 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F038155 |
| Family Type | Metagenome |
| Number of Sequences | 166 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MANNDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 68.67 % |
| % of genes near scaffold ends (potentially truncated) | 32.53 % |
| % of genes from short scaffolds (< 2000 bps) | 82.53 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.446 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (37.349 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.482 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (77.711 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.49% β-sheet: 2.82% Coil/Unstructured: 81.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF13830 | DUF4192 | 1.20 |
| PF14216 | DUF4326 | 1.20 |
| PF00565 | SNase | 1.20 |
| PF06067 | DUF932 | 1.20 |
| PF07659 | DUF1599 | 0.60 |
| PF01807 | zf-CHC2 | 0.60 |
| PF05257 | CHAP | 0.60 |
| PF02467 | Whib | 0.60 |
| PF13578 | Methyltransf_24 | 0.60 |
| PF00085 | Thioredoxin | 0.60 |
| PF04232 | SpoVS | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.60 |
| COG2359 | Stage V sporulation protein SpoVS, predicted DNA-binding, AlbA superfamily | Function unknown [S] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.45 % |
| All Organisms | root | All Organisms | 38.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 37.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.84% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.22% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.01% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.81% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.81% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.81% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.20% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.20% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.60% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.60% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.60% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.60% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027211 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24219J26650_10042091 | 3300002098 | Lentic | RPNGKAAKKNPKTNIKKGKTIGGYTPAKLAIRAAKRAA* |
| B570J29032_1093983222 | 3300002408 | Freshwater | LNHTQYESNGDNMANNNRKNGKAYKKKPKVQKKTGKTIGGYSPSKLAIRAKKRGM* |
| JGI25908J49247_100437453 | 3300003277 | Freshwater Lake | MASNDRKNGKAYKKKPKIQKKTGKTIDGYSPAKLAIRAQKRGK* |
| JGI25910J50241_100187005 | 3300003388 | Freshwater Lake | MRNPDRKNGKAWKKAPKVNRKTGRTVGGYSPAKLAERASKRKG* |
| JGI25909J50240_10145684 | 3300003393 | Freshwater Lake | MASNDRKNGKAYXXKPXXQXKTGKTIDGYSPAKLAIRAQKRGK* |
| JGI25930J51415_10089323 | 3300003499 | Freshwater Lake | MKHITSRTGDSMASNDRKNGKAYKKKPKVQKKTGKTIGGYSPSKLAIRAKKRGM* |
