NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037755

Metagenome / Metatranscriptome Family F037755

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037755
Family Type Metagenome / Metatranscriptome
Number of Sequences 167
Average Sequence Length 85 residues
Representative Sequence MAHDVAEYISYLGHSKVPDTKVVLMMTLCIVATFYPVSYLFTKYHYVNTYSHRLEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS
Number of Associated Samples 152
Number of Associated Scaffolds 167

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.40 %
% of genes near scaffold ends (potentially truncated) 35.93 %
% of genes from short scaffolds (< 2000 bps) 96.41 %
Associated GOLD sequencing projects 145
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (88.024 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(16.168 % of family members)
Environment Ontology (ENVO) Unclassified
(33.533 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(51.497 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.14%    β-sheet: 0.00%    Coil/Unstructured: 43.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 167 Family Scaffolds
PF02167Cytochrom_C1 59.88
PF01991vATP-synt_E 7.19

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 167 Family Scaffolds
COG2857Cytochrome c1Energy production and conversion [C] 59.88
COG1390Archaeal/vacuolar-type H+-ATPase subunit E/Vma4Energy production and conversion [C] 7.19


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.42 %
UnclassifiedrootN/A9.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000736|JGI12547J11936_1030688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1201Open in IMG/M
3300002161|JGI24766J26685_10033697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1211Open in IMG/M
3300002835|B570J40625_100544476All Organisms → cellular organisms → Eukaryota1077Open in IMG/M
3300003430|JGI25921J50272_10083353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea688Open in IMG/M
3300003910|JGI26437J51864_10006319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2645Open in IMG/M
3300004112|Ga0065166_10016430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2108Open in IMG/M
3300004463|Ga0063356_100855294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1277Open in IMG/M
3300004463|Ga0063356_102644396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea771Open in IMG/M
3300004767|Ga0007750_1419079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea959Open in IMG/M
3300004769|Ga0007748_10164655Not Available718Open in IMG/M
3300004789|Ga0007752_11032103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300004792|Ga0007761_10015169Not Available952Open in IMG/M
3300004797|Ga0007764_10631208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300004802|Ga0007801_10130720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia720Open in IMG/M
3300005662|Ga0078894_10154982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2060Open in IMG/M
3300005987|Ga0075158_10241455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia1032Open in IMG/M
3300006037|Ga0075465_10006237All Organisms → cellular organisms → Eukaryota2142Open in IMG/M
3300006355|Ga0075501_1330228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia938Open in IMG/M
3300006378|Ga0075498_1326736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia945Open in IMG/M
3300006390|Ga0075509_1503837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300006402|Ga0075511_1613015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea901Open in IMG/M
3300006805|Ga0075464_10059740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea2127Open in IMG/M
3300006875|Ga0075473_10060788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1470Open in IMG/M
3300006917|Ga0075472_10442096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea645Open in IMG/M
3300007169|Ga0102976_1015233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1727Open in IMG/M
3300007513|Ga0105019_1141869Not Available1257Open in IMG/M
3300007559|Ga0102828_1038844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1085Open in IMG/M
3300007636|Ga0102856_1076403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
3300007665|Ga0102908_1036620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea943Open in IMG/M
3300007760|Ga0105018_1088022Not Available1158Open in IMG/M
3300009269|Ga0103876_1079811Not Available504Open in IMG/M
3300009422|Ga0114998_10574105Not Available530Open in IMG/M
3300009436|Ga0115008_10083576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2397Open in IMG/M
3300009436|Ga0115008_10324628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1092Open in IMG/M
3300009436|Ga0115008_10564949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea817Open in IMG/M
3300009441|Ga0115007_10858874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea617Open in IMG/M
3300009538|Ga0129287_10311739Not Available693Open in IMG/M
3300009544|Ga0115006_10397209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1207Open in IMG/M
3300009599|Ga0115103_1582974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea562Open in IMG/M
3300009606|Ga0115102_10153072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea546Open in IMG/M
3300009606|Ga0115102_10823896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia951Open in IMG/M
3300009608|Ga0115100_10053503Not Available664Open in IMG/M
3300009677|Ga0115104_10828655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300011009|Ga0129318_10115499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea784Open in IMG/M
3300012419|Ga0138260_10652796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia783Open in IMG/M
3300012471|Ga0129334_1066244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia760Open in IMG/M
3300012707|Ga0157623_1219684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea843Open in IMG/M
3300012760|Ga0138273_1019763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea742Open in IMG/M
3300012952|Ga0163180_10894548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea703Open in IMG/M
3300012952|Ga0163180_11949038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300012953|Ga0163179_12110286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia521Open in IMG/M
3300012953|Ga0163179_12126540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea519Open in IMG/M
3300013295|Ga0170791_12271538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1093Open in IMG/M
3300013295|Ga0170791_14594988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea659Open in IMG/M
3300013295|Ga0170791_15127108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea675Open in IMG/M
3300015053|Ga0137405_1398339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1308Open in IMG/M
3300016751|Ga0182062_1119095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1043Open in IMG/M
3300016766|Ga0182091_1353927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia696Open in IMG/M
3300017772|Ga0181430_1183885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300017952|Ga0181583_10251217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1141Open in IMG/M
3300018628|Ga0193355_1008503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea890Open in IMG/M
3300018701|Ga0193405_1017726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia779Open in IMG/M
3300018879|Ga0193027_1065178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea729Open in IMG/M
3300018885|Ga0193311_10015332All Organisms → Viruses → Predicted Viral1005Open in IMG/M
3300018926|Ga0192989_10053075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1041Open in IMG/M
3300018974|Ga0192873_10404410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia548Open in IMG/M
3300018982|Ga0192947_10086516All Organisms → Viruses → Predicted Viral1029Open in IMG/M
3300018989|Ga0193030_10239593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea596Open in IMG/M
3300018999|Ga0193514_10071216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1231Open in IMG/M
3300019010|Ga0193044_10141113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia789Open in IMG/M
3300019017|Ga0193569_10203241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea876Open in IMG/M
3300019032|Ga0192869_10364731Not Available630Open in IMG/M
3300019036|Ga0192945_10122749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia829Open in IMG/M
3300019036|Ga0192945_10199452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia643Open in IMG/M
3300019039|Ga0193123_10325389Not Available603Open in IMG/M
3300019045|Ga0193336_10061517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia1077Open in IMG/M
3300019050|Ga0192966_10099890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia996Open in IMG/M
3300019051|Ga0192826_10177707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia787Open in IMG/M
3300019051|Ga0192826_10241514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia666Open in IMG/M
3300019053|Ga0193356_10254562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea619Open in IMG/M
3300019053|Ga0193356_10360678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea507Open in IMG/M
3300019146|Ga0188881_10019912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea834Open in IMG/M
3300019149|Ga0188870_10040123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1117Open in IMG/M
3300019150|Ga0194244_10111812Not Available525Open in IMG/M
3300019272|Ga0182059_1142290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300020151|Ga0211736_10682559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea583Open in IMG/M
3300020157|Ga0194049_1032841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1344Open in IMG/M
3300020160|Ga0211733_10521633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea751Open in IMG/M
3300020162|Ga0211735_10400117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea907Open in IMG/M
3300020220|Ga0194119_10430021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea848Open in IMG/M
3300020578|Ga0194129_10360161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea783Open in IMG/M
3300020725|Ga0214200_1037856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella772Open in IMG/M
3300021169|Ga0206687_1807614Not Available552Open in IMG/M
3300021355|Ga0206690_10666724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia941Open in IMG/M
3300021364|Ga0213859_10372587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea636Open in IMG/M
3300021872|Ga0063132_145377Not Available534Open in IMG/M
3300021890|Ga0063090_1049096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1059Open in IMG/M
3300021894|Ga0063099_1035589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1011Open in IMG/M
3300021898|Ga0063097_1063801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia864Open in IMG/M
3300021903|Ga0063874_1081617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia527Open in IMG/M
3300021910|Ga0063100_1019824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1106Open in IMG/M
3300021925|Ga0063096_1064876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia565Open in IMG/M
3300021937|Ga0063754_1012276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1106Open in IMG/M
3300021962|Ga0222713_10201223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia1332Open in IMG/M
3300022369|Ga0210310_1012453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia840Open in IMG/M
3300024343|Ga0244777_10411488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea841Open in IMG/M
3300025451|Ga0208426_1004735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1916Open in IMG/M
3300025732|Ga0208784_1039777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1470Open in IMG/M
3300025848|Ga0208005_1221946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia585Open in IMG/M
3300025848|Ga0208005_1289169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300025896|Ga0208916_10458635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300026420|Ga0247581_1051806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia651Open in IMG/M
3300026447|Ga0247607_1022017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1066Open in IMG/M
3300026449|Ga0247593_1071190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea683Open in IMG/M
3300027720|Ga0209617_10095643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1201Open in IMG/M
3300027736|Ga0209190_1168422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea932Open in IMG/M
3300027741|Ga0209085_1343155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300027781|Ga0209175_10311368Not Available664Open in IMG/M
3300027784|Ga0207421_10208775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea879Open in IMG/M
3300027791|Ga0209830_10476732Not Available515Open in IMG/M
3300027902|Ga0209048_10913229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300027911|Ga0209698_11311347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea530Open in IMG/M
3300027963|Ga0209400_1309961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300028042|Ga0256844_10066795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia1223Open in IMG/M
3300028575|Ga0304731_10766196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia707Open in IMG/M
3300029922|Ga0311363_10849685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea830Open in IMG/M
3300030528|Ga0210277_10384050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea612Open in IMG/M
3300030542|Ga0210249_1180034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea601Open in IMG/M
3300030543|Ga0210289_1554955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea521Open in IMG/M
3300030547|Ga0247656_1236801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300030550|Ga0247631_1126412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea579Open in IMG/M
3300030572|Ga0210258_10517314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea518Open in IMG/M
3300030575|Ga0210288_1264751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300030604|Ga0247637_1098667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea647Open in IMG/M
3300030608|Ga0247651_10321477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea520Open in IMG/M
3300030610|Ga0247613_10285947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia617Open in IMG/M
3300030625|Ga0210259_10539073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea844Open in IMG/M
3300030625|Ga0210259_11361653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea512Open in IMG/M
3300030635|Ga0247627_10178984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300030722|Ga0308137_1039392Not Available846Open in IMG/M
3300030738|Ga0265462_11836962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300030740|Ga0265460_11357055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea696Open in IMG/M
3300030743|Ga0265461_10397184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1054Open in IMG/M
3300030775|Ga0074021_1862116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea703Open in IMG/M
3300030777|Ga0075402_12198806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1190Open in IMG/M
3300030779|Ga0075378_10895986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300030800|Ga0074032_10818409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea616Open in IMG/M
3300030850|Ga0075387_11318302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1022Open in IMG/M
3300030948|Ga0073977_1000756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1119Open in IMG/M
3300030980|Ga0074027_11175076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea508Open in IMG/M
3300031000|Ga0074035_10932687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea756Open in IMG/M
3300031050|Ga0074028_10511254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300031057|Ga0170834_107979058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea988Open in IMG/M
3300031231|Ga0170824_109201021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea643Open in IMG/M
3300031231|Ga0170824_121768490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea587Open in IMG/M
3300031469|Ga0170819_14144118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300031469|Ga0170819_17723916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea508Open in IMG/M
3300031569|Ga0307489_10163217All Organisms → Viruses → Predicted Viral1351Open in IMG/M
3300031602|Ga0307993_1148472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea588Open in IMG/M
3300031739|Ga0307383_10145660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1087Open in IMG/M
3300031786|Ga0315908_11205595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea601Open in IMG/M
3300032742|Ga0314710_10103255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1068Open in IMG/M
3300032756|Ga0315742_10496806All Organisms → Viruses → Predicted Viral1020Open in IMG/M
3300034064|Ga0335001_0189887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1150Open in IMG/M
3300034066|Ga0335019_0774387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea544Open in IMG/M
3300034167|Ga0335017_0733276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300034355|Ga0335039_0354647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea763Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine16.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.37%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.38%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.59%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.59%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.40%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.40%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.99%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.99%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.20%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.20%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.20%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.20%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.20%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.20%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.60%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.60%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.60%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.60%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.60%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.60%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.60%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.60%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.60%
Alkaline SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment0.60%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.60%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.60%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.60%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.60%
Mussel SurfaceHost-Associated → Mollusca → Shell → Unclassified → Unclassified → Mussel Surface0.60%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.60%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300003910Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LWEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004797Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007760Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012707Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012760Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019146Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020157Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25mEnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300020725Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021903Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021937Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027784Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028042Mussel associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - MusselsHost-AssociatedOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030542Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR003SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030550Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030610Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030775Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030779Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030800Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030980Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031000Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031050Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12547J11936_103068833300000736Freshwater And SedimentMAHDVSEYLSFVAKAKVPDQKIVLCMILAISFTMYPISYLFTKYHYVNCYSHRLEVYAVKNGGYKKFREKMFKTHKTPGNWLGQYS*
JGI24766J26685_1003369713300002161Freshwater And SedimentMAHDVAEYISFLGRSKVPDQRVTTFMMLAIVATXYPISYLFTKFHYVNCYSHRLEVYAVKNGGYKKFREKMFRHHKTAGNWLGAYS*
B570J40625_10054447633300002835FreshwaterGRSKVPDTKVVLMMTLCIVATFYPVSYLFTKYHFVNTYSHRLEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS*
JGI25921J50272_1008335323300003430Freshwater LakePDTKMVITMMLFIVGTFYPVSYLFTKYHFINTYSHRFEVYAVKNGGYKKFREKQFKTHKTSGNWLGAYS*
JGI26437J51864_1000631933300003910Freshwater Lake SedimentMAHDVAEYISYIGKNRTPDHKVVIFMMLGVVCTFYPISYLFTKYHYVNTYSYRLELYAVKSGGYKKFREKMFKTHKTSGNWLNAYT*
Ga0065166_1001643023300004112Freshwater LakeMAHDVAEYIAYLGKSKVPDTKVVLGMMLCIVATIYPVSYLFTKYHYVNTYSHRLELYAVKNGGYKKFREKAFKTHKTSGNWLGAYS*
Ga0063356_10085529433300004463Arabidopsis Thaliana RhizosphereMAHDVSEYLRFLSGCKVPDTKVIIGMIGLICLTFYPISYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFYSHKIPGNWLGAYS*
Ga0063356_10264439623300004463Arabidopsis Thaliana RhizosphereMAHDVSEYLAYVARSKVPDQKVVIGMIGCIILTFYPISYFFTKYHYVNTYSHRFEVYAVKNGKGYKKFREKMFKSHKIPGNWLGAYS*
Ga0007750_141907933300004767Freshwater LakeMAHDVSEYLSFVAKAKVPDQKIVLCMILAISFTMYPISYLFTKYHYVNCYSHRLEVYAVKNGGYKKFREKMFKTHKTPGNWLGQYS**
Ga0007748_1016465513300004769Freshwater LakeMAHDVSEYLSFVAKAKVPDQKIVLCMILAISFTMYPISYLFTKYHYVNCYSHRLEVYAVKNGGYKKFREKMFK
Ga0007752_1103210323300004789Freshwater LakeMAHDVAEYISYLGHSKVPDTKVVLMMTLCLVATFYPVSYLFTKYHYINTYSHRLEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS*
Ga0007761_1001516913300004792Freshwater LakeMAHDVSEYLSFVAKAKVPDQKIVLCMILAISFTMYPISYLFTKYHYVNCYSHRLEVYAVKNGGYKKFREKMFKTHKTPGNWLGQYS*LI
Ga0007764_1063120813300004797Freshwater LakeMAHDVAEYIMYLGKSKVPDTKVVIGIGIALMCTFYPVSYLFTKYHFVNTYSHRLEVYAVKNGGYKKFREKAFKTHKTNGNWMGAYS*STYLSVLFNNQKP
Ga0007801_1013072033300004802FreshwaterMAHDVAEYISYLGHSKVPDTKVVLMMTLCIVATFYPVSYLFTKYHYVNTYSHRLEVYAVKNGGYKKFREKAFKTHKTNGN
Ga0078894_1015498233300005662Freshwater LakeMAHDVAEYIAYLGKSKVPDTKVVIGMMLCIVATIYPVSYMFTKYHYVNTYSHRLELYAVKNGGYKKFREKAFKTHKTSGNWLGAYS*
Ga0075158_1024145523300005987Wastewater EffluentMAHDVSEYLTYLQKSKYPDTKVVLWMFVSMYVMFYTASYAFTKFHYINTYSYRFEVYAVKNGGYKKFRQKMFKTHKIPGNWLGNYA*
Ga0075465_1000623743300006037AqueousMAHDVSEYIAYLGKSKVPDTKVVISMLLILTATFYPVSYLFTKYHYVNTYSHRLELYAMRSGGYKKFREKAFKTHKTSGNWLGAYS*
Ga0075501_133022813300006355AqueousMAHDVAEYISFLGRSKVPDQRVTTFMMLAIVATFYPISYLFTKFHYVNCYSHRLEVYAVKNGGYKKFREKMFRHHK
Ga0075498_132673623300006378AqueousMAHDVAEYISFLGRSKVPDQRVTTFMMLAIVATFYPISYLFTKFHYVNCYSHRLEVYAVKNGGYKKFREKMFRHHKT
Ga0075509_150383723300006390AqueousPASAPQMAHDVAEYISYLGKSKQPDQKVVISMMLAVVCTFYPISYMFTKYHYVNTYSYRHEVYAVKNGGYKKFREKMFKSNKVPGNWLGNFS*
Ga0075511_161301513300006402AqueousMAHDVSEYLMFVSRAKVPDQKVMIYTALFITFTIYPISYLFTKYHYINCHSHRFEVYAVKNGGYKKFREKAFRTHKTPGNWLGQYS*
Ga0075464_1005974023300006805AqueousMAHDVAEYIMYLGKSKVPDTKVVIGIGIALMCTFYPVSYLFTKYHFVNTYSHRLEVYAVKNGGYKKFREKAFKTHKTNGNWMGAYS*
Ga0075473_1006078853300006875AqueousMAHDVAEYISFLGRSKVPDQRVTTFMMLAIVATFYPISYLFTKFHYVNCYSHRLEVYAVKNGGYKKFREKMFRHHKTAGNWLGAYS*
Ga0075472_1044209613300006917AqueousDVAEYIGYLGASKVPDTKVVICIMLACAATFYPISYMFTKYHFVNIHSHRMELYAIKNGGGYKKFREKAFKTHKTMGNWLGLYS*
Ga0102976_101523333300007169Freshwater LakeEYITFLGKSKVPDQRIVVVLALAIIATCYPVSYLFTKYHYVNCYSHRMEVYAVKNGGYKKFREKMFRTHKTPGNWLGAYS*
Ga0105019_114186923300007513MarineMAHDVSEYLKFVAAAKVPDTKVALCLVLGVCACIYPVSYLFTKAHYVNCHSHRFEVYAIRNGGYKKFREKAFKSAKVPGNWLGQYS*
Ga0102828_103884413300007559EstuarineLAKSKVPDTKLVITMILCIVGTFYPVSYLFTKYHFVNCYSHRFEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS*
Ga0102856_107640313300007636EstuarineVAEYITFLGKSRVPDTRVVVVLLLATVFTVYPVSYLFTKYHYINCYSHRLEVYAVKSGGYKKFREKMFRTHKTAGNWLGAYS*
Ga0102908_103662023300007665EstuarinePASAPQMAHDVAEYISYLGKSKGPDQKVVVSMMLAVVATFYPISYMFTKYHYVNTHSYRLELYAVKNGGYKKFREKMFKTNKTPGNWLGNYS*
Ga0105018_108802223300007760MarineMAHDVSEYLKFVAAAKVPDTKVALCLVLGVCACIYPVSYLFTKAHYVNCHSHRFEVYAIRNGGYKKFREKAFKSLC*
Ga0103876_107981113300009269Surface Ocean WaterMAHDVSEYLMFVARSKVPDTKMVLVMVLATAGMMFPISYLFTKYHFINCASHRLEVYALRTGGYKKFREKAFRTHKVPGNWLGQHS*
Ga0114998_1057410513300009422MarineDVSEYLMFVSRAKVPDTKMFIYLVLGITFTLYPMSYLFTKYHFVNCHSYRFEAYALKNGGYKKFREKAFKTHKTPGNWLNQYT*
Ga0115008_1008357633300009436MarineMAHDVSEYISYLGQNKAPDQKVVVCMMLGVVATFYPISYLFTKYHYVNTYSYRLELYAVKGGGYKKFREKMFKTHKTNGNWLGAYT*
Ga0115008_1032462813300009436MarineMAHDVSEYISYLGSNKAPDQKIVVALMLGVVATFYPISYLFTKYHYVNTYSYRLELYAVKGGGYKKFREKMFKTHKTNGNWLGAYT*
Ga0115008_1056494913300009436MarineAEYIGYLGASKVPDTKVVLMMVLAVMGTVYPVSYLFTKYHYINTYSHRFEVYAVKQAGYKKFREKAFKTHKTQGNWLGAYS*
Ga0115007_1085887413300009441MarineMAHDVAEYISYLGKCKAPDQKVVVMMMLAVVATFYPISYVFTKAHYVNTYSYRLELYAVKSGGYKKFREKMFKTHKTSGNWLGNYT*
Ga0129287_1031173913300009538Beach Aquifer PorewaterMAHDVSEFLSFVSSGLVPDFKIVLYMTIGIVATITPFSYIFTKYHFVNVYSHRFEIYAVKNGGYRKFRE*
Ga0115006_1039720923300009544MarineDVAEYITYIGNAKGPDQKVQAAMVFGIACFMYPISYLFTKYHFVNTYSHRLEVYAVKNGGYKKFREKAFKTHKVTGNWLGAYS*
Ga0115103_158297423300009599MarineMAHDVSEYLSYLAKSKVPDTKVVLSMILFVTFTFYPISYLFTKYHYINTYSHRFEVYAVKNGGYKKFREKAFKTHKVPGNWLGAYS*
Ga0115102_1015307223300009606MarineMAHDVSEYLSFVARNKVPDSKIVICITLALIGTFYPISYLFTKAHYVNCHSHRFEVYAVKNGGYKKFREKAFKTHKTPGNWLGQYS*
Ga0115102_1082389633300009606MarineMAHDVSEYLMFVSRAKVPDTKMFIYLVLGITFTLYPLSYLFTKYHFVNCHSYRFEAYALKSGGYKKFREKAFKTH
Ga0115100_1005350313300009608MarineMAHDVSEYLMFVSRAKVPDTKMFIYLVLGITFTLYPLSYLFTKYHFVNCHSYRFEAYALKNGGYKKFREKAFKTHKTPGNWLNQYT*
Ga0115104_1082865513300009677MarineGTPSSAPQMAHDVAEYISYLGKNKAPDQKIVVMMMLAVVATFYPISYLFTKAHYVNTYSYRLELYAVKSGGYKKFREKMFKTHKVNGNWLGAYT*
Ga0129318_1011549923300011009Freshwater To Marine Saline GradientHDVAEYIAYLGKSKVPDTKVVLGMMLCIVATIYPVSYLFTKYHYVNTYSHRLELYAVKNGGYKKFREKAFKTHKTSGNWLGAYS*
Ga0138260_1065279623300012419Polar MarineMAHDVSEYLMYVARAKVPDTKVVLCLTLALVATFYPISYLFTKYHYINCYSHRFEVYAVKNGGYKKFREKAFRTHKTPGNWLGQYS*
Ga0129334_106624413300012471AqueousMAHDVSEFLSFVARNKVQDTKIVIYMTFAIIATVYPVSYMFTKYHYVNCYSHRFEVYAVKNGGYKKFREKAFKTHKTPGNWLGQYS*
Ga0157623_121968413300012707FreshwaterMAHDVSEYLAYLGKSKVPDTKVVIGMVLCIVATFYPISYLFTKYHFVNTYSHRHEIYAVKNGGYKKFREKAFKTYKTAGNVL
Ga0138273_101976333300012760Freshwater LakeMAHDVAEYISYLGHSKVPDTKVVLMMTLCIVATFYPVSYLFTKYHYVNTYSHRLEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS*
Ga0163180_1089454823300012952SeawaterSEYITYLGSTKVPDTKVVINMMIFVSFTCYPISYLFTKYHYVNTYSHRLELYAVKNGGYKKFREKAFKTHKTPGNWMGAYS*
Ga0163180_1194903813300012952SeawaterMAHDVSEYLMFLAHSKVPDTKVMLCMALAISATMYPISYMFTKYHYVNCYSHRFEVYAVKNGGYKKFREKAFKTHKIPGNWLGQYS*
Ga0163179_1211028613300012953SeawaterSSAPQMAHDVSEYLKFVAAAKVPDTKVILCLTLAIAATMYPVSYMFTKYHYVNCYSHRFEVYAVKNGGYKKFREKAFKTHKTPGNWLGQYS*
Ga0163179_1212654013300012953SeawaterDVSEYLKFVAAAKVPDTKVAICLILGVAACFYPISYLFTKAHYINCHSHRFEVYAIRNGGYKKFREKAFKTHKVPGNWLGQYS*
Ga0170791_1227153813300013295FreshwaterMAHDVAEYISYLGHSKVPDTKVVLMMTLCIVATFYPVSYLFTKYHYINTYSHRLEVYAVKNGGYKKFREKAFKTHKTNGNWLGAYS*
Ga0170791_1459498823300013295FreshwaterLAHDVAEYISYLGHSKVPDTKVVLMMTLCLVATFYPVSYLFTKYHYINTYSHRLEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS*
Ga0170791_1512710813300013295FreshwaterMAHDLSEYLSFVAKAKVPDQKIVLCMILAISFTMYPISYLFTKYHYVNCYSHRLEVYAVKNGGYKKFREKMFKTHKTPGNWLGQYS
Ga0137405_139833933300015053Vadose Zone SoilMAHDVSEYLSFVAKSKVPDTKVVIGMVCCIIATFYPISYFFTKYHYVNTYSHRLEIYAVKNGGYKKFREKMFKTHKIPGNWLGNFS*
Ga0182062_111909523300016751Salt MarshMAHDVSEYLMFVARAKVPDTKIVLCMTLAIIATIYPVSYLFTKYHYINCHSHRFEVYAVKNGGYKKFREKAFRTHKTPGNWLGQILLNTQLLRLYSRDKYLKDF
Ga0182091_135392713300016766Salt MarshMAHDVSEYLMFVSRAKVPDQKVMIYTALFITFTIYPISYLFTKYHYINCHSHRFEVYAVKNGGYKKFREKAFRTHKTPGNWLGQYS
Ga0181430_118388513300017772SeawaterDVSEYIAYLGSNKAPDQKIVVMMMLGVVATFYPISYLFTKYHYVNTYSYRLELYAVKSGGYKKFREKMFKTHKTSGNWLGAYT
Ga0181583_1025121713300017952Salt MarshISYLGHSKVPDTKVVLMMTLCICATFMPISYMFTKYHFVNAYSHRLEVYAMKTGGYKKFREKAFKTHKTSGNWLGAYS
Ga0193355_100850313300018628MarineMAHDVAEYISYLGRSKVPDTKIVLMMTLCITATFYPVSYMFTKYHFVNAYSHRLEVYAMKSGGYKKFREKAFKTHKTSGNWLGAYS
Ga0193405_101772613300018701MarineMAHDVSEYLMFVSRAKVPDQKVMIYTALAITFMMYPISYLYTKSHFINCHSHRFEVYAVKNGGYKKFREKAFKTHKTPGNWLGQYS
Ga0193027_106517823300018879MarineMAHDVAEYISYLGKNKAPDQKVVVMMMLCVVATFYPLSYMFTKQHYVNTYSYRFEMYAMKSGGYKKFREKMFKTHKTSGNWLGAYT
Ga0193311_1001533233300018885MarineMAHDVSEYLMFVSRAKVPDQKVMIYTALAITFMMYPVSYLYTKSHFINCHSHRFEVYAVKNGGYKKFREKAFKTHKTPGNWLGQYS
Ga0192989_1005307513300018926MarineMAHDVSEYLMYVSGAKVPDTKLLICLTLAVIGTFYPVSYFFTKYHFINCYSHRFEVYAVKNGGYKKFREKMFKSHKTPGNWLGAYS
Ga0192873_1040441013300018974MarineMAHDVSEYLQFVARSKVPDTKVMIYTALFITATIYPVSYLFTKYHYINCHSYRFEVYAVKSGGYKKFREKAF
Ga0192947_1008651613300018982MarineMAHDVSEYLMFVSRAKVPDQKMMIYTALAITFTTYPISYLFTKYHFINCHSHRFEVYAVKNGGYKKFREKAFRTHKTPGNWLNQYT
Ga0193030_1023959313300018989MarineMAHDVSEYLKFVAAAKVPDTKVALCMILGVCASFYPISYLFTKAHYINCHSHRFEVYAIRNGGYKKFREKAFKTHKVPGNWLGQYS
Ga0193514_1007121623300018999MarineMAHDVAEYISFLGKNKVPDTMVVISLTLCVVATFYPISYMFTKQHYVNTYSHRFEIYAVKNGGYKKFREKMFKTHKTPGNWWGAYS
Ga0193044_1014111313300019010MarineMAHDVSEYLSYVARSKVPDTKVVLGITLAIVFTFYPISYMFTKYHYINCYSHRFEVYAVKNGGYKKFREKAFRTHKTPGNWLGQYS
Ga0193569_1020324113300019017MarineMAHDVAEYISYLGKNKAPDQKVVVSMMLAVVATFYPISYMFTKYHYVNTYSYRLEVYAVKSGGYKKFREKMFKTHKTPGNWLGNYS
Ga0192869_1036473113300019032MarineMAHDVAEYVTYLGKNKVPDDKVVVMMLLTLGSTFYFVSYFFTKYHFVNTYSHRLELYAVKDGGAGYKKFRAKAFKTHKMAGNWLGQFS
Ga0192945_1012274913300019036MarineMAHDVSEFLTFVSSSKRPDQRAIVYMTLAMVAIMYPVSYMFTKYHYLNCHSYRFEVYAVKNGGYKKFREKAFKTHKTPGNWLGQYS
Ga0192945_1019945213300019036MarineMAHDVSEYISYLGQNKAPDQKIVVCMMLGVVATFYPISYLFTKYHYVNTYSYRLELYAVKGGGYKKFREKMFKTHKTNGNWLGAYT
Ga0193123_1032538923300019039MarineMAHDVSEYLHFVARAKVPDQKVMIYTALALVFTIYPVSYLFTKYHYINCHSHRFEVYAVKNGGYKKFREKSFRTHKTPGNWLGQSS
Ga0193336_1006151723300019045MarineMAHDVSEYLLFVARNKVPDTKVVIYITFAIIATVYPISYMFTKYHYINCYSHRFEVYAVKNGGYRKFREKAFKTHKTPGNWLGQYS
Ga0192966_1009989033300019050MarineMAHDVSEFLTFVSSSKRPDQRAIIYMTLAMVAIMYPVSYMFTKYHYLNCHSYRFEVYAVKNGGYKKFREKAFKTHKTPGNWLGQYS
Ga0192826_1017770713300019051MarineMAHDVSEYLAFVARPKVPDQRMVLCMMLAVAATLYPISYMFTKYHFVNLHSSRFEVYAVKSGGYKKFREKTFKTHKVPGNWLGQYS
Ga0192826_1024151413300019051MarineMAHDVSEYLHFVSKAKVPDMKMQINIALAITFTIFPVSYLFTKYHYINCHSHRFEVYAVKNGGYKKFREKAFRT
Ga0193356_1025456223300019053MarineMAHDVAEYISYLGKNKAPDQKVVVMMMLCVVATFYPLSYMFTKQHYVNTYSYRLELYAMKSGGYKKFREKMFKTHKVSGNWLGAYT
Ga0193356_1036067813300019053MarineISYLGKSKAPDQKVVVSMMLAVVATFYPISYMFTKYHYVNTYSYRLEVYAVKSGGYKKFREKMFKTNKVPGNWLGNYS
Ga0188881_1001991213300019146Freshwater LakeMAHDVSEYLAYVARSKVPDTKIVLCLTLALVATFYPISYLFTKYHYINCYSHRFEVYAVKNGGYKKFREKAFKTHKI
Ga0188870_1004012323300019149Freshwater LakeMAHDVSEYLSFVARVRVPDTKIVLCLALAMAATFYPISYLFTKYHYINCYSHRFEVYAVKNGGYKKFREKAFRTHKTPGNWLGQYS
Ga0194244_1011181213300019150MarineHGITYLGKNKVPDDKVVVMMLLTLGSTFYFVSYFFTKYHFINTYSHRLELYAVKDGGAGYKKFRAKAFKTHKMAGNWLG
Ga0182059_114229023300019272Salt MarshMAHDVSEYLMYIAGAKVPDTKLLICLTLAVIGTFYPVSYLFTKSHFINCYSHRFEVYAVKNGGYKKFREKMFRTHKTPGNWLGGYS
Ga0211736_1068255913300020151FreshwaterMAHDVAEYISYIGKNRTPDHKVVIFMMLGVVCTFYPISYLFTKYHYVNTYSYRLELYAVKNGGYKKFREKMFKTHKTSGNWLNAYT
Ga0194049_103284113300020157Anoxic Zone FreshwaterMAHDVAEYIAYLGKSKVPDTKVVLGMVLCIVATIYPVSYLFTKYHYVNTYSHRLELYAVKNGGYKKFREKAFKTHKTSGNWLGAYS
Ga0211733_1052163323300020160FreshwaterAHDVAEYISYIGRSKVPDTKVVLMMTLCIVATFYPVSYLFTKYHFVNTYSHRLEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS
Ga0211735_1040011713300020162FreshwaterMAHDVAEYIMYLGKSKVPDTKVVIGIGIALMCTFYPVSYLFTKYHFVNTYSHRLEVYAVKNGGYKKFREKAFKTHKTNGNWMGAYS
Ga0194119_1043002123300020220Freshwater LakePQMAHDVAEYLSYLAKSKVPDTKMVIIMMLCIVGTMYPVSYMFTKYNFVNLYSHRFEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS
Ga0194129_1036016113300020578Freshwater LakeKSKVPDTKLVIIMMLCIVGTMYPISYMFTKYNFVNLYSHRFEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS
Ga0214200_103785613300020725FreshwaterMAHDVSEYLAYLGKNKVPDQKVVIGMICCIVATFYPISYLFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKIQGNWLGAYS
Ga0206687_180761413300021169SeawaterMAHDVAEYITYLGKQKVPDDKVVVLMMLSFSTFMYSISYLFTKYHFVNTYSHRLELYAVKNGGYKKFREKAFKTHKTNGNWLGQFS
Ga0206690_1066672433300021355SeawaterMAHDVAEYVAYIAKVKWPDTKVIFMMCLGICLTFHSVSYLFTKFHYVNCHSHRFEVYAVKNGGYKKFREKAFKTAKVPGNWLGAYS
Ga0213859_1037258713300021364SeawaterAPQMAHDVAEYISYLGKSKAPDQKIVVSMMLAVVATFYPISYMFTKYHYVNTYSYRLEVYAVKNGGYKKFREKMFKTNKVPGNWLGNYS
Ga0063132_14537723300021872MarineMAHDVSEYLMFVSRAKVPDQKVIIYTALAITFMMYPISYLFTKSHFINCHSHRFEVYAVKNGGYKKFREKAFKTHKTPGNWLGQYS
Ga0063090_104909623300021890MarineMAHDVSEYISYLGRNKAPDQKVVVCMMLGVVATFYPISYLFTKYHYVNTYSYRLELYAVKGGGYKKFREKMFKTHKTNGNWLGAYT
Ga0063099_103558933300021894MarineMAHDVSEYISYLGQNKAPDQKVVVCMMLGVVATFYPISYLFTKYHYVNTYSYRLELYAVKGGGYKKFREKMFKTHKTNGNWLGAYT
Ga0063097_106380133300021898MarineMAHDVAEYIAYLGKNKAPDQKIVVMMMLAVVATFYPISYVFTKAHYVNTYSYRLELYAVKSGGYKKFREKMFKTHKTSGNWLGNYT
Ga0063874_108161723300021903MarineMAHDVSEYISYLGQNKAPDQKVVVCMMLGVVATFYPISYLFTKYHYVNTYSYRLELYAVKGGGYKKFREKMFKTHK
Ga0063100_101982433300021910MarineMAHDVAEYISYLGKSKAPDQKVVVMMMLAVVATFYPISYVFTKAHYVNTYSYRLELYAVKSGGYKKFREKMFKTHKTSGNWLGNYT
Ga0063096_106487623300021925MarineMANDVAEYISFLGRNKVPDTMIVISMVLCVVATFYPISYIFTKQHYINTYSHRFEMYAVKNGGYKKFREKMFKTHKSSGNWLGNYS
Ga0063754_101227623300021937MarineMMFQSTSRTLDSNKAPDQKIVVALMLGVVATFYPISYLFTKYHYVNTYSYRLELYAVKGGGYKKFREKMFKTHKTNGNWLGAYT
Ga0222713_1020122313300021962Estuarine WaterMAHDVSEFLSFVARNKVQDTKIVIYMTFAIIATVYPVSYMFTKYHYVNCYSHRFEVYAVKNGGYKKFREKAFKTHKTPGNWLGQYS
Ga0210310_101245323300022369EstuarineMAHDVSEYLMFVSRAKVPDTKMFIYLVLGITFTLYPLSYLFTKYHFVNCHSYRFEAYALKNGGYKKFREKAFKTHKTP
Ga0244777_1041148823300024343EstuarineMAHDVAEYISYIGKNRTPDHKVVIFMMLGVVCTFYPISYLFTKYHYVNTYSYRLELYAVKSGGYKKFREKMFKTHKTSGNWLNAYT
Ga0208426_100473543300025451AqueousMAHDVSEYIAYLGKSKVPDTKVVISMLLILTATFYPVSYLFTKYHYVNTYSHRLELYAMRSGGYKKFREKAFKTHKTSGNWLGAYS
Ga0208784_103977723300025732AqueousMAHDVAEYISFLGRSKVPDQRVTTFMMLAIVATFYPISYLFTKFHYVNCYSHRLEVYAVKNGGYKKFREKMFRHHKTAGNWLGAYS
Ga0208005_122194613300025848AqueousMAHDVAEYISYIGKNRTPDHKVVIFMMLGVVCTFYPISYLFTKYHYVNTYSYRLELYAVKSGGYKKFREKMFKTHKTSGN
Ga0208005_128916923300025848AqueousDVAEYIGYLGASKVPDTKVVICIMLACAATFYPISYMFTKYHFVNIHSHRMELYAIKNGGGYKKFREKAFKTHKTMGNWLGLYS
Ga0208916_1045863513300025896AqueousAEYITFLGKSRVPDTRVVVVLLLATVFTVYPVSYLFTKYHYINCYSHRLEVYAVKSGGYKKFREKMFRTHKTAGNWLGAYS
Ga0247581_105180613300026420SeawaterMAHDVSEYLMFVARTRVPDQKITLCLALAIAATIYPVSYLFTKYHYVNCYSQRFEVYAVKNGGYKKFREKAFRTHKTPGNWLN
Ga0247607_102201713300026447SeawaterMAHDVSEYLSFVARVRVPDTKIVLCLALAMAATFYPISYMFTKYHYVNCYSHRFEVYAVKNGGYKKFREKAFRTHKTPGNWLGQYS
Ga0247593_107119013300026449SeawaterMAHDVSEYLMFVSRTRVPDQKIALCIALAIAATCYPISYLYTKAHYVNCYSHRFEVYAVKNGGYKKFREKAFKTHKIPGNWLGQYS
Ga0209617_1009564323300027720Freshwater And SedimentMAHDVSEYLSFVAKAKVPDQKIVLCMILAISFTMYPISYLFTKYHYVNCYSHRLEVYAVKNGGYKKFREKMFKTHKTPGNWLGQYS
Ga0209190_116842223300027736Freshwater LakeHDVSEYIMYLGKSKVPDTKVVIGIGIALMCTFYPVSYLFTKYHYVNTYSHRLEVYAVKNGGYKKFREKAFKTHKTNGNWLGAYS
Ga0209085_134315523300027741Freshwater LakeMAHDVSEYLSFVAKAKVPDQKIVLCMILAISFTMYPISYLFTKYHYVNCYSHRLEVYAVKNGGYKKFREKMFKTHKTPGNWLGQYSXSIYI
Ga0209175_1031136823300027781Wastewater EffluentMAHDVSEYLTYLQKSKYPDTKVVLWMFVSMYVMFYTASYAFTKFHYINTYSYRFEVYAVKNGGYKKFRQKMFKTHKIPGNWLGNYA
Ga0207421_1020877513300027784Alkaline SedimentMAHDVSEYLAYLARNRVPDTKVIIGMLGFIVATFYPVSYLFTKYHYVNTYSHRFEVYAVKNGKGYKKFREKAFKTHKIPGNWLGAYS
Ga0209830_1047673213300027791MarineDVSEYLMFVSRAKVPDTKMFIYLVLGITFTLYPMSYLFTKYHFVNCHSYRFEAYALKNGGYKKFREKAFKTHKTPGNWLNQYT
Ga0209048_1091322913300027902Freshwater Lake SedimentMAHDVSEYLMFIGRSKVPDTKMVLVMTLAVSAVLYPVSYLFTKYHYINCYSHRFEVYAVKNGGYKKFREKAFKHHKIPGNWLG
Ga0209698_1131134713300027911WatershedsMAHDVSEYLTYIGKNKVPDTKVVICLISAVIATIYPVSWFFTKYHFVNTYSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWMG
Ga0209400_130996123300027963Freshwater LakeMAHDVSEYLSFVAKAKVPDQKIVLCMILAISFTMYPISYLFTKYHYVNCYSHRLEVYAVKNGGYKKFREKMFKTHKTPGNWLGQYSX
Ga0256844_1006679513300028042Mussel SurfaceMAHDVSEYLQFVARAKVPDTKVMIYMAIVIFSFFFPFSYMYTKYHFVNCLSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWHGNYT
Ga0304731_1076619613300028575MarineMAHDVSEYLMFVARAKVPDTKMVLVMAIAMAATMYPVSYLFTKYHMVNCASHRLEVYALKSGGYKKFREKAFRTHKVPGNWLGQ
Ga0311363_1084968513300029922FenMAHDVSEYLAYLARSKVPDTTVVICMVGFIIATFFPVSYMFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWMGQFS
Ga0210277_1038405013300030528SoilMAHDVSEYIKYLGSNKTPDTKVIMCMIGFIIATFYPVSYLFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWLGSFS
Ga0210249_118003413300030542SoilMAHDVSEYLKYISGHRTPDTKVVIAMIGFIIATFYPVSYIFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKIPGNWLGNFS
Ga0210289_155495523300030543SoilMAHDVSEFLTYYSKNKVPDTKVVIALIGCIIATVYPVSYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKVPGNWNGAYS
Ga0247656_123680113300030547SoilMAHDVSEYLSFVAKSKVPDTKVVIGMICCIIATFYPVSYFFTKYHYVNTYSHRLEIYAVKNGGYKKFREKMFKTHKIPGNWLGNFS
Ga0247631_112641213300030550SoilMAHDVSEYLKFLATSKVPDTKVVLSMVGFIVLTFYPISYMFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKIPGNWLGAYS
Ga0210258_1051731413300030572SoilMAHDVSEYLMYIARSKVPDTKVMIYLVFFTSMMFFPVSYHFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKTHGNWLGAYS
Ga0210288_126475123300030575SoilMAHDVSEFLTYYSKNKVPDTKVVIALIGCIIATVYPVSYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKVPGNWNGAYSXRIFLKRVSFFSANLFKTIS
Ga0247637_109866723300030604SoilMAHDVSEYLAYLARSKVPDTLVVIGMVGFIVATFFPVSYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWMGQFS
Ga0247651_1032147713300030608SoilMAHDVSEYLAYLARSKVPDTRVIICMIGLVMATFYPVSYMFTKYHYVNTYSYRFEVYAVKNGGYKKFREKMFKTHKIPGNWLGQFSXVDLEIDKIVNFSLVYSYL
Ga0247613_1028594713300030610SoilMAHDVSEYLKYIGSNKVPDTKVVICLVACIIGTFFPISYMFTKYHYVNTYSHRFEVYAVKNGGYKKFREKQFKTHKIPGNWLGNFS
Ga0210259_1053907323300030625SoilMAHDVSEFLTYYSKNKVPDTKVVIALIGCIIATVYPVSYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKVPGNWNGAYSXRIFLKRVSLSEFI
Ga0210259_1136165313300030625SoilMAHDVSEYLKYISGSKNPDTKVVICLIGFVIATFYPVSYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKIPGNWLGNFS
Ga0247627_1017898413300030635SoilMAHDVSEYLAYLSRSKVPDTVVVMCMVGGIVATIFPISYLFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWMGQFS
Ga0308137_103939233300030722MarineMAHDVSEYLQFVGKAKVPDTKVMLMLTLALAATFYPVSYMFTKYHYVNCYSHRHEVYAVKNGGYKKFRDKAFRTHKTPGNWLGQYS
Ga0265462_1183696213300030738SoilMAHDVSEYLTYLARSKVPDTKVVICMIGCLVATFYPISYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKIPGNWLGQFS
Ga0265460_1135705513300030740SoilMAHDVSESLTYYSKNKVPDTKVVIALIGCIIATVYPVSYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKVPGNWNGAYS
Ga0265461_1039718433300030743SoilMAHDVSEFLTYYSKNKVPDTKVVIALIGCIIATVYPVSYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKVPGNWNGAYSXRIFLKRVFFFSANLFKTISTLKK
Ga0074021_186211623300030775SoilMAHDVSEFLKYVGMNKAPDTMVVITMIAFIFATVWPVSYMFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKIPGNWLGQYS
Ga0075402_1219880613300030777SoilMAHDVSEYLKFIGASKAPDTKVVICMVGFIIATFYPVSYLFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKIPGNWLGQYS
Ga0075378_1089598613300030779SoilMAHDVSEYIMYLSRSKIPDTKVVMSMITFICATFFPVSYFFTKYHYVNTYSHRFEIYAVKNGGYKKFREKMFKSHKISGNWHGNFS
Ga0074032_1081840923300030800SoilMAHDVSEYLMYIARSKVPDTKVMIYLVFFTSMMFFPVSYHFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKTHGNWLGAYSXFTSTYSLFKSKFVTK
Ga0075387_1131830213300030850SoilMAHDVSEYIMYLSRSKIPDTKVVMSMITFICATFFPVSYFFTKYHYVNTYSHRFEIYAVKNGGYKKFREKMFKSHKISGNWHGNFSXIAIDYHSLIFNHYLNL
Ga0073977_100075633300030948MarineMAHDVAEYINYLGRSKVPDTKIVIMMTLCIVATFYPVSYMFTKYHFVNAYSHRLEVYAMKSGGYKKFREKAFKTHKTSGNWLGAYS
Ga0074027_1117507613300030980SoilMAHDVSEYLMYIARSKVPDTKVMIYLVFFTSMMFFPVSYHFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKTHGNWLGAYSXFTSTYSLFKSKFVTKKKK
Ga0074035_1093268713300031000SoilMAHDVSEYLMYIARSKVPDTKVMIYLVFFTSMMFFPVSYHFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKTHGNWLGAYSXFTSTYSLFKSKFVTKKKKK
Ga0074028_1051125423300031050SoilMAHDVSEYLMYLSRSKVPDTQVVICMVGFIIATFFPVSYMFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWSGQFS
Ga0170834_10797905813300031057Forest SoilMAHDVSEYIMYLSRSKVPDTKVVMSMITFICATFFPVSYFFTKYHYVNTYSHRFEIYAVKNGGYKKFREKMFKSHKISGNWHGNFSXIAIDY
Ga0170824_10920102123300031231Forest SoilMAHDVSEYLAYVSGHKVPDLKVIIGMITCIALTFFPVSYLFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKSHKISGNWLGAYS
Ga0170824_12176849013300031231Forest SoilMAHDVSEYLMFISRSKVPDTKVVLCIITACMATVFPVSYLFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWLGAFS
Ga0170819_1414411823300031469Forest SoilMAHDVSEFLTYYSKNKVPDLKVVFCMMACMVFTVYPVSYLYTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKTPGNWYANYT
Ga0170819_1772391623300031469Forest SoilMAHDVSEYIKYLGGSKVPDTKVIIMLVGLVMATFYPVSYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKGHKIPGNWSGNFS
Ga0307489_1016321723300031569Sackhole BrineMAHDVSEFLSYVARNKVPDTKVVLYMMMCITATVYPVSYMFSKYHYVNCYSHRFEVYAVKNGGYKKFRDKAFKTHKTPGNWLG
Ga0307993_114847213300031602MarineRNKVPDTMVVISMILCVVATFYPISYMFTKQHYINTYSHRFEMYAVKNGGYKKFREKMFKTHKTPGNWLGNYS
Ga0307383_1014566023300031739MarineMAHDVSEYISFLGASKVPDTKVIIGMIFTLSCIFYPMSYLFTKYHYINTYSHRMEVYAVKNGGYKKFREKAFKTHKLAGNWLGAHS
Ga0315908_1120559523300031786FreshwaterKSKVPDTKLVITMILCIVGTFYPVSYLFTKYYMVSLYSYRHEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS
Ga0314710_1010325523300032742SeawaterMAHDVSEYLMYVARSKVPDTKIVLCLSLALVATFYPISYIFTKSHYINCYSHRFEVYAVKNGGYKKFREKAFRTHKTPGNWLGQYS
Ga0315742_1049680633300032756Forest SoilMAHDVSEYLSYLAKSRTPDTKVVIAMIGLICATIYPVSYFFTKYHYVNTYSHRFEVYAVKNGGYKKFREKMFKTHKIPGNWLGAYSXIRKRYYVILYLLQLFIFK
Ga0335001_0189887_872_11323300034064FreshwaterMAHDVSEYLSYLAKSKVPDTKLVITMILCIVGTFYPVSYLFTKYYMVNLYSYRHEVYAVKNGGYKKFREKAFKTHKTSGNWLGAYS
Ga0335019_0774387_14_2743300034066FreshwaterMAHDVSEYLAYLGKSKVPDQKVVIGMVICLVATFYPISYLFTKYHYINTYSHRFEVYAVKNGGYKKFREKMFKTHKIQGNWLGAYS
Ga0335017_0733276_252_5003300034167FreshwaterVAEYIAYLGKSKVPDTKVVLSMMLCIVATIYPVSYLFTKYHYINTYSHRLELYAVKNGGYKKFREKAFKTHKTSGNWLGAYS
Ga0335039_0354647_13_2733300034355FreshwaterMAHDVAEYVSYLGKHKVPDTKMVITMMLFIVGTFYPVSYLFTKYHFINTYSHRFEVYAVKNGGYKKFREKQFKTHKTSGNWLGAYS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.