Basic Information | |
---|---|
Family ID | F038595 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 165 |
Average Sequence Length | 41 residues |
Representative Sequence | MYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSEK |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 165 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 76.10 % |
% of genes near scaffold ends (potentially truncated) | 28.48 % |
% of genes from short scaffolds (< 2000 bps) | 90.91 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (75.152 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.546 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.909 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.242 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 165 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 5.45 |
PF07715 | Plug | 0.61 |
PF12704 | MacB_PCD | 0.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 75.15 % |
All Organisms | root | All Organisms | 24.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100749578 | Not Available | 856 | Open in IMG/M |
3300004082|Ga0062384_100321901 | Not Available | 968 | Open in IMG/M |
3300004092|Ga0062389_100267734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 1750 | Open in IMG/M |
3300004268|Ga0066398_10009689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1379 | Open in IMG/M |
3300005434|Ga0070709_11527031 | Not Available | 543 | Open in IMG/M |
3300005445|Ga0070708_101248129 | Not Available | 695 | Open in IMG/M |
3300005468|Ga0070707_100342320 | Not Available | 1453 | Open in IMG/M |
3300005549|Ga0070704_102030575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300005552|Ga0066701_10521849 | Not Available | 733 | Open in IMG/M |
3300005559|Ga0066700_11175743 | Not Available | 500 | Open in IMG/M |
3300006028|Ga0070717_10338711 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300006804|Ga0079221_11522764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 538 | Open in IMG/M |
3300006804|Ga0079221_11771845 | Not Available | 505 | Open in IMG/M |
3300006854|Ga0075425_101349263 | Not Available | 808 | Open in IMG/M |
3300006871|Ga0075434_101284521 | Not Available | 743 | Open in IMG/M |
3300007258|Ga0099793_10225880 | Not Available | 901 | Open in IMG/M |
3300007258|Ga0099793_10333663 | Not Available | 740 | Open in IMG/M |
3300007265|Ga0099794_10474958 | Not Available | 657 | Open in IMG/M |
3300007788|Ga0099795_10220621 | Not Available | 807 | Open in IMG/M |
3300007788|Ga0099795_10419633 | Not Available | 611 | Open in IMG/M |
3300009038|Ga0099829_10950647 | Not Available | 713 | Open in IMG/M |
3300009088|Ga0099830_10637371 | Not Available | 875 | Open in IMG/M |
3300009088|Ga0099830_10887465 | Not Available | 737 | Open in IMG/M |
3300009088|Ga0099830_11383955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 585 | Open in IMG/M |
3300009089|Ga0099828_10383191 | Not Available | 1268 | Open in IMG/M |
3300009089|Ga0099828_11146193 | Not Available | 690 | Open in IMG/M |
3300009089|Ga0099828_11683605 | Not Available | 558 | Open in IMG/M |
3300009143|Ga0099792_10053397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella siphonis | 1978 | Open in IMG/M |
3300009143|Ga0099792_10535393 | Not Available | 738 | Open in IMG/M |
3300009143|Ga0099792_10584197 | Not Available | 710 | Open in IMG/M |
3300009156|Ga0111538_13701124 | Not Available | 530 | Open in IMG/M |
3300009162|Ga0075423_12047991 | Not Available | 620 | Open in IMG/M |
3300009176|Ga0105242_12902091 | Not Available | 530 | Open in IMG/M |
3300009792|Ga0126374_10580561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300010043|Ga0126380_10168767 | Not Available | 1426 | Open in IMG/M |
3300010159|Ga0099796_10078149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 1208 | Open in IMG/M |
3300010159|Ga0099796_10538546 | Not Available | 524 | Open in IMG/M |
3300010361|Ga0126378_10343765 | Not Available | 1601 | Open in IMG/M |
3300010362|Ga0126377_11937459 | Not Available | 665 | Open in IMG/M |
3300010376|Ga0126381_102413374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300011269|Ga0137392_10805030 | Not Available | 776 | Open in IMG/M |
3300011270|Ga0137391_10496163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
3300011270|Ga0137391_10899765 | Not Available | 724 | Open in IMG/M |
3300011271|Ga0137393_10728061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
3300012096|Ga0137389_10388656 | Not Available | 1190 | Open in IMG/M |
3300012096|Ga0137389_10705919 | Not Available | 867 | Open in IMG/M |
3300012189|Ga0137388_10483496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1149 | Open in IMG/M |
3300012201|Ga0137365_11096632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300012202|Ga0137363_10162385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1765 | Open in IMG/M |
3300012202|Ga0137363_10771624 | Not Available | 815 | Open in IMG/M |
3300012202|Ga0137363_10948007 | Not Available | 731 | Open in IMG/M |
3300012202|Ga0137363_11435382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300012206|Ga0137380_10751938 | Not Available | 844 | Open in IMG/M |
3300012210|Ga0137378_10697385 | Not Available | 926 | Open in IMG/M |
3300012210|Ga0137378_11773079 | Not Available | 522 | Open in IMG/M |
3300012211|Ga0137377_10686661 | Not Available | 959 | Open in IMG/M |
3300012361|Ga0137360_10725919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 854 | Open in IMG/M |
3300012361|Ga0137360_10776048 | Not Available | 824 | Open in IMG/M |
3300012362|Ga0137361_10637499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
3300012362|Ga0137361_10688104 | Not Available | 935 | Open in IMG/M |
3300012363|Ga0137390_10903290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
3300012683|Ga0137398_10522283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300012683|Ga0137398_11006233 | Not Available | 578 | Open in IMG/M |
3300012685|Ga0137397_10413375 | Not Available | 1005 | Open in IMG/M |
3300012917|Ga0137395_10123515 | Not Available | 1747 | Open in IMG/M |
3300012918|Ga0137396_11223527 | Not Available | 527 | Open in IMG/M |
3300012922|Ga0137394_10278053 | Not Available | 1432 | Open in IMG/M |
3300012923|Ga0137359_11139943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300012924|Ga0137413_10228265 | Not Available | 1267 | Open in IMG/M |
3300012944|Ga0137410_10178538 | Not Available | 1633 | Open in IMG/M |
3300012989|Ga0164305_10131535 | Not Available | 1667 | Open in IMG/M |
3300015241|Ga0137418_10634429 | Not Available | 833 | Open in IMG/M |
3300016270|Ga0182036_10385580 | Not Available | 1088 | Open in IMG/M |
3300016270|Ga0182036_11503518 | Not Available | 565 | Open in IMG/M |
3300016294|Ga0182041_10453751 | Not Available | 1102 | Open in IMG/M |
3300016319|Ga0182033_10175985 | Not Available | 1679 | Open in IMG/M |
3300016319|Ga0182033_10273363 | Not Available | 1383 | Open in IMG/M |
3300016371|Ga0182034_11406513 | Not Available | 610 | Open in IMG/M |
3300017822|Ga0187802_10217006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 737 | Open in IMG/M |
3300017822|Ga0187802_10334156 | Not Available | 593 | Open in IMG/M |
3300017823|Ga0187818_10574713 | Not Available | 509 | Open in IMG/M |
3300017924|Ga0187820_1040046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 1242 | Open in IMG/M |
3300017928|Ga0187806_1275256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 588 | Open in IMG/M |
3300017932|Ga0187814_10184093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 783 | Open in IMG/M |