| Ga0066182_101510361 | 3300004125 | Freshwater Lake | MNRMGDSMASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRSK* |
| Ga0066179_101301902 | 3300004126 | Freshwater Lake | MTTNNRKNGKASKKKPKVQKKTGKTIGGYSIAKLAIRAQKRSK* |
| Ga0070374_100681751 | 3300005517 | Freshwater Lake | LQKGATMRNPDRKNGKAWKKAPKVNRKTGRTVGGYSPAKLAERASKRKG* |
| Ga0070374_103895371 | 3300005517 | Freshwater Lake | MNRMGDSMASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRGK* |
| Ga0068876_101321504 | 3300005527 | Freshwater Lake | PNPNRKNGKAPKKNPKTAKKTGKTIGGYSPEKLAIRAQKRLESV* |
| Ga0068876_104285682 | 3300005527 | Freshwater Lake | LIETQYESNGDSMTTTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK* |
| Ga0068876_104964872 | 3300005527 | Freshwater Lake | MANNDRKNGKAWKKKPKVQKKTGRTIDGYSPAKLAIRAKKRGM* |
| Ga0068872_101360831 | 3300005528 | Freshwater Lake | MTTTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK* |
| Ga0049081_100642204 | 3300005581 | Freshwater Lentic | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQ |
| Ga0049080_100309183 | 3300005582 | Freshwater Lentic | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRSK* |
| Ga0049085_101648453 | 3300005583 | Freshwater Lentic | VSNERKNGKAWKKKPKVQKKTGRTIDGYSPAKLVERAQK |
| Ga0049082_101175823 | 3300005584 | Freshwater Lentic | VSNERKNGKAWKKKPKVQKKTGRTIDGYSPAKLVE |
| Ga0049082_101896731 | 3300005584 | Freshwater Lentic | MERKNGKAAKKKPKTQKKTGRTIGGYSLSKLAIRAIKRGAK* |
| Ga0079957_10207275 | 3300005805 | Lake | MANNDRKNGKAWKKKPKVQKKTGKTIDGYSPAKLAIRAKKRGM* |
| Ga0079957_10622446 | 3300005805 | Lake | MATTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK* |
| Ga0073913_100913791 | 3300005940 | Sand | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIR |
| Ga0073926_101027732 | 3300005943 | Sand | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAIRAKK |
| Ga0070749_100937273 | 3300006802 | Aqueous | VSATNTQRKNGKAWKKHPKVQKKTGKTVGGYSLAKLAMRAQRRKSV* |
| Ga0075464_104394852 | 3300006805 | Aqueous | MANNDRKNGKAYKKKPKVQKKTGKTINGYSPAKLAIRAKKRGM* |
| Ga0102828_11520141 | 3300007559 | Estuarine | MNRIGDSMASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRSK* |
| Ga0102863_100207812 | 3300007622 | Estuarine | MSRIGDSMASNDRKNGKAYKKKPKVQKKTGKTIGGYSPSKLAIRAKKRGM* |
| Ga0070751_12443191 | 3300007640 | Aqueous | NTQRKNGKAWKKHPKVQKKTGKTVGGYSLAKLAMRAQRRKSV* |
| Ga0104988_1093936 | 3300007735 | Freshwater | MATTDRKNGKAYKKKPKVQKKTGKTISGYSPAKLAIRAQKRGK* |
| Ga0105745_13262012 | 3300007972 | Estuary Water | MSRIGDSMASNDRKNGKAYKKKPKAQKKTGKTIDGYSPAKLAIRAKKRGM* |
| Ga0114340_10787231 | 3300008107 | Freshwater, Plankton | MTTTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQ |
| Ga0114340_11104575 | 3300008107 | Freshwater, Plankton | MKHNTSRTGDNMANNDRKNGKAWKKKPKVQKKTGRTIDGYSPAKLAIRAKKRGM* |
| Ga0114340_11120896 | 3300008107 | Freshwater, Plankton | MANNDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK* |
| Ga0114340_11524862 | 3300008107 | Freshwater, Plankton | VSNERKNGKAWKKKPKVQKKTGKTIGGYTPAKLAIRAQKRGK* |
| Ga0114341_101665084 | 3300008108 | Freshwater, Plankton | MATTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAI |
| Ga0114341_105200711 | 3300008108 | Freshwater, Plankton | SMATTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK* |
| Ga0114343_10863684 | 3300008110 | Freshwater, Plankton | MATTDRKNGKAYKKKPKVQKKTGKTIDGYSPTKLAIRAQKRGK* |
| Ga0114343_10871503 | 3300008110 | Freshwater, Plankton | MATTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQMAL* |
| Ga0114343_11394163 | 3300008110 | Freshwater, Plankton | MKHITSRTGDNMANNDRKNGKAWKKKPKVQKKTGRTIDGYSPAKLAIRAKKRGM* |
| Ga0114346_11297731 | 3300008113 | Freshwater, Plankton | MATTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQ |
| Ga0114346_12273301 | 3300008113 | Freshwater, Plankton | MANNDRKNGKAYKKKPKIQKKTGKTIGGYSPSKLAIRAKKRGM* |
| Ga0114347_10203453 | 3300008114 | Freshwater, Plankton | MKHITSRTGDSMANNDRKNGKAWKKKPKVQKKTGRTIDGYSPAKLAIRAKKRGM* |
| Ga0114347_10384842 | 3300008114 | Freshwater, Plankton | MATTDRKNGKAYKKKPKVQKKTGKTIGGYSLAKLAIRAQKRGK* |
| Ga0114347_11246671 | 3300008114 | Freshwater, Plankton | MANSDRKNGKAWKKKPKVQKKTGRTIDGYSPAKLAIRAKKRGM* |
| Ga0114350_10879513 | 3300008116 | Freshwater, Plankton | MANNDRKNGKAWKKKPKVQKKTGRTIDGYSPAKLAIR |
| Ga0114363_10703312 | 3300008266 | Freshwater, Plankton | MANNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRSK* |
| Ga0114973_104508741 | 3300009068 | Freshwater Lake | MANNDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAKKRGM* |
| Ga0114973_105198183 | 3300009068 | Freshwater Lake | MASNDRKNGKASKKKPKVQKKTGKTIDGYSPAKLAIRAQKRGK* |
| Ga0114968_101404081 | 3300009155 | Freshwater Lake | MANNDRKNGKAWKKKPKVAKKTGRTIGGYSPAKLVARAVKRKKAVVVDFSA* |
| Ga0114978_100157807 | 3300009159 | Freshwater Lake | MERKNGKAAKKKPKVQKKTGKTIGGYSLSKLAIRALKRGGKQ* |
| Ga0114978_100690372 | 3300009159 | Freshwater Lake | MANNDRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAIRAKKRGM* |
| Ga0114969_100216221 | 3300009181 | Freshwater Lake | KAWKKKPKVAKKTGRTIGGYSPAKLVARAAKRKKAVVIDFPA* |
| Ga0114967_100379453 | 3300010160 | Freshwater Lake | MANNNRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAIRAKKRGM* |
| Ga0114967_101490202 | 3300010160 | Freshwater Lake | MANNDRKNGKAWKKKPKVAKKTGRTIGGYSPAKLVARAAKRKKAVVIDFPA* |
| Ga0114967_103970181 | 3300010160 | Freshwater Lake | KNGKAAKKKPKTQKKTGRTIGGYSLSKLAIRAIKRGVK* |
| Ga0129333_110974154 | 3300010354 | Freshwater To Marine Saline Gradient | KNGKAWKKHPKVQKKTGKTVGGYSLAKLAMRAQRRKSV* |
| Ga0129333_112041222 | 3300010354 | Freshwater To Marine Saline Gradient | VGTTNSQRKNGKAWKKHPKVQKKTGKTIGGYSLAKLAARKEKRAK* |
| Ga0133913_102856743 | 3300010885 | Freshwater Lake | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAEKRSK* |
| Ga0133913_122545561 | 3300010885 | Freshwater Lake | MANNDRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAIRA |
| Ga0133913_126915681 | 3300010885 | Freshwater Lake | SMANNDRKNGKAYKKKPKVQKKTGKTINGYSPAKLAIRAKKRGM* |
| Ga0133913_130359724 | 3300010885 | Freshwater Lake | MERKNGKAAKKKPKTQKKTGRTIGGYSLSKLAIRAIKRGA |
| Ga0139557_10032456 | 3300011010 | Freshwater | MASNDRKNGKAWKKKPKVAKKTGRTICGYSPAKLAIRAIKRKKAVVVDFPA* |
| Ga0139557_10288013 | 3300011010 | Freshwater | MNTTRPNGKAYKKRPKVQKQTGKTIGGYSPTKLAIRAQKRAKA* |
| Ga0151514_1018410 | 3300011115 | Freshwater | MNTNRPNGKAYKKRPKVQKQTGKTIGGYSPTKLAIRAQKRAKA* |
| Ga0153799_10382121 | 3300012012 | Freshwater | PNPNRKNGKAPKKNPKTAKKTGKTIGGYSPEKLAIRAQKRLGLV* |
| Ga0164292_105622564 | 3300013005 | Freshwater | TTDRKNGKAWKKKPKVQKKTGRTIDGYSPAKLAIRAQKRSK* |
| (restricted) Ga0172373_100300815 | 3300013131 | Freshwater | MANNDRKNGKAWKKKPKVQRKTGKTIGGYSLAKLAIRDAKRKKAVVVDFMA* |
| (restricted) Ga0172372_103682913 | 3300013132 | Freshwater | MTNNDRKNGKAWKKKPKVQKKTGKTIDGYSLAKLAIRAKKRGK* |
| (restricted) Ga0172362_107007262 | 3300013133 | Sediment | MSRTGNSMTNNDRKNGKAWKKKPKVQKKTGKTIDGYSLAKLAIRAKKRGK* |
| Ga0136641_11475391 | 3300013286 | Freshwater | DSRANGKANKKHPKTNRKTGKTIGGYSPAKLKIRAEKRFNQITQ* |
| Ga0181350_11581101 | 3300017716 | Freshwater Lake | KNGKAAKKKPKTQKKTGKTIGGYSLSKLAIRAIKRGAK |
| Ga0181362_10122082 | 3300017723 | Freshwater Lake | MASNDRKNGKAWKKKPKVAKKTGRTIGGYTPAKLAIRAIKRKKAVVVDFPA |
| Ga0181362_11238231 | 3300017723 | Freshwater Lake | REKEGIMERKNGKAWKKKPKVQKKTGRTIGGYSLSKLAIRAIKRGAK |
| Ga0181365_10819071 | 3300017736 | Freshwater Lake | MASNDRKNGKAFKKKPKVQKKTGKTIGGYSPAKLAIRAQKRSK |
| Ga0181365_11329181 | 3300017736 | Freshwater Lake | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRS |
| Ga0181356_10972622 | 3300017761 | Freshwater Lake | LNHTHHESNGDSMASNDRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAIRAKKRGM |
| Ga0181356_11292225 | 3300017761 | Freshwater Lake | KNGKAAKKKPKVQKKTGRTIGGYSLSKLAIRALKRRAK |
| Ga0181356_12201461 | 3300017761 | Freshwater Lake | NGKAWKKKPKVQKKTGRTIGGYSLSKLAIRAIKRGAK |
| Ga0181356_12503251 | 3300017761 | Freshwater Lake | MNRTGDSMASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRGK |
| Ga0181358_12525641 | 3300017774 | Freshwater Lake | GKAAKKKPKTQKKTGRTIGGYSLSKLAIRAIKRGAK |
| Ga0181357_10504342 | 3300017777 | Freshwater Lake | MNRTGDSMASNDRKNGKAYKKKPKIQKKTGKTIDGYSPAKLAIRAQKRGK |
| Ga0181357_10537893 | 3300017777 | Freshwater Lake | MANNDRKNGKASKKKPKVQKKTGKTIGGYSIAKLAIRAQKRSK |
| Ga0181357_11245715 | 3300017777 | Freshwater Lake | MERKNGKAAKKKPKVQKKTGRTIGGYSLSKLAIRALKRRRASK |
| Ga0181357_11725341 | 3300017777 | Freshwater Lake | MERKNGKAAKKKPKTQKKTGRTIGGYSLSKLAIRALKRGV |
| Ga0181357_13217141 | 3300017777 | Freshwater Lake | MTTNNRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAKKRGM |
| Ga0181346_10698362 | 3300017780 | Freshwater Lake | MGNDNRKNGKAWKKKPKVAKKTGRTIGGYSPAKLAIRAEKRKKAVVIDFPA |
| Ga0181346_11372651 | 3300017780 | Freshwater Lake | RKNGKAWKKAPKVNRKTGRTVGGYSPAKLAERASKRKG |
| Ga0181346_12449331 | 3300017780 | Freshwater Lake | ERVMERKNGKAAKKKPKTQKKTGRTIGGYSLSKLAIRALKRRAK |
| Ga0181346_12627931 | 3300017780 | Freshwater Lake | MASNDRKNGKASKKKPKVQKKTGKTIGGYSIAKLAIRAQKRSK |
| Ga0181348_10387615 | 3300017784 | Freshwater Lake | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPATLAIRAQKRSK |
| Ga0181348_10908692 | 3300017784 | Freshwater Lake | MNRIGDSMASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRGK |
| Ga0181355_11417191 | 3300017785 | Freshwater Lake | MSSNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRSK |
| Ga0181359_10126989 | 3300019784 | Freshwater Lake | MERKNGKAAKKKPKVQKKTGRTIGGYSLSKLAIRALKRKRATSGK |
| Ga0181359_10386341 | 3300019784 | Freshwater Lake | GKAYKKKPKVQKKTGKTIDGYSPSKLAIRAKKRGM |
| Ga0181359_10659752 | 3300019784 | Freshwater Lake | MNRIGDSMASNDRKNGKAYKKKPKIQKKTGKTIDGYSPAKLAIRAQKRGK |
| Ga0181359_11718941 | 3300019784 | Freshwater Lake | MERKNGKAAKKKPKTQKKTGRTIGGYSLSKLAIRAIKRGAK |
| Ga0181359_12586091 | 3300019784 | Freshwater Lake | MNRMGDSMASNDRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAIRAKKRGI |
| Ga0211736_109261782 | 3300020151 | Freshwater | MASNDRKNGKAWKKKPKVAKKTGRTIGGYSPAKLAIRAIKRKKAVVVDFPA |
| Ga0211733_104229253 | 3300020160 | Freshwater | MERKNGKAWKKKPKVQKKTGRTIGGYSLSKLAIRAIKRGAK |
| Ga0211726_105567653 | 3300020161 | Freshwater | MASNDRKNGKAWKKKPKVAKKTGKTIGGYSPAKLAIRAIKRKKAVVVDFSA |
| Ga0194115_101904131 | 3300020183 | Freshwater Lake | MRNNDRKNGKAWKKKPKVQKKTGKTIKGYSHVKLVK |
| Ga0194115_104864931 | 3300020183 | Freshwater Lake | MRNNDRKNGKAWKKKPKVQKKTGKTIKGYSHVRFVERAQKRGLIPSVMSK |
| Ga0194118_100776931 | 3300020190 | Freshwater Lake | KEIAMRNNDRKNGKAWKKKPKVQKKTGKTIKGYSHVRFVERAQKRGLIPSVMSK |
| Ga0208235_10070436 | 3300020530 | Freshwater | KNGKAPKKNPKTAKKTGKTIGGYSPEKLAIRAQKRLESV |
| Ga0222712_100890943 | 3300021963 | Estuarine Water | MANNNRKNGKAWKKKPKVQKKTGRTIDGYSPAKLVIRAKKRGM |
| Ga0222712_101364901 | 3300021963 | Estuarine Water | MATTDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRGK |
| Ga0181353_10253161 | 3300022179 | Freshwater Lake | MKHITSRTGDSMASNDRKNGKAYKKKPKVQKKTGKTIGGYSPSKLAIRAKKRGM |
| Ga0181354_10851693 | 3300022190 | Freshwater Lake | MASNDRKNGKASKKKPKVQKKTGKTIDGYSPAKLAIRAQKRGM |
| Ga0181354_11320702 | 3300022190 | Freshwater Lake | MERKNGKAAKKKPKVQKKTGRTIGGYSLSKLAIRALKRGVK |
| Ga0181354_11843161 | 3300022190 | Freshwater Lake | MGDSMASNDRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAIRAKKRGI |
| Ga0181354_11971882 | 3300022190 | Freshwater Lake | MGNDNRKNGKAWKKKPKVAKKTGRTIGGYSPAKLAIRAVKRKKAVVIDFPA |
| Ga0181351_10660443 | 3300022407 | Freshwater Lake | MANNDRKNGKASKKKPKVQKKTGKTIDGYSPAKLAIRAQKRGM |
| Ga0181351_10703571 | 3300022407 | Freshwater Lake | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPTKLAIRAQKRN |
| Ga0181351_11856642 | 3300022407 | Freshwater Lake | MERKNGKAAKKKPKVQKKTGKTIGGYSLSKLAIRALKRGGKQ |
| Ga0228702_10438524 | 3300022748 | Freshwater | MRNNDRKNGKAWKKKPKVTKKTGKTIDGYSADKLAIRAQKRAK |
| Ga0214917_101259116 | 3300022752 | Freshwater | NSDRKNGKAWKKKPKVQKKTGRTIDGYSPAKLAIRAKKRGM |
| Ga0214921_100318909 | 3300023174 | Freshwater | VSNERKNGKAWKKKPKVQKKTGKTIGGYTPAKLAIRAQKRGK |
| Ga0214921_102914583 | 3300023174 | Freshwater | MTSNDRKNGKAYKKKPKVQKKTGKTIDGYSPNKLAIRAKK |
| Ga0214919_101378004 | 3300023184 | Freshwater | MERKNGKAAKKKPKVQKKTGRTIGGYSLSKLAIRALKRRAK |
| Ga0208644_13659161 | 3300025889 | Aqueous | GQPVSATNTQRKNGKAWKKHPKVQKKTGKTVGGYSLAKLAMRAQRRKSV |
| Ga0208916_102911482 | 3300025896 | Aqueous | MANNDRKNGKAYKKKPKVQKKTGKTINGYSPAKLAIRAKKRGM |
| Ga0208307_10067233 | 3300027211 | Estuarine | MSRIGDSMASNDRKNGKAYKKKPKVQKKTGKTIGGYSPSKLAIRAKKRGM |
| Ga0209867_10739661 | 3300027393 | Sand | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAI |
| Ga0208974_11300292 | 3300027608 | Freshwater Lentic | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRSK |
| Ga0209357_12050074 | 3300027656 | Freshwater Lake | DRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAQKRSK |
| Ga0209769_10134126 | 3300027679 | Freshwater Lake | MRNPDRKNGKAWKKAPKVNRKTGRTVGGYSPAKLAERASKRKG |
| Ga0209769_11205862 | 3300027679 | Freshwater Lake | MTTNNRKNGKASKKKPKVQKKTGKTIGGYSIAKLAIRAQKRSK |
| Ga0209442_12621612 | 3300027732 | Freshwater Lake | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAI |
| Ga0209190_10750691 | 3300027736 | Freshwater Lake | MANNNRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAIRAKKRGM |
| Ga0209596_10616521 | 3300027754 | Freshwater Lake | MGNDNRKNGKAWKKKPKVAKKTGRTIGGYSPAKLVARAAKRKKAVVIDFPA |
| Ga0209768_101709041 | 3300027772 | Freshwater Lake | MASNDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRSK |
| Ga0209768_102920442 | 3300027772 | Freshwater Lake | MERKNGKAAKKKPKVQKKTGRTIGGYSLSKLAIRALKRRTK |
| Ga0209246_100146886 | 3300027785 | Freshwater Lake | MASNDRKNGKAYKKKPKIQKKTGKTIDGYSPAKLAIRAQKRGK |
| Ga0209246_101358662 | 3300027785 | Freshwater Lake | MASNNRKNGKASKKKPKVQKKTGKTIGGYSIAKLAIRAKKRGM |
| Ga0209972_100942462 | 3300027793 | Freshwater Lake | VNNERKNGKAWKKKPKVQKKTGKTIGGYTPAKLAIRAQKRGK |
| Ga0209972_103556821 | 3300027793 | Freshwater Lake | PNPNRKNGKAPKKNPKTAKKTGKTIGGYSPEKLAIRAQKRLESV |
| Ga0209972_104615912 | 3300027793 | Freshwater Lake | LIETQYESNGDSMATTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK |
| Ga0209107_101730873 | 3300027797 | Freshwater And Sediment | MERKNGKAVKKKPKTQKKTGRTIGGYSLSKLAIRAIKRKGERV |
| Ga0209353_103529753 | 3300027798 | Freshwater Lake | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPSKLAIRAKKRGI |
| Ga0209354_103014492 | 3300027808 | Freshwater Lake | MERKNGKAAKKKPKTQKKTGRTIGGYSLSKLAIRALKRGVK |
| Ga0209354_103187071 | 3300027808 | Freshwater Lake | KAAKKKPKVQKKTGRTIGGYSLSKLAIRALKRRAK |
| Ga0209990_102015611 | 3300027816 | Freshwater Lake | MTTTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK |
| Ga0209401_12684002 | 3300027971 | Freshwater Lake | MANNDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAKKRGM |
| Ga0209299_12885801 | 3300027974 | Freshwater Lake | RTMERKNGKAAKKKPKTQKKTGRTIGGYSLSKLAIRAIKRGAK |
| Ga0247723_10007654 | 3300028025 | Deep Subsurface Sediment | MASNDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAKKRGM |
| Ga0304730_10982701 | 3300028394 | Freshwater Lake | MASNDRKNGKAYKKKPKVQKKTGKTINGYSPAKLAIRAKKRGM |
| Ga0315907_102940422 | 3300031758 | Freshwater | MATTDRKNGKAYKKKPKVQKKTGKTIGGYSLAKLAIRAQKRGK |
| Ga0315288_104820586 | 3300031772 | Sediment | MASNDRKNGKAYKKKPKVQKKTGKTIDGYSPAKLAIRAKKRGI |
| Ga0315900_103318611 | 3300031787 | Freshwater | LIETQYESNGDSMATTDRKNGKAYKKKPKVQKKTGKTIGGYSLAKLAIRAQKRGK |
| Ga0315900_108320101 | 3300031787 | Freshwater | MANSDRKNGKAWKKKPKVQKKTGRTIDGYSPAKLAIRAKKRGM |
| Ga0315900_109195602 | 3300031787 | Freshwater | LIETQYESNGDSMTTTDRKNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK |
| Ga0315909_102942785 | 3300031857 | Freshwater | KNGKAYKKKPKVQKKTGKTIGGYSPAKLAIRAQKRGK |
| Ga0315909_107400262 | 3300031857 | Freshwater | LIETQYESNGNSMATTDRKNGKAYKKKPKVQKKTGKTIGGYSLAKLAIRAQKRGK |
| Ga0315297_110224081 | 3300031873 | Sediment | MERKNGKAAKKKPKVQKKTGRTIGGYSLSKLAIRALKRKRVSNGK |
| Ga0315904_114759101 | 3300031951 | Freshwater | DNVSNERKNGKAWKKKPKVQKKTGKTIGGYTPAKLAIRAQKRGK |
| Ga0315274_115265722 | 3300031999 | Sediment | MGNDNRKNGKAWKKKPKVAKKTGRTIGGYSPAKLAIRAIKRKKAVVIDFPA |
| Ga0315274_121138441 | 3300031999 | Sediment | MERKNGKAAKKKPKVQKKTGRTIGGYSLSKLAIRAIKRGAK |
| Ga0315903_102529564 | 3300032116 | Freshwater | MANNDRKNGKAWKKKPKVQKKTGKTIDGYSPAKLAIRAKKRGM |
| Ga0334986_0063810_2156_2287 | 3300034012 | Freshwater | MASNDRKNGKAYKKKPKVQKKTGKTIGGYSLSKLAIRAKKRGM |
| Ga0335002_0182317_3_110 | 3300034020 | Freshwater | MERKNGKAAKKKPKVQKKTGKTIGGYSLSKLAIRAL |
| Ga0335010_0129186_1178_1330 | 3300034092 | Freshwater | MNRIGDSMASNDRKNGKAYKKKPKVQKKTGKTIGGYSLSKLAIRAKKRGM |
| Ga0335010_0276187_2_139 | 3300034092 | Freshwater | NDRPNGKARKQKPRKQRKTGRTVGGYSPAKLAERAKKRAGNVGKE |
| Ga0335010_0584233_3_116 | 3300034092 | Freshwater | NGKAWKKKPKTQKKTGRTIGGYSLSKLAIRAIKRGAK |
| Ga0335029_0549154_117_248 | 3300034102 | Freshwater | MASNDRKNGKAYKKKPKVQKKTGKTIGGYSPSKLAIRAKKRGM |
| Ga0335030_0393895_522_653 | 3300034103 | Freshwater | MATTDRKNGKAWKKKPKVQKKTGRTINGYSPAKLAIRAQKRSK |
| Ga0335036_0003792_4340_4471 | 3300034106 | Freshwater | MASNDRKNGKAYKKKPKVQKKTGRTIGGYSLSKLAIRAKKRGM |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |