018961	3300026358	Soil	MSQKPPDTVGELTSAEMDVPHIPSLKAKKLGKLVQGK
Ga0209874_11319691	3300027577	Groundwater Sand	KHWDTVGELKSAEMCVSHMSSWKAKKLGKLTQEKVLLVL
Ga0209814_100659292	3300027873	Populus Rhizosphere	MTGESLSLTKRLDTVGQPPGTKIGVPNMPSLKAKKLRKLPREKVLLEL
Ga0209481_103828371	3300027880	Populus Rhizosphere	PGDTVGQPPSTEIGVLNMSAWKAKKLRKLPQEKVLLEL
Ga0209488_100357521	3300027903	Vadose Zone Soil	DTVGELKSAEICVSYIPSLKAKKLEKLTQGKVVLKR
Ga0209488_107193761	3300027903	Vadose Zone Soil	FICLEKPGDTVGQPPSIEIGVLNIPSLKAKKLRKLPQDKVLLEL
Ga0207428_101558471	3300027907	Populus Rhizosphere	PDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEL
Ga0207428_108819971	3300027907	Populus Rhizosphere	GLTNSIRPDTVGEPPSAEMGVSHMPSLKAKTLGKLTQEKVLLEL
Ga0209382_108711751	3300027909	Populus Rhizosphere	SKKRADTVGEPPSTEIGVPNMPSLKAKKLGKLPREKVLLEL
Ga0247819_106127482	3300028608	Soil	PDTVGQPPSTEIGVPNMPSLKAKKLNKLPREKVLLER
Ga0308187_100107824	3300031114	Soil	LEIFPDTVGELRRAEVCVSCMPSLKAKKLEKLTQGKVVLKR
Ga0318576_100453795	3300031796	Soil	LKTLPDTVGEPRSAETCVSHMPSWKQKSLKPTQKEVVLERLK
Ga0307409_1000193474	3300031995	Rhizosphere	IVNRKRADTVGELKSAEIYVSDMPSLKAKKLGKRPQEKVLLER
Ga0307416_1002361033	3300032002	Rhizosphere	VRHVLQEDTVGEPPSTEVSVPNMLPLKAKKLRKRPQEKVLLEL
Ga0247830_103358951	3300033551	Soil	MYTKRADTVGQPPSTEIGVPNMPSLKAKKLSKLPREK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F039790

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences