NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037836

Metagenome / Metatranscriptome Family F037836

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037836
Family Type Metagenome / Metatranscriptome
Number of Sequences 167
Average Sequence Length 39 residues
Representative Sequence MASKTEETPQKEEMPEKEGPETLPDSPLLDLSDAAVKK
Number of Associated Samples 139
Number of Associated Scaffolds 167

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.06 %
% of genes near scaffold ends (potentially truncated) 94.01 %
% of genes from short scaffolds (< 2000 bps) 93.41 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.072 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.551 % of family members)
Environment Ontology (ENVO) Unclassified
(37.725 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.299 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.55%    β-sheet: 0.00%    Coil/Unstructured: 95.45%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 167 Family Scaffolds
PF01165Ribosomal_S21 11.98
PF05362Lon_C 1.80
PF00313CSD 1.80
PF00343Phosphorylase 1.20
PF00140Sigma70_r1_2 1.20
PF00571CBS 1.20
PF05598DUF772 1.20
PF07750GcrA 1.20
PF13185GAF_2 0.60
PF03006HlyIII 0.60
PF07508Recombinase 0.60
PF03979Sigma70_r1_1 0.60
PF13683rve_3 0.60
PF13763DUF4167 0.60
PF02190LON_substr_bdg 0.60
PF13581HATPase_c_2 0.60
PF00271Helicase_C 0.60
PF13333rve_2 0.60
PF04986Y2_Tnp 0.60
PF00982Glyco_transf_20 0.60
PF00027cNMP_binding 0.60
PF01734Patatin 0.60
PF07369DUF1488 0.60
PF12769PNTB_4TM 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 167 Family Scaffolds
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 11.98
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 1.80
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.80
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 1.80
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 1.80
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 1.80
COG0058Glucan phosphorylaseCarbohydrate transport and metabolism [G] 1.20
COG5352Uncharacterized conserved proteinFunction unknown [S] 1.20
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 0.60
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 0.60
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.60
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.60
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.60
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.07 %
UnclassifiedrootN/A35.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000580|AF_2010_repII_A01DRAFT_1059847Not Available582Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1005454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2425Open in IMG/M
3300001213|JGIcombinedJ13530_109204374Not Available647Open in IMG/M
3300004479|Ga0062595_102187611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium541Open in IMG/M
3300004479|Ga0062595_102289083Not Available532Open in IMG/M
3300005332|Ga0066388_106263868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300005332|Ga0066388_106879332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales572Open in IMG/M
3300005332|Ga0066388_108521577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales510Open in IMG/M
3300005556|Ga0066707_10913713All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005557|Ga0066704_10072482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2219Open in IMG/M
3300005713|Ga0066905_100288888All Organisms → cellular organisms → Bacteria → Proteobacteria1281Open in IMG/M
3300005713|Ga0066905_101373527Not Available638Open in IMG/M
3300005713|Ga0066905_102126428Not Available522Open in IMG/M
3300005764|Ga0066903_100637231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1859Open in IMG/M
3300005764|Ga0066903_102275882All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1046Open in IMG/M