3300017933|Ga0187801_10385501 | Not Available | 581 | Open in IMG/M |
3300017942|Ga0187808_10076571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 1439 | Open in IMG/M |
3300017942|Ga0187808_10148985 | Not Available | 1030 | Open in IMG/M |
3300017942|Ga0187808_10264578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 771 | Open in IMG/M |
3300017943|Ga0187819_10551629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 655 | Open in IMG/M |
3300017943|Ga0187819_10657491 | Not Available | 592 | Open in IMG/M |
3300017995|Ga0187816_10084698 | Not Available | 1352 | Open in IMG/M |
3300020579|Ga0210407_10058318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 2888 | Open in IMG/M |
3300020579|Ga0210407_10785844 | Not Available | 735 | Open in IMG/M |
3300020583|Ga0210401_10619685 | Not Available | 943 | Open in IMG/M |
3300021088|Ga0210404_10442037 | Not Available | 731 | Open in IMG/M |
3300021168|Ga0210406_11169804 | Not Available | 562 | Open in IMG/M |
3300021171|Ga0210405_10443602 | Not Available | 1021 | Open in IMG/M |
3300021405|Ga0210387_11887030 | Not Available | 502 | Open in IMG/M |
3300021479|Ga0210410_11197902 | Not Available | 651 | Open in IMG/M |
3300021560|Ga0126371_10166636 | Not Available | 2277 | Open in IMG/M |
3300022533|Ga0242662_10215722 | Not Available | 610 | Open in IMG/M |
3300024288|Ga0179589_10107038 | Not Available | 1150 | Open in IMG/M |
3300025906|Ga0207699_10335331 | Not Available | 1064 | Open in IMG/M |
3300025910|Ga0207684_10041832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense | 3884 | Open in IMG/M |
3300025910|Ga0207684_10198868 | Not Available | 1729 | Open in IMG/M |
3300025915|Ga0207693_10017128 | All Organisms → cellular organisms → Bacteria | 5782 | Open in IMG/M |
3300025922|Ga0207646_11924210 | Not Available | 504 | Open in IMG/M |
3300025939|Ga0207665_11039122 | Not Available | 652 | Open in IMG/M |
3300026369|Ga0257152_1012358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300026482|Ga0257172_1009471 | Not Available | 1579 | Open in IMG/M |
3300026490|Ga0257153_1017109 | Not Available | 1475 | Open in IMG/M |
3300027094|Ga0208094_109379 | Not Available | 510 | Open in IMG/M |
3300027610|Ga0209528_1029178 | Not Available | 1220 | Open in IMG/M |
3300027654|Ga0209799_1022644 | Not Available | 1381 | Open in IMG/M |
3300027727|Ga0209328_10145179 | Not Available | 722 | Open in IMG/M |
3300027783|Ga0209448_10255463 | Not Available | 578 | Open in IMG/M |
3300027783|Ga0209448_10309855 | Not Available | 517 | Open in IMG/M |
3300027846|Ga0209180_10131782 | Not Available | 1436 | Open in IMG/M |
3300027862|Ga0209701_10377215 | Not Available | 796 | Open in IMG/M |
3300027862|Ga0209701_10741451 | Not Available | 501 | Open in IMG/M |
3300027903|Ga0209488_10127931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1914 | Open in IMG/M |
3300027903|Ga0209488_10228581 | Not Available | 1398 | Open in IMG/M |
3300027903|Ga0209488_10677211 | Not Available | 741 | Open in IMG/M |
3300027903|Ga0209488_10888530 | Not Available | 625 | Open in IMG/M |
3300028536|Ga0137415_10061265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 3629 | Open in IMG/M |
3300031543|Ga0318516_10065619 | Not Available | 2003 | Open in IMG/M |
3300031545|Ga0318541_10386359 | Not Available | 782 | Open in IMG/M |
3300031545|Ga0318541_10687491 | Not Available | 571 | Open in IMG/M |
3300031546|Ga0318538_10253612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300031573|Ga0310915_10189935 | Not Available | 1434 | Open in IMG/M |
3300031668|Ga0318542_10397527 | Not Available | 712 | Open in IMG/M |
3300031682|Ga0318560_10071903 | Not Available | 1747 | Open in IMG/M |
3300031682|Ga0318560_10828257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300031744|Ga0306918_10093391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2124 | Open in IMG/M |
3300031763|Ga0318537_10057407 | Not Available | 1418 | Open in IMG/M |
3300031765|Ga0318554_10800022 | Not Available | 527 | Open in IMG/M |
3300031768|Ga0318509_10302641 | Not Available | 895 | Open in IMG/M |
3300031771|Ga0318546_10645113 | Not Available | 745 | Open in IMG/M |
3300031795|Ga0318557_10132553 | Not Available | 1120 | Open in IMG/M |
3300031795|Ga0318557_10281553 | Not Available | 763 | Open in IMG/M |
3300031797|Ga0318550_10124702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 1228 | Open in IMG/M |
3300031798|Ga0318523_10384333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300031879|Ga0306919_10138648 | Not Available | 1762 | Open in IMG/M |
3300031879|Ga0306919_11432342 | Not Available | 521 | Open in IMG/M |
3300031910|Ga0306923_10088436 | Not Available | 3482 | Open in IMG/M |
3300031910|Ga0306923_10669446 | Not Available | 1158 | Open in IMG/M |
3300031912|Ga0306921_10291082 | Not Available | 1913 | Open in IMG/M |
3300031912|Ga0306921_11917120 | Not Available | 634 | Open in IMG/M |
3300031946|Ga0310910_11240693 | Not Available | 577 | Open in IMG/M |
3300031947|Ga0310909_10161540 | Not Available | 1847 | Open in IMG/M |
3300031947|Ga0310909_10819217 | Not Available | 768 | Open in IMG/M |
3300032059|Ga0318533_10086132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2153 | Open in IMG/M |
3300032059|Ga0318533_10507551 | Not Available | 884 | Open in IMG/M |
3300032059|Ga0318533_10896543 | Not Available | 650 | Open in IMG/M |
3300032060|Ga0318505_10406285 | Not Available | 644 | Open in IMG/M |
3300032060|Ga0318505_10612972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. ME-1 | 511 | Open in IMG/M |
3300032066|Ga0318514_10617137 | Not Available | 577 | Open in IMG/M |
3300032076|Ga0306924_11689827 | Not Available | 664 | Open in IMG/M |
3300032090|Ga0318518_10175621 | Not Available | 1093 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 10.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.64% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.03% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.42% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.21% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300027094 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF022 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1007495782 | 3300002245 | Forest Soil | MDALLSLVIPFVLLHHGFSSIVLKIFSEIKSGLKYWRETSKK* |
Ga0062384_1003219014 | 3300004082 | Bog Forest Soil | MRTLLGFVILFLLIHGFNSIVLKIISEIKSAFKYWRETSKK* |
Ga0062389_1002677341 | 3300004092 | Bog Forest Soil | TPMRTLLGFVILFLLFYGFNSIVLKIVSEIKSGFKYWREKSKK* |
Ga0062386_1008452772 | 3300004152 | Bog Forest Soil | MHALLGLAVLSLLIRGLNSIVLKLLLEIKSGLRYWRQTAKR |
Ga0066398_100096892 | 3300004268 | Tropical Forest Soil | MYILFSLLIPFALLHHGFNSIALKIVSRIKSGPKYWRETLKK* |
Ga0070709_115270311 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTLMSFVIPFVLIHHGFNSIVLKIISEIKSGLKYWCRTSKK* |
Ga0070708_1012481292 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALLSLVIPFVLLHHGFNSIALKIFSEIKSGLKYWCETSKK* |
Ga0070707_1003423202 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTLMSFVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSNK* |
Ga0070704_1020305751 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTLFNLMIPFALLHHGFNSIVLKTISEIKSGLKYWREISKK* |
Ga0066701_105218491 | 3300005552 | Soil | MYTLMSFVIPFVLVHYGFNSIVLKIISEIKSGLKYRREPSKK* |
Ga0066700_111757432 | 3300005559 | Soil | MHTLMSFVIPFVLVHYGFNSIVLKIISEIKSGLKYRREPSKK* |
Ga0070717_103387113 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHTLLGSIILFLLIHGFNSIVLAIYTEIKSGLKYWRETSKK* |
Ga0079221_115227641 | 3300006804 | Agricultural Soil | MYTLFSLMIPFALLHHGFNSIVLKIISEIKSGLKYWREISKK* |
Ga0079221_117718452 | 3300006804 | Agricultural Soil | MYTLFSLMIPFVLLHHGFNSIVLRIITEIKSGLKYWCEAAKK* |
Ga0075425_1013492632 | 3300006854 | Populus Rhizosphere | MYTLFSLMIPFALLHHGFNSIVLKIISEVKSGLKYWREISKK* |
Ga0075434_1012845213 | 3300006871 | Populus Rhizosphere | LFSLMIPFALLHHGFNSIVLKIISEIKSDLKYWRETTKN* |
Ga0099793_102258802 | 3300007258 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVLKIISEIKSGLKYWREISNK* |
Ga0099793_103336633 | 3300007258 | Vadose Zone Soil | SLAIPFVLLHHGFNSLVLKIILEIKSGLKYWRETSNK* |
Ga0099794_104749581 | 3300007265 | Vadose Zone Soil | MYALLSLVIPFVLVHHGFDSIVLKAISEIKSGLKYWRETSNK* |
Ga0099795_102206214 | 3300007788 | Vadose Zone Soil | FVIPFVLVHHGFNSVVLKIISEIKSGLKYWRETSNK* |
Ga0099795_104196332 | 3300007788 | Vadose Zone Soil | MYTLMSFVIPFVLLHHGFNSIVLKIISEIKSGLKYWRETSNK* |
Ga0099829_109506472 | 3300009038 | Vadose Zone Soil | MSFVIPFVLVHYGFNSIVLKIISEIKSGLKYRREPSKK* |
Ga0099830_106373711 | 3300009088 | Vadose Zone Soil | TPMYALLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSKK* |
Ga0099830_108874653 | 3300009088 | Vadose Zone Soil | ENTRMYTLMSFVIPFALIHHGFNSIVLKIISEIKSGLKYWREISNK* |
Ga0099830_113839551 | 3300009088 | Vadose Zone Soil | MYALLSLVIPFVLVHHGFNSIVLKIISAIKSGLKYWRETSKK* |
Ga0099828_103831912 | 3300009089 | Vadose Zone Soil | MYALLNLVIPFVLVHHDFNSIVLKIISEIKSGLKYWRET |
Ga0099828_111461932 | 3300009089 | Vadose Zone Soil | MHTLLGLVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSKK* |
Ga0099828_116836053 | 3300009089 | Vadose Zone Soil | FVIPFVLVHYGFNSIVLKIISEIKSGLKYRREPSKK* |
Ga0099792_100533976 | 3300009143 | Vadose Zone Soil | MTILMSFVIPFVLVHHGFNSIVLKIISEIKSGVKYWRETSNK* |
Ga0099792_105353933 | 3300009143 | Vadose Zone Soil | MTILMSLVIPFVLLHHGFNSIVLKIISEIKSGLKYWRETSNK* |
Ga0099792_105841971 | 3300009143 | Vadose Zone Soil | YALLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSNK* |
Ga0111538_137011243 | 3300009156 | Populus Rhizosphere | LLRRKKLPMYTLFSLMIPFALLHHGFNSIVLKIISEIKSGLKYWREISKK* |
Ga0075423_120479912 | 3300009162 | Populus Rhizosphere | MIPFALLHHGVNSIVLKIISEIKSGLKYWRETSKK* |
Ga0105242_129020912 | 3300009176 | Miscanthus Rhizosphere | MYTLCSLMIPFALLHHGFNSIVTKILSEIKSGLKYWRETS |
Ga0126374_105805613 | 3300009792 | Tropical Forest Soil | MYILFSLLIPFALLHHGFNSIALKIVSRIRSGPKYWRETLKK* |
Ga0126380_101687672 | 3300010043 | Tropical Forest Soil | MYILFSLLIPFALLHHGFNSIALKIVSRIKSGPKYWCETLKK* |
Ga0099796_100781492 | 3300010159 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVLKIFSEIKSGLKYWRETSNK* |
Ga0099796_105385462 | 3300010159 | Vadose Zone Soil | MTILMSFVIPFVLLHHGFNSIVLKIISEIKSGFKYLCETSKK* |
Ga0126378_103437651 | 3300010361 | Tropical Forest Soil | MYILFSLLIPFTLLHHGFNSIALKIVSRIKSGPKYWRETLKK* |
Ga0126377_119374592 | 3300010362 | Tropical Forest Soil | MRTLLSLAIPFALIHHGFNSIVLKIISAIKSGLKYW |
Ga0126381_1024133742 | 3300010376 | Tropical Forest Soil | MYTLYSLLIPFTLLHYGINSIVLKTISWIKSGFKYWRETSKK* |
Ga0137392_108050302 | 3300011269 | Vadose Zone Soil | MYTLMSFVIPFVLIHHGFSSIVLKIISEIKSGLKYWNETSKK* |
Ga0137391_104961633 | 3300011270 | Vadose Zone Soil | MYALLSLVIPFVLVHHGFNSIVLKIISEIKSGLKNWREISNK* |
Ga0137391_108997652 | 3300011270 | Vadose Zone Soil | MNTLMGFVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSKK* |
Ga0137393_107280612 | 3300011271 | Vadose Zone Soil | MYTLMSFVIPFVLIHHGFSSIVLKIISEIKSGLKYWREASNK* |
Ga0137389_103886561 | 3300012096 | Vadose Zone Soil | MSFVIPFVLIHHGFSSIVLKIISEIKSGLKYWREISNK* |
Ga0137389_107059192 | 3300012096 | Vadose Zone Soil | MYALLSLVILFVLVHHDLNSIVLKIISEIKSGLKYWRETSNK* |
Ga0137388_104834962 | 3300012189 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVLKIISEIKSGLRYWRETSNK* |
Ga0137365_110966321 | 3300012201 | Vadose Zone Soil | MYALLSVIIPFVLIHHGLNSIVLKIISEIKSGFKY* |
Ga0137363_101623855 | 3300012202 | Vadose Zone Soil | SFVIPFVLVHYGFNSIVLKIISEIKSGLKYRREPSKK* |
Ga0137363_107716242 | 3300012202 | Vadose Zone Soil | MYALLSLVIPFVLVHHGFNSVVLKIISAIKSGLKYWRETSNK* |
Ga0137363_109480072 | 3300012202 | Vadose Zone Soil | MYALFSLMIPFALLHHGFNSIVLKIISEIKSDLKYWRETSKK* |
Ga0137363_114353822 | 3300012202 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVMKIISEIKLGLKYWRETSNK* |
Ga0137380_107519382 | 3300012206 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVLKIISEIKSGLKYWHETSNK* |
Ga0137378_106973852 | 3300012210 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVLKIISEIKSGPKYWRETSKK* |
Ga0137378_117730793 | 3300012210 | Vadose Zone Soil | QEKHPMNTLFSLMIPFALLHHGFNSIVLKIISEVKSGLKYWRETSKK* |
Ga0137377_106866614 | 3300012211 | Vadose Zone Soil | MYALLSLIIPFVLIHHGLNSIVLKIISEIKSGFKY* |
Ga0137360_107259191 | 3300012361 | Vadose Zone Soil | TRMYTLMSFVIPFVLVHHGFNSVVLKIISAIKSGLKYWRETSNK* |
Ga0137360_107760481 | 3300012361 | Vadose Zone Soil | MYALLSVIIPFVLIHHGLNSIVLKIISEIKSGLKYWRETSEK* |
Ga0137361_106374992 | 3300012362 | Vadose Zone Soil | MHTLLGLVIPFVLVHHGFNSIVLKLVSEIKSGLKYWRETSKT* |
Ga0137361_106881042 | 3300012362 | Vadose Zone Soil | MDALLSLVIPFVLLHHGFSSIVLKIISEIKSGLKYWRETANK* |
Ga0137390_109032902 | 3300012363 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSLVLKSISAIKSGLKYWRETSNK* |
Ga0137398_105222832 | 3300012683 | Vadose Zone Soil | MYALLSLVIPFVLVHHGFNSIVLKIFSEIKSGLKYWRETSNK* |
Ga0137398_110062331 | 3300012683 | Vadose Zone Soil | PMYALLSLVLPFVLLHHGFNSIVLKMFSEIKSGLKYWRETSKK* |
Ga0137397_104133752 | 3300012685 | Vadose Zone Soil | MYTLLSLVIPFVLLHHGFSSIVLKIFSEIKSGFKYWCETSKK* |
Ga0137395_101235154 | 3300012917 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVLKIILEIKSGLKYWRETSNK* |
Ga0137396_112235272 | 3300012918 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVLKIISEIKSSLKYWRETSNK* |
Ga0137394_102780532 | 3300012922 | Vadose Zone Soil | MYALLSLIIPFVLLHHGLNSIVLKIISEIKSGLKYWLETSKK* |
Ga0137359_111399432 | 3300012923 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVLKIISEIKSGFKYWRETSNK* |
Ga0137413_102282652 | 3300012924 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSVVLKIISEIKSGLKYWREASNK* |
Ga0137410_101785383 | 3300012944 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSVVLKIISQIKSGLKYWRETSNK* |
Ga0164305_101315352 | 3300012989 | Soil | MYTLMSFVIPFVLVHHGFNSVVLKIISAIKSGLKYWRETSNK* |
Ga0137418_106344292 | 3300015241 | Vadose Zone Soil | MYTLMSFVIPFVLVHHGFNSIVLKIISQIKSGLKYWRETSNK* |
Ga0182036_103855803 | 3300016270 | Soil | MYTLFSLMVPFALLHHGFNSIALKIISEIRSGLKYWRETSKK |
Ga0182036_115035182 | 3300016270 | Soil | SAGEDPMGILFSFAILFVLVHHSFNSIVLKIISEIRSGLKYWRETSKK |
Ga0182041_104537512 | 3300016294 | Soil | MYTLLSLVIPFMVHHGFNSIVLKTISAIKSGFKYWRETSKK |
Ga0182033_101759851 | 3300016319 | Soil | AGETPMYTLLSLVIPFMVHHGFNSIVLKTISAIKSGFKYWRETSKK |
Ga0182033_102733631 | 3300016319 | Soil | TPMYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYRRETSEK |
Ga0182034_114065131 | 3300016371 | Soil | EHPAPQEKTPMYTLLSLVIPFMVHHGFNSIVLKTISAIKSGFKYWRETSKK |
Ga0187802_102170062 | 3300017822 | Freshwater Sediment | MRTLLGLVILFVLAHGFNSIVLKFVSEIKSGLKYWRETSKK |
Ga0187802_103341561 | 3300017822 | Freshwater Sediment | MRTPLLGLVVLFLLVHGFNSIVLKLVAEIKSGLKYWRETAKK |
Ga0187818_101195011 | 3300017823 | Freshwater Sediment | EAPMHALLGLVVLSVLVHGCNSIVLKLLSQITSGLNYWRETAKK |
Ga0187818_105747132 | 3300017823 | Freshwater Sediment | MRTPLLGLVVLFVLVHGFNSIVLKLLSEIKSGLKYWRETANK |
Ga0187820_10400462 | 3300017924 | Freshwater Sediment | MRTLLGLVILFVLVHGFNSIVLKIVSEIKSGLKYWRETSKK |
Ga0187806_12752561 | 3300017928 | Freshwater Sediment | PRGKPMRTLLGVVTLFVLVHGFNSIVLKIVSEIQSGLKYWRETSKK |
Ga0187814_101840932 | 3300017932 | Freshwater Sediment | MRTLLGLVILFVLVHGFNSIVLKAVSEIKSGLKYWRETSKK |
Ga0187801_101846792 | 3300017933 | Freshwater Sediment | MRTPLLGLVVLFLLVHGCNSIVLKLVAEIKSGLKYWRDTAKK |
Ga0187801_103855012 | 3300017933 | Freshwater Sediment | MRPLLGLVILFVLVHGFNSIVLKIVSEIKSGLKYCRETSKK |
Ga0187808_100765711 | 3300017942 | Freshwater Sediment | MRTLLGLVILFVLVHGFNSIVLKIVSEIKSVIKYCRETSKK |
Ga0187808_101489854 | 3300017942 | Freshwater Sediment | MRTLLGVVILFVLVHGFNSIVLKIVSDIKSGLKYWRETSKK |
Ga0187808_102645782 | 3300017942 | Freshwater Sediment | MRTLLLCLLILSLPVHGFNSIVLKMIAEIKSGLKYWRETSKK |
Ga0187819_103220011 | 3300017943 | Freshwater Sediment | MHALLGLVVLSVLVHGCNSIVLKLLSQITSGLNYWRETAKK |
Ga0187819_104964932 | 3300017943 | Freshwater Sediment | SIPLPEKPPMRTPLLGLVVLFLLVHGFNSIVLKLVAEIKSGLKYWRETAKR |
Ga0187819_105516291 | 3300017943 | Freshwater Sediment | MHILLGLAILPILVHGFNSIVLTLFSEIKSGLKYWRETAKR |
Ga0187819_106574911 | 3300017943 | Freshwater Sediment | MHALLGLVVLFVLVHGFNSIVLKLVSEIKSGLKYWRETAKK |
Ga0187817_103990662 | 3300017955 | Freshwater Sediment | MHVLLALAVPSLLTHCVNSIVLKLLLEIKSGLKYWRETAKK |
Ga0187816_100846985 | 3300017995 | Freshwater Sediment | MRTPLLGLVVLFLLVHGFNSIVLKLVAEIKSGLKYWRETANR |
Ga0210407_100583182 | 3300020579 | Soil | MYALLSLAIPFVLLHHGFNSIVLKIISEIKSGLKYWCETSKK |
Ga0210407_107858441 | 3300020579 | Soil | MYTLMSFVIPFVLVHHGFNSVVLKIISEIKSGLKYWRETSNK |
Ga0210401_106196852 | 3300020583 | Soil | MRTLLGFVILFVLVHGFNSIVLKIISEIKSGFKYLRETSKK |
Ga0210404_104420373 | 3300021088 | Soil | MYTLMSFVIPLVLVHHGFNSVVLKIISAIKSRLKYWRETSNK |
Ga0210406_111698041 | 3300021168 | Soil | MYTLMSFVIPFVLVHHGFNSIVLKIISEIKSGLKYWCETSKK |
Ga0210405_104436021 | 3300021171 | Soil | MDALLSLAIPFVLLHHGFSSIVLKIFSEIKSGLKYWRETSKK |
Ga0210387_118870301 | 3300021405 | Soil | ALLSLVIPFVLLHHGFRSIVLKIFSEIKSGLKYWRETSNK |
Ga0210410_111979023 | 3300021479 | Soil | LSLVIPFVLLHHGFNSIVLKIFSEIKSGLQYWRETSNK |
Ga0126371_101666362 | 3300021560 | Tropical Forest Soil | MYTLFSLMIPFVLLHHCFNSIVLKIITEIKSGLKYRREASKK |
Ga0242662_102157221 | 3300022533 | Soil | MYTLMSFVIPFVLVHHGFNSVVLKIISEIKSIVPLSVV |
Ga0179589_101070381 | 3300024288 | Vadose Zone Soil | MYALLSLVIPFVLVHHGFNSIVLKIFSEIKSGLKYWRET |
Ga0207699_103353312 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTLMSFVFPFVLVHHGFNSVVLKIISAIKSGLKYWRETSNK |
Ga0207684_100418322 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHTLLGSIILFLLIHGFNSIVLAIYSEIKSGLKYWRETSKK |
Ga0207684_101988682 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTLMSFVIPFVLLHHGFNSLVLKIFLEIKSGLKYRCDTSNK |
Ga0207693_100171282 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTLMSFVIPFVLIHHGFNSIVLKIISEIKSGLKYWCRTSKK |
Ga0207646_119242102 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTLMSFVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSNK |
Ga0207665_110391223 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWCETSKK |
Ga0257152_10123583 | 3300026369 | Soil | MYTLMSFVIPFALIHHGFNSIVLKIISEIKSGLKYWRETSNK |
Ga0257172_10094711 | 3300026482 | Soil | MDALLSLVIPFVLVHHGFNSVVLKIISQIKSGLKYWRETSNK |
Ga0257153_10171092 | 3300026490 | Soil | MHTLMSFVIPFVLVHHGFNSIVLKIFSEIKSGLKYWRETSNK |
Ga0208094_1093792 | 3300027094 | Forest Soil | MYTLMSFVIPFVLVQHGFNSLVLKIILEIKSGLKYWRETSNK |
Ga0209528_10291781 | 3300027610 | Forest Soil | MDALLSLVIPFVLLHHGFNSIVLKIFSEIKSGLKYWRETSKK |
Ga0209799_10226442 | 3300027654 | Tropical Forest Soil | MYILFSLLIPFALLHHGFNSIALKIVSRIKSGPKYWRETLKK |
Ga0209328_101451791 | 3300027727 | Forest Soil | MYALLSLVIPFVLLHHGFNSIVLKIFSEIKSGLKYWRETSKK |
Ga0209448_102554632 | 3300027783 | Bog Forest Soil | MRTLLGFVILFLLFYGFNSIVLKIVSEIKSGFKYWRETSKK |
Ga0209448_103098552 | 3300027783 | Bog Forest Soil | MHALLGLVVLFVLVHGCNSIVLKLVPEIKSGLKYWRETAKK |
Ga0209180_101317822 | 3300027846 | Vadose Zone Soil | MYALLSLVIPFVLVHHGFNSIVLKAISEIKSGLKYWRETSNK |
Ga0209701_103772151 | 3300027862 | Vadose Zone Soil | MYALLSLVIPFVLVHHGFNSIVLKIISAIKSGLKYWRETSKK |
Ga0209701_107414511 | 3300027862 | Vadose Zone Soil | MYALLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWREISNK |
Ga0209488_101279311 | 3300027903 | Vadose Zone Soil | RKEKTPMYALLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSNK |
Ga0209488_102285814 | 3300027903 | Vadose Zone Soil | MDALLSLVIPFVLLHHGLSSIVLKIFSEIKSGLKYWCETSKK |
Ga0209488_106772113 | 3300027903 | Vadose Zone Soil | MTILMSLVIPFVLLHHGFNSIVLKIISEIKSGLKYWRETSNK |
Ga0209488_108885301 | 3300027903 | Vadose Zone Soil | PMYALLSLVIPFVLVHHDFNSIVLKIISEIKSGLKYWRETSNK |
Ga0137415_100612654 | 3300028536 | Vadose Zone Soil | MTILMSFVIPFVLVHHGFNSIVLKIISEIKSGVKYWRETSNK |
Ga0318516_100656192 | 3300031543 | Soil | MYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYRRGL |
Ga0318541_103863591 | 3300031545 | Soil | LLSLVIPFMVHHGFNSIVLKTISAIKSGFKYWRETSKK |
Ga0318541_106874913 | 3300031545 | Soil | YTLFSLMVPFALLHHGFNSIALKIISEIKSGIKYWRETPKK |
Ga0318538_102536122 | 3300031546 | Soil | MYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWAETTKK |
Ga0310915_101899355 | 3300031573 | Soil | MYTLFSLMIPFALLHHGFNSITLKIISEIRSGLKYWRETSKK |
Ga0318542_103975271 | 3300031668 | Soil | MYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKY |
Ga0318560_100719031 | 3300031682 | Soil | MYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYRRETSEK |
Ga0318560_108282571 | 3300031682 | Soil | MYTLFSLMVPFALLHHGFNSIALKIISEIKSGIKYWRETSKK |
Ga0306918_100933915 | 3300031744 | Soil | MYTLFSLMVPFALLHHGFNSITLKIISEIRSGLKYWRETSKK |
Ga0318537_100574072 | 3300031763 | Soil | MYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYR |
Ga0318554_108000221 | 3300031765 | Soil | MYTLFSLMVPFALLHHGFNSISLKIISEIKSGIKYWRETPKK |
Ga0318509_103026412 | 3300031768 | Soil | MYTLFSLMIPFVLLHHGFNSIVLKIITEIKSGLKYWREVSKK |
Ga0318546_106451132 | 3300031771 | Soil | MYTLFSLIIPFVLLHHGFNSIVLRIITEIKSGVKYW |
Ga0318557_101325531 | 3300031795 | Soil | MYTLLSLVIPFVLVHHGFNSIVLKTISAIKSGFKYWRET |
Ga0318557_102815532 | 3300031795 | Soil | MYTLFSLMIPFALLHHGFNSIALKIISEIRSGLKYWRETSKK |
Ga0318550_101247022 | 3300031797 | Soil | LFSLMIPFVLLHHGFNSIVLRIITEIKSGVKYWCEAAKK |
Ga0318523_103843332 | 3300031798 | Soil | MYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSEK |
Ga0306919_101386483 | 3300031879 | Soil | MYTLFSLMVPFALLHHGFNSIALKIISEIKSGIKYWRETPKK |
Ga0306919_114323423 | 3300031879 | Soil | TLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWAETTKK |
Ga0306923_100884364 | 3300031910 | Soil | MYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGFKYWRETSKK |
Ga0306923_106694462 | 3300031910 | Soil | MYTLFSLMIPFVLLHHGFNSIVLRIITEIKSGVKYWCEAAKK |
Ga0306921_102910821 | 3300031912 | Soil | MYTLFSLMIPFVLLHHGFSSIVLGIITEIKSGLKYRREAS |
Ga0306921_119171202 | 3300031912 | Soil | MQTLFSLIIPFVLINHGLNRIVLNVISEIKSRVKNWRETPKQ |
Ga0310910_112406931 | 3300031946 | Soil | VIPFVLVHHGFNSIVLKIISEIKSGLKYWAETTKK |
Ga0310909_101615404 | 3300031947 | Soil | MYTLLSLVIPFMVHHGFNSIVLKTISAIKSGFKYWRET |
Ga0310909_108192171 | 3300031947 | Soil | MYTLFSLMIPFVLLHHGFNSIFLKIITEIKSGLKYWREASKK |
Ga0318533_100861325 | 3300032059 | Soil | MYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYRR |
Ga0318533_105075514 | 3300032059 | Soil | TLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYRRGL |
Ga0318533_108965433 | 3300032059 | Soil | LFSLMVPFALLHHGFNSIALKIISEIKSGIKYWRETPKK |
Ga0318505_104062852 | 3300032060 | Soil | MYTLFSLMIPFVLLHHGFNSIVLRIITEIKSGVKYWCEAAK |
Ga0318505_106129721 | 3300032060 | Soil | PMYTLFSLMIPFVLLHHGFNSIVLRIITEIKSGVKYWCEAAKK |
Ga0318514_106171371 | 3300032066 | Soil | EKTPMYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYRRETSEK |
Ga0306924_116898271 | 3300032076 | Soil | MIPFVLLHHGFNSIVLRIITEIKSGVKYWCEAAKK |
Ga0318518_101756211 | 3300032090 | Soil | HPAPQEKTPMYTLLSLVIPFVLVHHGFNSIVLKIISEIKSGLKYWRETSEK |
⦗Top⦘ |