NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F038795

Metagenome / Metatranscriptome Family F038795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F038795
Family Type Metagenome / Metatranscriptome
Number of Sequences 165
Average Sequence Length 41 residues
Representative Sequence GLYQRGWENYLSLLTRYWQPYLDGRTTFDDAIAHMVSAL
Number of Associated Samples 138
Number of Associated Scaffolds 165

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.61 %
% of genes near scaffold ends (potentially truncated) 96.36 %
% of genes from short scaffolds (< 2000 bps) 89.70 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.727 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(28.485 % of family members)
Environment Ontology (ENVO) Unclassified
(33.939 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.848 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.76%    β-sheet: 0.00%    Coil/Unstructured: 52.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 165 Family Scaffolds
PF02621VitK2_biosynth 20.00
PF13474SnoaL_3 4.24
PF07969Amidohydro_3 4.24
PF12390Se-cys_synth_N 2.42
PF03551PadR 1.82
PF13620CarboxypepD_reg 1.82
PF08818DUF1801 1.82
PF00285Citrate_synt 1.82
PF01433Peptidase_M1 1.21
PF07843DUF1634 1.21
PF13594Obsolete Pfam Family 1.21
PF01019G_glu_transpept 1.21
PF01432Peptidase_M3 0.61
PF08241Methyltransf_11 0.61
PF12704MacB_PCD 0.61
PF12840HTH_20 0.61
PF10017Methyltransf_33 0.61
PF10282Lactonase 0.61
PF14020DUF4236 0.61
PF07676PD40 0.61
PF00990GGDEF 0.61
PF13673Acetyltransf_10 0.61
PF05726Pirin_C 0.61
PF00754F5_F8_type_C 0.61
PF01609DDE_Tnp_1 0.61
PF04226Transgly_assoc 0.61
PF07609DUF1572 0.61
PF07681DoxX 0.61
PF16757Fucosidase_C 0.61
PF00582Usp 0.61
PF04255DUF433 0.61
PF00106adh_short 0.61
PF02585PIG-L 0.61
PF01925TauE 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 165 Family Scaffolds
COG1427Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)Coenzyme transport and metabolism [H] 20.00
COG0372Citrate synthaseEnergy production and conversion [C] 1.82
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 1.82
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 1.82
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.82
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.82
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.82
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 1.82
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 1.21
COG4272Uncharacterized membrane proteinFunction unknown [S] 1.21
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 1.21
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.61
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.61
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.61
COG5421TransposaseMobilome: prophages, transposons [X] 0.61
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.61
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.61
COG3293TransposaseMobilome: prophages, transposons [X] 0.61
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.61
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.61
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.61
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.61
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 0.61
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.61
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.61
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.73 %
UnclassifiedrootN/A7.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000651|AP72_2010_repI_A10DRAFT_1021783All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10128248All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300002245|JGIcombinedJ26739_100808681All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300004091|Ga0062387_100540456All Organisms → cellular organisms → Bacteria → Proteobacteria822Open in IMG/M
3300004092|Ga0062389_102672342All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria665Open in IMG/M
3300005172|Ga0066683_10246236All Organisms → cellular organisms → Bacteria → Proteobacteria1108Open in IMG/M
3300005332|Ga0066388_101933381All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300005343|Ga0070687_101120916All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005447|Ga0066689_10655632All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005518|Ga0070699_101957004All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005526|Ga0073909_10657469All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005537|Ga0070730_10323714All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300005538|Ga0070731_10026202All Organisms → cellular organisms → Bacteria3980Open in IMG/M
3300005541|Ga0070733_11047308All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Microbulbiferaceae → Microbulbifer → Microbulbifer variabilis547Open in IMG/M
3300005552|Ga0066701_10264623All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300005553|Ga0066695_10203515All Organisms → cellular organisms → Bacteria → Proteobacteria1242Open in IMG/M
3300005569|Ga0066705_10674981All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300005575|Ga0066702_10300807All Organisms → cellular organisms → Bacteria → Proteobacteria978Open in IMG/M
3300005586|Ga0066691_10287004All Organisms → cellular organisms → Bacteria → Acidobacteria970Open in IMG/M
3300005602|Ga0070762_11110201All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005718|Ga0068866_10200956All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300005764|Ga0066903_103036455All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300005842|Ga0068858_100051650All Organisms → cellular organisms → Bacteria3803Open in IMG/M
3300005843|Ga0068860_101629627All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300006059|Ga0075017_100847650All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300006086|Ga0075019_10073401All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300006162|Ga0075030_101290386All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300006174|Ga0075014_100696443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300006176|Ga0070765_100917659All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300006176|Ga0070765_102217004All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300006794|Ga0066658_10015617All Organisms → cellular organisms → Bacteria2883Open in IMG/M
3300006794|Ga0066658_10820950All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300006797|Ga0066659_10811897All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
3300006893|Ga0073928_10124097All Organisms → cellular organisms → Bacteria2123Open in IMG/M
3300007265|Ga0099794_10753033All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300007788|Ga0099795_10499823All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300009038|Ga0099829_10493679All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300009038|Ga0099829_10578294All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300009038|Ga0099829_10706535All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300009038|Ga0099829_10757508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6807Open in IMG/M
3300009088|Ga0099830_10741349All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300009088|Ga0099830_10891831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia735Open in IMG/M
3300009089|Ga0099828_10501198All Organisms → cellular organisms → Bacteria → Proteobacteria1095Open in IMG/M
3300009089|Ga0099828_11299702All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300009143|Ga0099792_10280236All Organisms → cellular organisms → Bacteria → Acidobacteria982Open in IMG/M
3300009143|Ga0099792_10574438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300009143|Ga0099792_11189364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300009545|Ga0105237_10395706All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300009553|Ga0105249_13424946All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300010043|Ga0126380_11017330All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300010046|Ga0126384_10137275All Organisms → cellular organisms → Bacteria → Acidobacteria1865Open in IMG/M
3300010047|Ga0126382_11785559All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300010303|Ga0134082_10104944All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300010343|Ga0074044_10869073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300010358|Ga0126370_10786557Not Available847Open in IMG/M
3300010360|Ga0126372_10403483All Organisms → cellular organisms → Bacteria → Acidobacteria1248Open in IMG/M
3300010361|Ga0126378_10250200All Organisms → cellular organisms → Bacteria1865Open in IMG/M
3300010361|Ga0126378_10638718All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300010366|Ga0126379_12424512All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300010375|Ga0105239_12060818All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300010397|Ga0134124_11581357All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300010880|Ga0126350_10025570All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300011269|Ga0137392_10294452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1341Open in IMG/M
3300011271|Ga0137393_10993381All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300012096|Ga0137389_10730910All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300012199|Ga0137383_10781878All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300012202|Ga0137363_10268853All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300012205|Ga0137362_10556966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300012210|Ga0137378_10459245All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300012361|Ga0137360_10207136All Organisms → cellular organisms → Bacteria → Acidobacteria1591Open in IMG/M
3300012363|Ga0137390_11836571All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300012582|Ga0137358_10414864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium910Open in IMG/M
3300012683|Ga0137398_11169381All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300012685|Ga0137397_10022852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4411Open in IMG/M
3300012917|Ga0137395_11234268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300012918|Ga0137396_11025938Not Available595Open in IMG/M
3300012918|Ga0137396_11278092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300012924|Ga0137413_10970753All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300012924|Ga0137413_11291788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium ADurb.Bin325585Open in IMG/M
3300012925|Ga0137419_10356517All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1133Open in IMG/M
3300012925|Ga0137419_11737563All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300012927|Ga0137416_10057132All Organisms → cellular organisms → Bacteria → Acidobacteria2767Open in IMG/M
3300012927|Ga0137416_11215237All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300012927|Ga0137416_11314158All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300012927|Ga0137416_11697357All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300012944|Ga0137410_10638467All Organisms → cellular organisms → Bacteria → Acidobacteria883Open in IMG/M
3300013306|Ga0163162_11126243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium JOSHI_001890Open in IMG/M
3300015245|Ga0137409_10261342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1534Open in IMG/M
3300015357|Ga0134072_10159156All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300015372|Ga0132256_101183187All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300016371|Ga0182034_10357193All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300017975|Ga0187782_10780874All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300017994|Ga0187822_10084119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium948Open in IMG/M
3300019883|Ga0193725_1137675Not Available538Open in IMG/M
3300020170|Ga0179594_10090743All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300020579|Ga0210407_11026347Not Available628Open in IMG/M
3300020579|Ga0210407_11147826Not Available587Open in IMG/M
3300020582|Ga0210395_11042813Not Available605Open in IMG/M
3300020583|Ga0210401_10199990All Organisms → cellular organisms → Bacteria1856Open in IMG/M
3300021046|Ga0215015_10310171All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300021170|Ga0210400_11282997All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300021178|Ga0210408_10273103All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300021401|Ga0210393_11403806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300021420|Ga0210394_10117909Not Available2298Open in IMG/M
3300021420|Ga0210394_10601813All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300021420|Ga0210394_10991098Not Available728Open in IMG/M
3300021432|Ga0210384_10036817All Organisms → cellular organisms → Bacteria → Acidobacteria4523Open in IMG/M
3300021433|Ga0210391_11538767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300021474|Ga0210390_10500006All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1024Open in IMG/M
3300021478|Ga0210402_10270776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1570Open in IMG/M
3300021478|Ga0210402_10536613All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300022532|Ga0242655_10211592All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300022722|Ga0242657_1013248All Organisms → cellular organisms → Bacteria → Acidobacteria1444Open in IMG/M
3300024222|Ga0247691_1020569All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300024288|Ga0179589_10571259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300024330|Ga0137417_1458320All Organisms → cellular organisms → Bacteria6374Open in IMG/M
3300024330|Ga0137417_1510361All Organisms → cellular organisms → Bacteria → Acidobacteria3803Open in IMG/M
3300025439|Ga0208323_1082469All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300025899|Ga0207642_10118578All Organisms → cellular organisms → Bacteria → Acidobacteria1361Open in IMG/M
3300025912|Ga0207707_10775796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300025915|Ga0207693_10063125All Organisms → cellular organisms → Bacteria → Acidobacteria2902Open in IMG/M
3300025918|Ga0207662_10559328All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300026301|Ga0209238_1072030All Organisms → cellular organisms → Bacteria → Acidobacteria1214Open in IMG/M
3300026309|Ga0209055_1060015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1611Open in IMG/M
3300026333|Ga0209158_1215248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300026334|Ga0209377_1323910All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300026374|Ga0257146_1070423All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300026550|Ga0209474_10049417All Organisms → cellular organisms → Bacteria3018Open in IMG/M
3300027671|Ga0209588_1192401All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300027729|Ga0209248_10160298All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300027738|Ga0208989_10204629Not Available652Open in IMG/M
3300027862|Ga0209701_10062758All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2365Open in IMG/M
3300027862|Ga0209701_10196944Not Available1203Open in IMG/M
3300027862|Ga0209701_10431031All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300027889|Ga0209380_10403594All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300027903|Ga0209488_10698779All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300027915|Ga0209069_10511944All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300028047|Ga0209526_10430535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria871Open in IMG/M
3300028146|Ga0247682_1008918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1728Open in IMG/M
3300028775|Ga0302231_10218845All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300028789|Ga0302232_10410176All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300028808|Ga0302228_10270127All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300030053|Ga0302177_10322339All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300030056|Ga0302181_10503255All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300030841|Ga0075384_10857139All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300031128|Ga0170823_14578589All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300031231|Ga0170824_121424243All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300031251|Ga0265327_10288737All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300031545|Ga0318541_10825999All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300031718|Ga0307474_10766765All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300031720|Ga0307469_10460650All Organisms → cellular organisms → Bacteria → Acidobacteria1103Open in IMG/M
3300031753|Ga0307477_10323149All Organisms → cellular organisms → Bacteria → Acidobacteria1063Open in IMG/M
3300031754|Ga0307475_10082311All Organisms → cellular organisms → Bacteria2485Open in IMG/M
3300031754|Ga0307475_10267579All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300031764|Ga0318535_10566675All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300031823|Ga0307478_11019855All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300031912|Ga0306921_11412249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium765Open in IMG/M
3300031962|Ga0307479_10368705All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300031962|Ga0307479_11194964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae724Open in IMG/M
3300032090|Ga0318518_10158325All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300032174|Ga0307470_10365070All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1007Open in IMG/M
3300032180|Ga0307471_100196239All Organisms → cellular organisms → Bacteria2013Open in IMG/M
3300032955|Ga0335076_10431563All Organisms → cellular organisms → Bacteria1201Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil28.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.09%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.03%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.03%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.42%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.21%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.21%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.21%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.21%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.21%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.21%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.61%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.61%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.61%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AP72_2010_repI_A10DRAFT_102178333300000651Forest SoilREGLYRRGWENYLRILAQYWQPYLDGRVDFSDAVAHMVSAL*
AF_2010_repII_A001DRAFT_1012824823300000793Forest SoilMLRFHRGYDTYAFREGLYQRGWKSYLELLQRFWQPYLDGKASFDDAIARMVSSL*
JGIcombinedJ26739_10080868123300002245Forest SoilYAMREGLYQRGWENYLALLNRYWQPYLEGRATFDDAIAHMASAL*
Ga0062387_10054045613300004091Bog Forest SoilLREGLYQRGWNDYYKLLQKFWQPYLDGTASFDDAIARMVSSL*
Ga0062389_10267234223300004092Bog Forest SoilIREGLYARGWDDYLPLLTRFWQPYLDGHASFDDAIARMVSSL*
Ga0066683_1024623613300005172SoilYAVREGLYQRGWKNYLELLQRFWQPYLDGKATFDDAIARMVSSL*
Ga0066388_10193338123300005332Tropical Forest SoilLESYKPYAMREGLYRRGWERYLELLTTFWQPYLDNRETFDDAIARMVSAL*
Ga0070687_10112091613300005343Switchgrass RhizosphereEGLYKRGWENYLRVLTQYWQPYLDGRVDFSDAVAHMVSAL*
Ga0066689_1065563223300005447SoilVREGLYKRGWENYLRVLTQYWQPYLDGKVTFEDSIAHMVSAL*
Ga0070699_10195700423300005518Corn, Switchgrass And Miscanthus RhizosphereEGLYQRGWENYLQLLTRYWQPYLESRVTFDDAIAHMVSAL*
Ga0073909_1065746923300005526Surface SoilPYALREGLYERGWKNYLDVLQRFWQPYLDGHATFSDAIARMVSSL*
Ga0070730_1032371433300005537Surface SoilTGYDTYAFREGLYQRGWKNYLELLQRFWQPYLDGKATFDDAIARMVSSL*
Ga0070731_1002620243300005538Surface SoilKRGWENYLRILTQFWQPYLDGRVEFSDAIAHMVSAL*
Ga0070733_1104730813300005541Surface SoilTPYAVRERLFQRGWDQYLKLLERFWQPYLDGNVTFDDAIAHMVSAL*
Ga0066701_1026462323300005552SoilREGLYQRGWNEYFKLLQKFWQPYLDGRASFDDAIARMVSSL*
Ga0066695_1020351513300005553SoilVREGLYQRGWKNYLELLQRFWQPYLDGKATFDDAIARMVSSL*
Ga0066705_1067498113300005569SoilEGLYQRGWNEYFKLLQKFWQPYLDGRASFDDAIARMVSSL*
Ga0066702_1030080713300005575SoilYQRGWKSYLELLQRFWQPYLDGKATFDDAIARMVSSL*
Ga0066691_1028700413300005586SoilGWEDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL*
Ga0070762_1111020113300005602SoilLYQRGWNDYYKLLQRFWQPYLNGQATFDDAVARMVSQL*
Ga0068866_1020095613300005718Miscanthus RhizosphereYQRGWDNYLSLLRRFWQPYLDGKASFDDAIAHMVSAL*
Ga0066903_10303645523300005764Tropical Forest SoilLYKRGWQDYLRVLTEFWQPYLDGKASFDDAIAHMVSAL*
Ga0068858_10005165053300005842Switchgrass RhizosphereAVREGLYKRGWENYLRVLTQYWQPYLDGRVEFSDAVAHMVSAL*
Ga0068860_10162962713300005843Switchgrass RhizosphereGWENYLRILTQYWQPYLDGRVDFSDAVAHMVSAL*
Ga0075017_10084765023300006059WatershedsQRGWEDYLHLLTTFWQPYLDGRVTFEDAIAHMVSAL*
Ga0075019_1007340123300006086WatershedsGWSDYYKLLQKFWQPYLDGTATFDDAIARMVSAL*
Ga0075030_10129038623300006162WatershedsYTRGWDAYLKLLTRFWQPYLDGKSSFDDAIARLVSAL*
Ga0075014_10069644323300006174WatershedsYERGWKDYLELLTRFWQPYLDNKATFDDAIARMVSAL*
Ga0070765_10091765913300006176SoilEGLYERGWDDYLKLLTRFWQPYLDGRSSFDDAIARMVSSL*
Ga0070765_10221700413300006176SoilYAIREGLYERGWKDYLQLLSRFWQPYLDNKSTFDDAIARMVSAL*
Ga0066658_1001561713300006794SoilYQRGWNEYFKLLQKFWQPYLDGHASFDDAIARMDSSL*
Ga0066658_1082095013300006794SoilGLYQRGWNDYFKLLQKFWQPYLDGSASFDDAIARMVSSL*
Ga0066659_1081189723300006797SoilLYKRGWENYLRVLIQYWQPYLDGSATYDDAIAHMVSAL*
Ga0073928_1012409743300006893Iron-Sulfur Acid SpringFRERLYQRGWDDYLKLLERFWQPYLDGTATFDDAIAHIVSAL*
Ga0099794_1075303313300007265Vadose Zone SoilGLYERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL*
Ga0099795_1049982323300007788Vadose Zone SoilGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL*
Ga0099829_1049367913300009038Vadose Zone SoilLREGLYQRGWNDYFKLLQKFWQPYLDGRASFDDAVARMVSSL*
Ga0099829_1057829433300009038Vadose Zone SoilPYAKREGLYQRGWENYLQLLTRYWQPYLDGQTTFDNAIAHMVSAL*
Ga0099829_1070653513300009038Vadose Zone SoilPYAKREGLYQRGWENYLQLLIRYWQPYLDGTVTFDNAIAHMVSAL*
Ga0099829_1075750833300009038Vadose Zone SoilPYAKREGLYQRGWENYLQLLTRYWQPYLDGQTTFDNAIAHIVSAL*
Ga0099830_1074134923300009088Vadose Zone SoilYAVREGLYQRGWNDYFKLLQKFWQPYLDGSASFDDAIARMVSSL*
Ga0099830_1089183113300009088Vadose Zone SoilREGLYKRGWDEYLKLLNRFWQPYLDNKVTFDDAIARMVSAQ*
Ga0099828_1050119813300009089Vadose Zone SoilLYTRGWSGYLLLLERFWQPYLDGKTDFDAAIARMVSSL*
Ga0099828_1129970213300009089Vadose Zone SoilEGLYTRGWSGYLLLLERFWQPYLDGKTDFDAAIARMVSSL*
Ga0099792_1028023623300009143Vadose Zone SoilYAKREGLYQRGWESYLQLLTLYWQPYLDGRVTFDNAIAHIVSAL*
Ga0099792_1057443813300009143Vadose Zone SoilTPYAKREGLYQRGWENYLSLLNRYWQPYLQGRSTFDDAIARMVSAL*
Ga0099792_1118936413300009143Vadose Zone SoilALREGLYQRGWNDYFKLLQRFWQPYLDGTATFDDAIARMVSSL*
Ga0105237_1039570623300009545Corn RhizosphereYEPYAVRERLYQRGWDEYLKLLERFWQPYLDGNVTFDDAIAHMVSAL*
Ga0105249_1342494613300009553Switchgrass RhizosphereRGWDNYLSLLRRFWQPYLDGKASFDDAIAHMVSAL*
Ga0126380_1101733023300010043Tropical Forest SoilYMPYAVRERLYQRGWDEYLKLLERFWQPYLDGQATFDDAIAHMVSAL*
Ga0126384_1013727513300010046Tropical Forest SoilRGWENYLRVLNDFWQPYLDGKTSFDDAIAHMVSAL*
Ga0126382_1178555913300010047Tropical Forest SoilQIENYLRVLNDFWQPYLDGKTSFDDAIAHMVSAL*
Ga0134082_1010494413300010303Grasslands SoilGLYQRGWNEYFKLLQKFWQPYLDGRASFDDAIARMVSSL*
Ga0074044_1086907313300010343Bog Forest SoilEGLYERGWKDYLQLLTRFWQPYLDNKSTFDDSIARMVSAL*
Ga0126370_1078655723300010358Tropical Forest SoilLYQRGWDQYLKLLTRFWQPYLEGKSTFDDAIARMVSAL*
Ga0126372_1040348313300010360Tropical Forest SoilYAVREGLYKRGWQDYLRVLNDFWQPYLDGKTSFDDAIAHMVSAL*
Ga0126378_1025020033300010361Tropical Forest SoilYQRGWKNYLELLQRFWQPYLDGKATFDDAIARMVSSL*
Ga0126378_1063871823300010361Tropical Forest SoilYAFREGLYQRGWKSYLELLQRFWQPYLDGKASFDDAIARMVSSL*
Ga0126379_1242451223300010366Tropical Forest SoilVREDLYKRGWENYLRILTQYWQPYLDGRVDFSDAVAHMVSAL*
Ga0105239_1206081823300010375Corn RhizosphereNGEYTPYPVRERLYQRGWDEYLKLLERFWQPYLDGNVTFDDAIAHMVSAL*
Ga0134124_1158135713300010397Terrestrial SoilKRGWQNYLRVLTQYWQPYLDGRVEFSDAIAHMVSAL*
Ga0126350_1002557013300010880Boreal Forest SoilYQRGWDGYFQLLTKYWQPYLNGTVPFDDAIARMVSSL*
Ga0137392_1029445213300011269Vadose Zone SoilYAKREGLYQRGWENYLSLLTHYWQPYLQGRTTFDDAIAHMVSAL*
Ga0137393_1099338113300011271Vadose Zone SoilGLYQRGWSDYFKLLQKFWQPYLDGTASFDDAIARMVSSL*
Ga0137389_1073091023300012096Vadose Zone SoilQRGWNDYFKLLQKFWQPYLDGTASFDDAIARMVSSL*
Ga0137383_1078187813300012199Vadose Zone SoilPYAVREGLYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL*
Ga0137363_1026885313300012202Vadose Zone SoilRGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL*
Ga0137362_1055696613300012205Vadose Zone SoilYKRGWENYLRILTEYWQPYLDGRVTFDDAIAHMVSAL*
Ga0137378_1045924513300012210Vadose Zone SoilEGLYKRGWENYLRLLTEYWQPYLDGRVTFDDAIAHMVSAL*
Ga0137360_1020713613300012361Vadose Zone SoilKREGLYQRGWENYLSLLNRYWQPYLQGRSTFDDAIARMVSAL*
Ga0137390_1183657113300012363Vadose Zone SoilYALREGLYQRGWNDYFKLLQKFWQPYLDGTASFDDAIARMVSSL*
Ga0137358_1041486433300012582Vadose Zone SoilYRRGWENYLQILTRYWQPYLEGRVTFDDAIAHMVSAL*
Ga0137398_1116938113300012683Vadose Zone SoilYAVREGLYQRGWSDYFKLLQKFWQPYLDGTASFDDAIARMVSSL*
Ga0137397_1002285213300012685Vadose Zone SoilGWNDFFKMLQRFWQPYLDGTATFDDAIARMVSSL*
Ga0137395_1123426813300012917Vadose Zone SoilAKREGLYQRGWENYLQILTRYWQPYLEGHVPFDDAIAHMVSAL*
Ga0137396_1102593813300012918Vadose Zone SoilYTRGWDAYLKLLTTFWQPYLDGKSTFDDAIARMVSAL*
Ga0137396_1127809213300012918Vadose Zone SoilEGLYQRGWENYLSLLTRYWQPYLNGRTTFDDAIAHMVSAL*
Ga0137413_1097075313300012924Vadose Zone SoilLYKRGWENYLRLLTEYWQPYLDGRVPFDDAIAHMVSAL*
Ga0137413_1129178813300012924Vadose Zone SoilYKRGWEDYLRVLTQYWQPYLDGNVSYDDAIAHMVSAL*
Ga0137419_1035651733300012925Vadose Zone SoilYQRGWENYLSLLNRYWQPYLQGRSTFDDAIARMVSAL*
Ga0137419_1173756313300012925Vadose Zone SoilRGWENYLRLLTEYWQPYLDGRVTFDDAIAHMVSAL*
Ga0137416_1005713223300012927Vadose Zone SoilLYQRGWTDYFKLLQKFWQPYLDGGATFDDAIARMVSSL*
Ga0137416_1121523713300012927Vadose Zone SoilREGLYQRGWNDYFKLLQKFWQPYLDGRASFDDAIARMVSSL*
Ga0137416_1131415823300012927Vadose Zone SoilEGLYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL*
Ga0137416_1169735723300012927Vadose Zone SoilAIRERLYERGWDGYLQLLTRFWQPYLDGKSTYDDAIARMVSSL*
Ga0137410_1063846723300012944Vadose Zone SoilYERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL*
Ga0163162_1112624313300013306Switchgrass RhizosphereYKRGWENYLRVLTQYWQPYLDGRVEFSDAIAHMVSAL*
Ga0137409_1026134213300015245Vadose Zone SoilKRGWENYLRVLTQYWQPYLDGSVTFDDAIAHMVSAL*
Ga0134072_1015915613300015357Grasslands SoilLREGLYQRGWNEYFKLLQKFWQPYLDGHASFDDAIARMVSSL*
Ga0132256_10118318713300015372Arabidopsis RhizosphereKRGWENYLRVLTQYWQPYLDGRVEFSDAIAHMVSAL*
Ga0182034_1035719313300016371SoilVPYAVREGLYKRGWENYLRILTEYWQPYLDGRVDFSDAIAHMVSAL
Ga0187782_1078087413300017975Tropical PeatlandERGWKEYYSLLEQFWQPYLDGRASYDDAIARMVSSL
Ga0187822_1008411913300017994Freshwater SedimentGLYKRGWENYLRILTQYWQPYLDGSVEFSDAIAHMVSAL
Ga0193725_113767513300019883SoilERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL
Ga0179594_1009074313300020170Vadose Zone SoilALREGLYERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL
Ga0210407_1102634723300020579SoilGLYERGWKGYLDVLQRFWQPYLDGQATFSDAVARMVSSL
Ga0210407_1114782623300020579SoilGLYERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL
Ga0210395_1104281323300020582SoilVREQLYKRGWDEYLKLLERFWQPYLDGNVSFDDAIAHMVSAL
Ga0210401_1019999023300020583SoilREGLYERGWKDYLQLLNRFWQPYLDNKSTFDDAIARMVSAL
Ga0215015_1031017123300021046SoilVYKRQGYLLLLERFWQPYLDGKTDFDAAIARMVSSL
Ga0210400_1128299713300021170SoilEGLYQRGWNDYFKLLQKFWQPYLDGRASFDDAIARMVSSL
Ga0210408_1027310313300021178SoilGLYQRGWNDYYKLLQKFWQPYLDGTATFDDAIARMVSSL
Ga0210393_1140380623300021401SoilGLYKRGWENYLRLLTEYWQPYLDGRVTFDDAIAHMVSAL
Ga0210394_1011790953300021420SoilEGLYERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL
Ga0210394_1060181323300021420SoilYAIREGIYQRGWDGYLKLLTQFWQPYLDGNSTFDDAVARMVSAL
Ga0210394_1099109823300021420SoilVLYERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL
Ga0210384_1003681743300021432SoilLPISPYAIREGLYQRGWENYFQMLTHYWQPYLEGRVTFDDAIAHMVSAL
Ga0210391_1153876723300021433SoilYERGWKDYLQLLTRFWQPYLDNQSTFDDAIARMVSAL
Ga0210390_1050000613300021474SoilAIREGLYQRGWNDYFQLLIRFWQPYLDNKSTFDDAIARMVSAL
Ga0210402_1027077613300021478SoilPYAIREGLYERGWKDYLDLLTRFWQPYLDNKSTFDDAIARMVSAL
Ga0210402_1053661313300021478SoilLYQRDWDDYLKLLTRFWQPYLDGRVTFDDAIAHMVSAL
Ga0242655_1021159223300022532SoilENLYKRGWESYLPILTRYWQPYLEGQVTFDDAIAHMVSAL
Ga0242657_101324843300022722SoilYERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL
Ga0247691_102056913300024222SoilRLYQRGWDDYLKLLERFWEPYLENRVTFDDAIAHIVSAL
Ga0179589_1057125913300024288Vadose Zone SoilYAKREGLYQRGWENYLSLLNRYWQPYLQGRSTFDDAIARMVSAL
Ga0137417_145832013300024330Vadose Zone SoilKRDGWNDYFRLLRQFWQPYLERKPPFADAIARMVSSV
Ga0137417_151036163300024330Vadose Zone SoilVREGLYQRGWSDYFKLLQKFWQPYLDGNASFDDAIARMVSSL
Ga0208323_108246923300025439PeatlandAMREGLYTHRWSNYLRVIQKYWQPYLDGSADFGDAIARMVSSL
Ga0207642_1011857823300025899Miscanthus RhizosphereERLYQRGWDNYLSLLRRFWQPYLDGKASFDDAIAHMVSAL
Ga0207707_1077579633300025912Corn RhizosphereGLYQRGWENYLSLLTRYWQPYLDGRTTFDDAIAHMVSAL
Ga0207693_1006312513300025915Corn, Switchgrass And Miscanthus RhizosphereVREGLYKRGWENYLRVLTQYWQPYLDGRVDFSDAVAHMVSAL
Ga0207662_1055932813300025918Switchgrass RhizosphereEGLYKRGWENYLRVLTQYWQPYLDGRVDFSDAVAHMVSAL
Ga0209238_107203013300026301Grasslands SoilREGLYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL
Ga0209055_106001533300026309SoilALREGLYQRGWNDYFKLLQKFWQPYLDGTASFDDAIARMVSSL
Ga0209158_110612913300026333SoilKRGWAGYQRALEQFWQPYLDGKADFDDAIARIVSAL
Ga0209158_121524823300026333SoilEGLYQRGWNEYFKLLQKFWQPYLDGHASFDDAIARMVSSL
Ga0209377_132391013300026334SoilGLYERGWKNYLDVLQRFWQPYLDGRATFSDAIARMVSSL
Ga0257146_107042313300026374SoilAVREGLYKRGWEDYLRVLTQFWQPYLDGKESFDDAIAHMVSAL
Ga0209474_1004941713300026550SoilRGWKNYLELLQRFWQAYLDGKASFDDAIARMVSSL
Ga0209588_119240123300027671Vadose Zone SoilEGLYQRGWENYLQILTRYWQPYQPYLEGHVTFDDAIAHMVSAL
Ga0209248_1016029813300027729Bog Forest SoilYQRGWDDYLKLLTRFWQPYLDGKVTFDDAIARMVSSL
Ga0208989_1020462913300027738Forest SoilREGLYRRGWKNYLDVLQRFWQPYLDGRATFSDAVARMVSSL
Ga0209701_1006275833300027862Vadose Zone SoilVREGLYKRGWDEYLKLLNRFWQPYLDNKVTFDDAIARMVSAQ
Ga0209701_1019694423300027862Vadose Zone SoilVREGLYQRGWNDYFKLLQKFWQPYLDGTASFDDAIARMVSSL
Ga0209701_1043103123300027862Vadose Zone SoilALREGLYQRGWNDYFKLLQKFWQPYLDGRATFDDAIARMVSSL
Ga0209380_1040359423300027889SoilYAVREQLFKRGWDEYLKLLERFWQPYLDGNVSFDDAIAHMVSAL
Ga0209488_1069877913300027903Vadose Zone SoilAVREGLYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL
Ga0209069_1051194423300027915WatershedsYTPYAQREGLYHRGWDSYFQLLSLYWQPYLDGKVTFDNAIAHMVSAL
Ga0209526_1043053513300028047Forest SoilVPYAIREGLYERGWKDYLQLLTRFWQPYLDNKSTFDDAIARMVSAL
Ga0247682_100891833300028146SoilLYKRGWQDYLRVLTEYWQPYLDGKQSFDDAVAHMVSAL
Ga0302231_1021884513300028775PalsaGLYLRGWDDYLRVLNRFWQPYLDGTASFDDAIARMVSAL
Ga0302232_1041017613300028789PalsaVKQGLYQRGWDDYLKVLTHFWQPYLDGKATFDDAIARMVSAL
Ga0302228_1027012713300028808PalsaYQRGWDDYLKVLTHFWQPYLDGKATFDDAIARMVSAL
Ga0302177_1032233933300030053PalsaAVKEGLYLRGWDDYLRVLNRFWQPYLDGTASFDDAIARMVSAL
Ga0302181_1050325523300030056PalsaRGWDDYLKVLTHFWQPYLDGKATFDDAIARMVSAL
Ga0075384_1085713923300030841SoilPYAVREGLYKRGWENYLRLLTEYWQPYLDGRVTFDDAIAHMVSAL
Ga0170823_1457858923300031128Forest SoilYKRGWENYLRLLTEYWQPYLDGRVSFDDAIAHMVSAL
Ga0170824_12142424313300031231Forest SoilTPYAIREGLYERGWKDYLDLLTRFWQPYLDNKSTFDDAIARMVSAL
Ga0265327_1028873723300031251RhizosphereNLSQRGWDDYLHLLTTFWQPYLDGRVTFEDAIAHMVSAL
Ga0318541_1082599923300031545SoilVREGLYKRGWENYLRILTEYWQPYLDGRVDFSDAIAHMVSAL
Ga0307474_1076676523300031718Hardwood Forest SoilNGEYTPYAVREQLYKRGWDTYLKLLDQFWQPYLDGKVSFDDAIAHMVSAL
Ga0307469_1046065023300031720Hardwood Forest SoilREGLYQRGWDRYLTLLTTFWQPYLDNQETFDDAIARMVSAL
Ga0307477_1032314933300031753Hardwood Forest SoilQRGWENYLQLLTRYWQPYLQGQVTFDDAIAHMVSAL
Ga0307475_1008231113300031754Hardwood Forest SoilQDAEYTPYAMREGLYQRGWENYLTLLTHYWQPYLEGRATFDDAIAHMVSAL
Ga0307475_1026757923300031754Hardwood Forest SoilKRGWENYLRILTEYWQPYLDGRVTFDDAIAHMVSAL
Ga0318535_1056667513300031764SoilMREGLYQRNWDRYLELLTTFWQPYLEGQASFDDAIARMVSGL
Ga0307478_1101985513300031823Hardwood Forest SoilVREGLYERGWKDYLQLLTHYWQPYLDNKTTFDDAIAHMVSNL
Ga0306921_1141224923300031912SoilLYQHGWSSYYKLLARFWQPYLDGHATFDDAIARMISAL
Ga0307479_1036870523300031962Hardwood Forest SoilGLYQRGWNDYFKLLQRFWQPYLDGRASFDDAIARMVSSL
Ga0307479_1119496433300031962Hardwood Forest SoilRLYQRGWDEYLKLLERFWQPYLDGKTTFDDAIAHIVSAL
Ga0318518_1015832513300032090SoilDMYAFREGLYQRGWKNYLELLQRFWQPYLDGKASFDDAIARMVSSL
Ga0307470_1036507013300032174Hardwood Forest SoilGLYQRGWENYFEILSRYWQPYLESRVTFDDAIAHMVSAL
Ga0307471_10019623913300032180Hardwood Forest SoilAVREGLYKRGWENYLRVLTQYWQPYLDGRVDFSDAVAHMVSAL
Ga0335076_1008350533300032955SoilATTYTSGALQERLYSRGWQDYYRVLSDYWQPYLDGNVGFEDAIAHMVSAL
Ga0335076_1043156313300032955SoilLYQRNWDEYLKLLERFWQPYLDGNATFEDAIARMVSAL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.