3300006032|Ga0066696_10327191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria998Open in IMG/M
3300006046|Ga0066652_101131051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria742Open in IMG/M
3300006059|Ga0075017_100300461Not Available1185Open in IMG/M
3300006102|Ga0075015_100102507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1439Open in IMG/M
3300006176|Ga0070765_100216695All Organisms → cellular organisms → Bacteria1743Open in IMG/M
3300006176|Ga0070765_102131336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales523Open in IMG/M
3300006796|Ga0066665_10822404Not Available730Open in IMG/M
3300006796|Ga0066665_11637379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales508Open in IMG/M
3300006800|Ga0066660_11148184Not Available612Open in IMG/M
3300006847|Ga0075431_100734125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales964Open in IMG/M
3300007076|Ga0075435_100710679Not Available874Open in IMG/M
3300009156|Ga0111538_12053118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium719Open in IMG/M
3300009177|Ga0105248_12120360All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300009522|Ga0116218_1260278Not Available779Open in IMG/M
3300009522|Ga0116218_1325752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300009525|Ga0116220_10281282Not Available730Open in IMG/M
3300009698|Ga0116216_10207161Not Available1202Open in IMG/M
3300009808|Ga0105071_1085511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300010358|Ga0126370_12141990Not Available550Open in IMG/M
3300010361|Ga0126378_12433122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300010361|Ga0126378_12812334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300010366|Ga0126379_10820338All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300010376|Ga0126381_104558662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300010398|Ga0126383_12605606Not Available589Open in IMG/M
3300010398|Ga0126383_13479009Not Available514Open in IMG/M
3300010880|Ga0126350_10063161Not Available507Open in IMG/M
3300011271|Ga0137393_10558623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria982Open in IMG/M
3300011271|Ga0137393_11062106Not Available688Open in IMG/M
3300011420|Ga0137314_1163959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300012010|Ga0120118_1050323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga arsenatis1052Open in IMG/M
3300012096|Ga0137389_10430138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1129Open in IMG/M
3300012137|Ga0137346_1041301Not Available619Open in IMG/M
3300012189|Ga0137388_10613895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1011Open in IMG/M
3300012201|Ga0137365_10804891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300012209|Ga0137379_11318494Not Available627Open in IMG/M
3300012285|Ga0137370_10386511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium846Open in IMG/M
3300012358|Ga0137368_10181227All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1519Open in IMG/M
3300012361|Ga0137360_10817063Not Available802Open in IMG/M
3300012469|Ga0150984_101152149Not Available584Open in IMG/M
3300012685|Ga0137397_11338502All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012922|Ga0137394_10707012All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300012923|Ga0137359_11628246Not Available533Open in IMG/M
3300012925|Ga0137419_11519749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300012944|Ga0137410_10202834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1536Open in IMG/M
3300012986|Ga0164304_10969115Not Available671Open in IMG/M
3300012989|Ga0164305_10890056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium747Open in IMG/M
3300014325|Ga0163163_11210912Not Available818Open in IMG/M
3300015371|Ga0132258_11568043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1663Open in IMG/M
3300015372|Ga0132256_103210187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium550Open in IMG/M
3300015373|Ga0132257_103148212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300016294|Ga0182041_10847135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria819Open in IMG/M
3300016319|Ga0182033_12108550Not Available514Open in IMG/M
3300016341|Ga0182035_11199741Not Available678Open in IMG/M
3300016341|Ga0182035_12132523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300016371|Ga0182034_11399724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium611Open in IMG/M
3300016387|Ga0182040_11824562Not Available521Open in IMG/M
3300016404|Ga0182037_11396560Not Available619Open in IMG/M
3300016422|Ga0182039_10868066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria804Open in IMG/M
3300016422|Ga0182039_11622956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300016422|Ga0182039_11675674Not Available581Open in IMG/M
3300016422|Ga0182039_12112593Not Available519Open in IMG/M
3300016445|Ga0182038_10222590All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300016445|Ga0182038_12127582Not Available509Open in IMG/M
3300017822|Ga0187802_10367559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300018056|Ga0184623_10440403Not Available566Open in IMG/M
3300018422|Ga0190265_13806951Not Available503Open in IMG/M
3300018433|Ga0066667_10996482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium723Open in IMG/M
3300018468|Ga0066662_10759179All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300020015|Ga0193734_1080994Not Available558Open in IMG/M
3300021344|Ga0193719_10036904All Organisms → cellular organisms → Bacteria2114Open in IMG/M
3300021401|Ga0210393_10249572Not Available1439Open in IMG/M
3300021402|Ga0210385_10104240All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300021411|Ga0193709_1101764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300021433|Ga0210391_10207017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1543Open in IMG/M
3300025846|Ga0209538_1209265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae723Open in IMG/M
3300025862|Ga0209483_1077450Not Available1497Open in IMG/M
3300025888|Ga0209540_10148068All Organisms → cellular organisms → Bacteria → Proteobacteria1420Open in IMG/M
3300025915|Ga0207693_10266567Not Available1342Open in IMG/M
3300025928|Ga0207700_11646715Not Available567Open in IMG/M
3300026277|Ga0209350_1086595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium820Open in IMG/M
3300026309|Ga0209055_1123292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria977Open in IMG/M
3300026532|Ga0209160_1077162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1773Open in IMG/M
3300026879|Ga0207763_1005000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1466Open in IMG/M
3300027313|Ga0207780_1082690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300027645|Ga0209117_1135317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria651Open in IMG/M
3300027875|Ga0209283_10803243All Organisms → cellular organisms → Bacteria → Proteobacteria578Open in IMG/M
3300027882|Ga0209590_10933030Not Available545Open in IMG/M
3300027907|Ga0207428_10620713All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300028711|Ga0307293_10192140Not Available650Open in IMG/M
3300028717|Ga0307298_10191177All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300028784|Ga0307282_10341926Not Available723Open in IMG/M
3300028799|Ga0307284_10447329All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300028881|Ga0307277_10029253All Organisms → cellular organisms → Bacteria2187Open in IMG/M
3300028884|Ga0307308_10192634All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300029636|Ga0222749_10687471Not Available560Open in IMG/M
3300030730|Ga0307482_1162001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300030905|Ga0308200_1064243All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300030989|Ga0308196_1030680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium674Open in IMG/M
3300031090|Ga0265760_10283581Not Available583Open in IMG/M
3300031561|Ga0318528_10402670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium735Open in IMG/M
3300031573|Ga0310915_10870239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300031573|Ga0310915_11249904Not Available512Open in IMG/M
3300031640|Ga0318555_10296873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium874Open in IMG/M
3300031668|Ga0318542_10338232Not Available773Open in IMG/M
3300031719|Ga0306917_10302619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1235Open in IMG/M
3300031719|Ga0306917_10852728Not Available713Open in IMG/M
3300031723|Ga0318493_10385560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria765Open in IMG/M
3300031740|Ga0307468_101779408Not Available583Open in IMG/M
3300031744|Ga0306918_10124253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium1874Open in IMG/M
3300031748|Ga0318492_10020849All Organisms → cellular organisms → Bacteria2845Open in IMG/M
3300031770|Ga0318521_10376794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria843Open in IMG/M
3300031771|Ga0318546_11023646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium581Open in IMG/M
3300031778|Ga0318498_10507992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300031792|Ga0318529_10099112All Organisms → cellular organisms → Bacteria → Proteobacteria1313Open in IMG/M
3300031795|Ga0318557_10123253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Phyllobacterium1160Open in IMG/M
3300031805|Ga0318497_10880339Not Available503Open in IMG/M
3300031832|Ga0318499_10176570Not Available833Open in IMG/M
3300031845|Ga0318511_10323634Not Available699Open in IMG/M
3300031879|Ga0306919_10493707All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300031879|Ga0306919_11178300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300031880|Ga0318544_10375591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300031894|Ga0318522_10382620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300031910|Ga0306923_11201900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria810Open in IMG/M
3300031910|Ga0306923_12228912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300031941|Ga0310912_10204670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1509Open in IMG/M
3300031941|Ga0310912_11527205Not Available502Open in IMG/M
3300031942|Ga0310916_10624666Not Available915Open in IMG/M
3300031942|Ga0310916_10835073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria774Open in IMG/M
3300031945|Ga0310913_10455543All Organisms → cellular organisms → Bacteria → Proteobacteria908Open in IMG/M
3300031946|Ga0310910_11173008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300031947|Ga0310909_11223217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria607Open in IMG/M
3300031954|Ga0306926_11718704Not Available715Open in IMG/M
3300031954|Ga0306926_12273770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300031959|Ga0318530_10183287Not Available856Open in IMG/M
3300031959|Ga0318530_10481241Not Available515Open in IMG/M
3300031981|Ga0318531_10087969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1358Open in IMG/M
3300032001|Ga0306922_10537433All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300032001|Ga0306922_10700001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1066Open in IMG/M
3300032035|Ga0310911_10376656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria820Open in IMG/M
3300032042|Ga0318545_10093646All Organisms → cellular organisms → Bacteria → Proteobacteria1048Open in IMG/M
3300032060|Ga0318505_10230356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium870Open in IMG/M
3300032066|Ga0318514_10405542All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300032160|Ga0311301_10213421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3274Open in IMG/M
3300032261|Ga0306920_100692318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1502Open in IMG/M
3300032261|Ga0306920_103461435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300033290|Ga0318519_10069067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1827Open in IMG/M
3300034148|Ga0364927_0132264All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium710Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.19%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.40%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.99%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.80%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.20%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.20%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.20%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.20%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.20%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.60%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.60%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.60%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.60%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.60%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.60%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.60%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.60%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012137Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT560_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300025846Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A01DRAFT_105984723300000580Forest SoilMASKTQETSQKEEMLEKEGPETLPDSPLLDVSDPA
AF_2010_repII_A100DRAFT_100545413300000655Forest SoilMASKTQETPQKEPEKEGPETLPDSPRLDLSDAAIKELIRSAK
JGIcombinedJ13530_10920437413300001213WetlandMATKTDKTPQEDELPEKRGPESPPDSPLLDLSDAAVK
Ga0062595_10218761113300004479SoilMTSNTEVMPQKEEVPETEGLETPPDRPVLDLSGAAIKALIRSASTR
Ga0062595_10228908323300004479SoilVERLMASKTNATPQQEEVPNKEGSETPPDSPLLDLSGAAV
Ga0066388_10626386823300005332Tropical Forest SoilVWRLMASTTEETPQKEEMPEKEGPETLPDSPLLDLSDAAV
Ga0066388_10687933223300005332Tropical Forest SoilMASHTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIRSA
Ga0066388_10852157713300005332Tropical Forest SoilMASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIRS
Ga0066707_1091371323300005556SoilMARKTRVTPQKVQLPEKEGPETPSESPLLDLSDAAVKK
Ga0066704_1007248243300005557SoilMASKTKETPQKQEMPEKEGPETLPDSPLLDLSDAAVKK
Ga0066905_10028888813300005713Tropical Forest SoilMASKTEETPQKEEMLEKDGPETLPDSPLLDLSDPAVK
Ga0066905_10137352733300005713Tropical Forest SoilMASKTEETPQKEEMPEKAGPETPPDDLSDAAIAKL
Ga0066905_10212642813300005713Tropical Forest SoilMASKTEETPQKEEMLETEGPLLSLSDGAVRELARFGKKHGYVTSDQINSVLP
Ga0066903_10063723113300005764Tropical Forest SoilMASKTEKTPQKEEMPEKAGPETLPHDLSDAAITKLIRS
Ga0066903_10227588213300005764Tropical Forest SoilMASKTEETPQKEEMLEMEGPETLPDSPLLGLSDGAVRE
Ga0066696_1032719133300006032SoilMASNTKMTPLKEEVLEKEGSEIRPDSPLLDLSDAAIKKL
Ga0066652_10113105113300006046SoilMASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAA
Ga0075017_10030046123300006059WatershedsMASKIKVMPQKEEMLEKEDPETQSDRPLLDLSAAAVKELI
Ga0075015_10010250713300006102WatershedsMASKTKVTPQKEEMPEKEGPETSPDGPLLDLLENRTVRLRRGGAH
Ga0070765_10021669533300006176SoilMAGKIVVTPLKEEMLEKEGPEAPPDSPLLDLSDMAV
Ga0070765_10213133613300006176SoilMASKIKVMPQKEEMLEKDGPETQSDRPLLDLSAVAVKELIRNA
Ga0066665_1082240413300006796SoilMASKTEKTPQKEEMLEKDGPETLPDSPLLELSDPAVKELIRSLQAR*
Ga0066665_1163737923300006796SoilMAGKTKATPRKDEVPDKEGPDTSPDSPLLDLSDAAVK
Ga0066660_1114818413300006800SoilMTSKTEETPQKEEMLEKDGPETLPDSPLLDLSDPAVKE
Ga0075431_10073412533300006847Populus RhizosphereMAIKAKGTPQTEPVPATEGPETPPDRPLLDLLDAAVKKLIRTAK
Ga0075435_10071067943300007076Populus RhizosphereMANSTEATPQQNETEKEASETPDSPLPLLDLSDAAVKKLI
Ga0111538_1205311833300009156Populus RhizosphereMAIKAKGTPQTEPVPATEGPETPPDRPLLDLLDAA
Ga0105248_1212036023300009177Switchgrass RhizosphereMASNNMTPLKKEVLEKEGHEIRPDSSLLDLSDAAIEKLIRSAKKS
Ga0116218_126027813300009522Peatlands SoilMASKTKVKPQKEGIPEKEGSGTPLDRPLFDLSDAA
Ga0116218_132575223300009522Peatlands SoilMTSKINVTSQKEEMREKEGPETQSDRPLLDLSAVA
Ga0116220_1028128213300009525Peatlands SoilMASKTEVKGQKHATPEREGHETPPDGPLLDLSDAAIKK
Ga0116216_1020716113300009698Peatlands SoilMASKIKVMPQKEEMLEQEDPETQSDRPVLDLSAAVK
Ga0105071_108551113300009808Groundwater SandMASKTEVTPRKEEVPEKEGPETPPDSPLVDLSNAA
Ga0126370_1214199013300010358Tropical Forest SoilMASNIKATPQKEEVPEKEGPETLPDSPLLDLFDAAV
Ga0126378_1243312213300010361Tropical Forest SoilMASKTEETPQKEEMLEIEGPETLPESPLLGISDGAVREL
Ga0126378_1281233423300010361Tropical Forest SoilMASNIRATSQKEDAPEKEGPETLPDSPLLLDPSDAAVKKLI
Ga0126379_1082033823300010366Tropical Forest SoilMASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAI
Ga0126381_10455866213300010376Tropical Forest SoilMASKIQETPQKGEIPEKEGPETLPDSPLLGLSDGAVRE
Ga0126383_1260560623300010398Tropical Forest SoilMASKSKPTLQKDEVPEKEDPEAPPDSPLLDLPGAAIRTLN*
Ga0126383_1347900913300010398Tropical Forest SoilMASKTEETPQKEEMLEMEGPETLPESPLLGLSDGAVR
Ga0126350_1006316113300010880Boreal Forest SoilMTSKTKVTPQKEEMLEKECLEGPPDSPPIDRLNDSVKALVRTAV
Ga0137393_1055862333300011271Vadose Zone SoilMASKTKVTRQKEEVPEKGGPETPPDSPLLDLSNAAVEVLI
Ga0137393_1106210613300011271Vadose Zone SoilMASSPKVTPQKDKVPEKGGSETPPDSPLLGLSDAAV
Ga0137314_116395913300011420SoilMASKTKVTPQKEEMLEKEGPETLPGSPLLDLSNAAVKALI
Ga0120118_105032313300012010PermafrostMASKTNATPQKEEVPKKEGPETPPDSPLLDLSDAAVKK
Ga0137389_1043013823300012096Vadose Zone SoilMARKTKVTPQKEEVPEKAGPETPPESSLLDLSAAAVKKLIR
Ga0137346_104130113300012137SoilMASKSKVMPQKEEMLEKEGPETPPDSPLLDLSNAAVKAL
Ga0137388_1061389533300012189Vadose Zone SoilMASKTKMTRQKEEVPEKGGPETPPDSPLLDLSNAAV
Ga0137365_1080489123300012201Vadose Zone SoilMASKTEETPQKEEMLEMEGPETLPESPLLGLSDGAVREL
Ga0137379_1131849413300012209Vadose Zone SoilMASNTNMPPQNEDVPEKVGPDTSPDSPLLDLSDAAVKTL
Ga0137370_1038651123300012285Vadose Zone SoilMASKTEETPQKEEMPEMEGPETLPDSPLLGLADGAVRELVRC
Ga0137368_1018122713300012358Vadose Zone SoilMASKTEETPQKEEMLEKDGPETLPDSPLLDLSDPAVKE
Ga0137360_1081706313300012361Vadose Zone SoilMASKTKATPPHEEVLAKEGHESPPDRPLLDLSDAAV
Ga0150984_10115214913300012469Avena Fatua RhizosphereMASKTEVTPQKEEVPEKEGPETPPDSPLLDLSDVAIKK
Ga0137397_1133850223300012685Vadose Zone SoilMASKTEETPQKEEMPEKEGPETLSDSSLLDLSDAAVK
Ga0137394_1070701223300012922Vadose Zone SoilMATKINATPQKEEVPKKEGPETSPDNPPLDLSDSAVKKHI
Ga0137359_1162824613300012923Vadose Zone SoilMASSPKVTPPEDKVPEKGGSETPPDSPLLGLSDAAVKKLIRTAKK
Ga0137419_1151974923300012925Vadose Zone SoilMASKTEVTPQKEEVPEKEGPETPPDSPLLDLSDAAIKK
Ga0137410_1020283443300012944Vadose Zone SoilMASKTNATPRKEEVPNKEGPETPPDSPLLDLSGAA
Ga0164304_1096911513300012986SoilMASKTEETPQKEEMMEKDGPETLPDSTLLDPSDPAVKELIRS
Ga0164305_1089005623300012989SoilMASEIEETPQKEEMLEKDGPETLPDSPLLDLSDPAV
Ga0163163_1121091223300014325Switchgrass RhizosphereMASKTEVAPQKEEVPEKEGPETPPDSPLLDLSDVAINKLV
Ga0132258_1156804343300015371Arabidopsis RhizosphereMPSKTKVTPQKEPVLAKEGHETLPDRPLLDLLDAAVKKLIRTAK
Ga0132256_10321018713300015372Arabidopsis RhizosphereMPSKTKVTPQKEPVLAKEGPETLPDRPLLDLLDAAV
Ga0132257_10314821213300015373Arabidopsis RhizosphereMASKTNVTPQKEELEMEGPATPPDSPQLGLSNAAIKALIRTA*
Ga0182041_1084713523300016294SoilMASNTKRTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIRS
Ga0182033_1210855013300016319SoilMASKTEETPQKEEMLEIEGPETLPESPLLGLSDGAV
Ga0182035_1119974113300016341SoilMASKTKVTPQKEGAPEKEGADTLPDCPLLDLCDVAVK
Ga0182035_1213252313300016341SoilMASNTKMSPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLI
Ga0182034_1139972423300016371SoilMASKTKVTPQEGEVPETAGPKTPPDSPLLDLPDAAV
Ga0182040_1182456213300016387SoilMASKTEETPQKEKMPEKEGPDTLPDSPLLDPSDAAVK
Ga0182037_1139656013300016404SoilMASKTEETPQKEEMPEKDGPETLSDSPLRDLSDPAVKD
Ga0182039_1086806613300016422SoilMASNTKRTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIR
Ga0182039_1162295613300016422SoilMAKTEETPQKQEMLEKEGPETLPDSPLLDLSDPAV
Ga0182039_1167567413300016422SoilMASTSKVTPQKEEVPEKEGADTLPDCPLLDLSDAAVKK
Ga0182039_1211259313300016422SoilMASKVKMPPLKEEVLEKEGPEIRPDSPLLDLSDAAIK
Ga0182038_1022259013300016445SoilMASKTKVTPPEVEVPETAGPETPPDSPLLDLPDAAVKKLI
Ga0182038_1212758213300016445SoilMASKTKVTPQKEEVPEKVGADTLPDCPLLDLSDAAVKK
Ga0187802_1036755913300017822Freshwater SedimentMASKINVMPKEEMLEKEGPETQSDRPLLDLSAVAVKELI
Ga0184623_1044040313300018056Groundwater SedimentMASKTEVTPQKEEVLEKEGPETPPDSPLLDLSDVAIKKL
Ga0190265_1380695113300018422SoilMASKTKAMPQKEEAPEKEAGDSPDSPLLDLSDAAV
Ga0066667_1099648213300018433Grasslands SoilMASKTKITPQKEEMLEKEEGPETPPDRPLFDLWNASVKALIRTTKERG
Ga0066662_1075917923300018468Grasslands SoilMASNTNMPPQNEDVPEKVGPDTSPDSPLLDLSDAAV
Ga0193734_108099413300020015SoilMASKAEVTPQKEEVLEKEGPETPPDSPLLDLSDAAI
Ga0193719_1003690443300021344SoilMANKTIATPQKEELPKKEGPETPPDSPPLDLSDAA
Ga0210393_1024957213300021401SoilMASKTKVTVQEEAVPPETEGATTLPDSPLLDVADGAV
Ga0210385_1010424013300021402SoilMASKTVVTPLKGEMLEKEGPEAPPDSPLLDLSDMA
Ga0193709_110176413300021411SoilMASKTEVTPQKEEVAEKEGPETPPDSPLLDLSDVAI
Ga0210391_1020701713300021433SoilMASKTKVTPQKEVMLEKEGRETPPGSPLLDLSDAAVKKLI
Ga0209538_120926513300025846Arctic Peat SoilMASKTNATPQKEEVPKKEGPETSPDSPLLDLSDAA
Ga0209483_107745013300025862Arctic Peat SoilMASKTNATPKQEDVPKKEGTETPPDSPLLDLSDAAVKK
Ga0209540_1014806813300025888Arctic Peat SoilMASKTNATPQKEEVPKKEGPETSPGSPLLDLSDAAVKK
Ga0207693_1026656723300025915Corn, Switchgrass And Miscanthus RhizosphereMASDTKATSQKEDLPEKETPESAPDSPLLDLSDAAVKKLI
Ga0207700_1164671513300025928Corn, Switchgrass And Miscanthus RhizosphereMASKTDETPQGEEVLEKPLETPSDIPLLDLSDPAVGN
Ga0209350_108659523300026277Grasslands SoilMASKTKETPQKEEMPEKEGRETLPDSPLLDLSDAAVKK
Ga0209055_112329223300026309SoilMATKTNATPQKEEVPKNEGPETPPDSPPLNLSDAAVKKLI
Ga0209160_107716233300026532SoilMASKTKETPQKQEMPEKEGPETLPDSPLLDLSDAAVKKF
Ga0207763_100500033300026879Tropical Forest SoilMASKAKMTRQKENVSEEGPETPPDNPLLDLSDAAVKKFIRAV
Ga0207780_108269013300027313Tropical Forest SoilMASNTKMTPLKEEVLEKECPEIRPDSPLLDLSDAAIK
Ga0209117_113531723300027645Forest SoilMASKTKVTPQKEEMLEKEGPETPPDSPLIDRSNASVKA
Ga0209283_1080324313300027875Vadose Zone SoilMANKTKVTPQKDKVPEKEGQETPSDSPLLDLSDAA
Ga0209590_1093303013300027882Vadose Zone SoilMASKTEETPQKEEMPEKEGPETLPDDLSDAAITKLIR
Ga0207428_1062071313300027907Populus RhizosphereMANKTKVTPQKDKVPEKGGSETPPDSPLLDLVADLRAS
Ga0307293_1019214013300028711SoilMASKTEVTRQTQEASERDGRETPSDGPLLDLSDAAVKKLIHSA
Ga0307298_1019117713300028717SoilMANKTIATPEKEEVPKKEGPETPPDSPLLDLSDAAIKK
Ga0307282_1034192623300028784SoilVRAQRRLWRFMASNTDVTPQKEEVSKNEGPETPPDSPLL
Ga0307284_1044732913300028799SoilMANKTIATPQKEEVPKKEGPETPPDSPPLDLSDAAVKKLIR
Ga0307277_1002925343300028881SoilMATNTNATPQKEEVPKNEGPETPPDSPPLNLSDAAVK
Ga0307308_1019263433300028884SoilMERLIATNATPQKKEAPKKEGPETPPDSPPLDLSDAAV
Ga0222749_1068747113300029636SoilMATNTNATPQKEEVPKNEGPETPPDSPPLNLSDAAVKKLIRSAKK
Ga0307482_116200113300030730Hardwood Forest SoilMASKIKVIPQKEEILEKEGPETQSDRTLLDLSAAAVKE
Ga0308200_106424323300030905SoilMATKTNATPQKEEVPKKEGPETPPDSPPLYLSDSAVKKLI
Ga0308196_103068013300030989SoilQPRLWRLMASKTEVTPQTEEVPEKEGLETPPDSPLLDLSDAAIK
Ga0265760_1028358113300031090SoilMASKIKVMPQKEEMLEKEGPETQSDRPLLDLSAAAVKVADPQRQ
Ga0318528_1040267013300031561SoilMASKIKVTPQKVEVPETAGLETPPDSPLLDLLDAAV
Ga0310915_1087023913300031573SoilMASKTEETPQKEEMPEMEGPETLPDSPLLGLSDGAV
Ga0310915_1124990413300031573SoilMVSKTGEMPQKEEMPEKEGPETLPDSPLLDLSDAAVK
Ga0318555_1029687333300031640SoilMASKTEETPQKEEMLEIEGPETLTDSPLLGLSDGAVRE
Ga0318542_1033823213300031668SoilMASKTEETSQKEEMPEMEGPETLPDSPLLGLSDGAVREL
Ga0306917_1030261923300031719SoilMASKTEETPQKEEMLEIEGPETLPESPLLGISDGAVRELVRSAKK
Ga0306917_1085272813300031719SoilMASKTEETPQKEEMPEKEGPETLPDSPLLDLSDAAVKKL
Ga0318493_1038556013300031723SoilMASKTQETPQKEPEKEGPETLPDSPRLDLSDAAIKELIR
Ga0307468_10177940813300031740Hardwood Forest SoilMASKTEQTPQKQEMLEMEGPETLPDSPLLGLSDGAVRELVRFA
Ga0306918_1012425343300031744SoilMVSKTGEMPQKEEMPEKEGPETLPDSPLLDLSDAAVKK
Ga0318492_1002084913300031748SoilMASKTEETPQKEEMLEIKGPETLPESPLLGLSDGAVRELVRSAKKR
Ga0318521_1037679423300031770SoilMASKNEETPQKEEILEMEGAETLPERPLLGLSDGAVR
Ga0318546_1102364623300031771SoilMASKIKVTPQKVEVPETAGLETPPDSPLLDLLDAAVKNLIRSAEK
Ga0318498_1050799213300031778SoilMASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAINK
Ga0318529_1009911223300031792SoilMASKTEETPQKEEMLEMEGPETLPESPLLGLSDGAVRELVRSAK
Ga0318557_1012325323300031795SoilMASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDASIKKLIG
Ga0318576_1039405933300031796SoilMASDIKAMSHKEDLPEKETPESAPDRPLLDFSDAAVKKAPPHR
Ga0318550_1011599933300031797SoilMASDTKATSHKEDLPEKETPESAPDRPLLDLSDAAVKKLIS
Ga0318497_1088033913300031805SoilMASKTKVTPQKEGAPEKEGADTLPDCPLLDLSDAVVKKLIR
Ga0318499_1017657023300031832SoilMASNIKTTPQKEEMKEGPETLPDSPLLELSDAAVKKL
Ga0318511_1032363413300031845SoilMASKTEETPQKEEMLEMEGPETLPDSPLLGLSDGAV
Ga0306919_1049370733300031879SoilMASHTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAIKKLIRSANK
Ga0306919_1117830013300031879SoilMASKTEETPQKEEMQEKEGPETLPDSPLLDLSDAAVKKL
Ga0318544_1037559123300031880SoilMASKTGETPQKEEMLEMEGPETLTDSPLPGLSDGAVRELVRSAKKRG
Ga0318522_1038262013300031894SoilMASKAKMTRQKENVSEEGPETPPDNPLLDLSDAAVKKHPRC
Ga0306923_1120190013300031910SoilMASKTEETPQKEEMLEMEGPETLPDSPLLGLSDRAVRELV
Ga0306923_1222891213300031910SoilMASKTEETPQKEEMPEKEGPETLPDSPLLGLSGGAVRELARSAK
Ga0310912_1020467033300031941SoilMASKTEETPQKEEMPEKEGPETLPDSPLLDLSDAAVKK
Ga0310912_1152720513300031941SoilMASKTEETPQKEEMPEKDGPETLSDSPLRDLSDPAVKDLIHS
Ga0310916_1062466633300031942SoilMASKAKLTLQKENVPEQEGPETPPDNPLLDLSDAAVKKFIRAV
Ga0310916_1083507323300031942SoilMASNTKMTPLKEEVLEKEGPEIRPDSPLLDLSDAAIK
Ga0310913_1045554323300031945SoilMASKAKMTRQKENVSEEGPETPPDNPLLDLSDAVK
Ga0310910_1117300823300031946SoilMASKTEETPQKEEMLEMEGPETLPESPLLGLSDGA
Ga0310909_1122321723300031947SoilMASKTEETPQKEEMLEMEGPETLPDSPLLGLSDRAVREL
Ga0306926_1171870413300031954SoilMTSKTETPQKEEMLKKDGSETLPDSPLLDLSDPAVKELIRSAKK
Ga0306926_1227377013300031954SoilMASKTEETPQKEEMLEIEGPETLPESPLLGLSDGAVREL
Ga0318530_1018328713300031959SoilMASKTEETSQKEEMPEKEGPETLPDSPLLDLSDAAVKK
Ga0318530_1048124123300031959SoilMASKTGETPQKEEMLEMEGPETLTDSPLPGLSDGAVRELVR
Ga0318531_1008796933300031981SoilMASKNEETPQKEEILEMEGAETLPERPLLGLSDGAV
Ga0306922_1053743343300032001SoilMASKTEETPQKEEMPEKEGPETLPDSPLLGPSDAAVKKL
Ga0306922_1070000113300032001SoilMAKTEETPQKQEMLEKEGPETLPDSPLLDLSDPAVPELIRSAK
Ga0310911_1037665613300032035SoilMASKTEETPQKEEMPEKGGPETLPHDLSGAAITKLIRS
Ga0318545_1009364623300032042SoilMASKTEETPQKEEMPEMEGPETLPDSPLLGLSDGAI
Ga0318505_1023035623300032060SoilMASKTEKTPQKEEMLEIEGPETLPESPLLGISDGAV
Ga0318514_1040554213300032066SoilMASKTEETPQKEEMLEMEGPETLPDSPLLGLSDGAVRELVRS
Ga0318553_1026329333300032068SoilMASDTKATSHKEDLPEKETPESAPDRPLLDLSDAA
Ga0318553_1073767223300032068SoilMASDIKAMSHKEDLPEKETPESAPDRPLLDFSDAAVKKAPPHRQE
Ga0318540_1051952213300032094SoilMASDIKAMSHKEDLPEKETPESAPDRPLLDFSDAAVKKAPPHRQET
Ga0311301_1021342113300032160Peatlands SoilMASKTKVTPQKEVMLEKEGRETPPGSPLLDLSDAAVKK
Ga0306920_10069231813300032261SoilMASKTEETPQKEEMPEKEGPETLPDSPLLDLSDAAV
Ga0306920_10346143523300032261SoilMASKTEETPQKEEMLEIEGPETLPESPLLGLSDGAVRELVRSAK
Ga0318519_1006906713300033290SoilMASKTGETPQKEEMLEMEGPEALTDSPLLDLSDAAVR
Ga0364927_0132264_3_1073300034148SedimentMTSKTNVTPQKEEVPEKEGPETPPDGPLLDLSDAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.