NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037522

Metagenome / Metatranscriptome Family F037522

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037522
Family Type Metagenome / Metatranscriptome
Number of Sequences 167
Average Sequence Length 57 residues
Representative Sequence VLHPTLPVDRVTRRKLRMAQDSDDLFVVNIVVWVLVVILAIVALHCPLPRRVVR
Number of Associated Samples 96
Number of Associated Scaffolds 167

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 10.84 %
% of genes near scaffold ends (potentially truncated) 86.23 %
% of genes from short scaffolds (< 2000 bps) 98.80 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (91.617 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(75.449 % of family members)
Environment Ontology (ENVO) Unclassified
(94.012 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(81.437 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.34%    β-sheet: 0.00%    Coil/Unstructured: 53.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 167 Family Scaffolds
PF00078RVT_1 1.20
PF13966zf-RVT 1.20
PF00190Cupin_1 0.60
PF14223Retrotran_gag_2 0.60
PF13952DUF4216 0.60
PF00665rve 0.60
PF07727RVT_2 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 167 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.60
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.60
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.60
COG4584TransposaseMobilome: prophages, transposons [X] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.62 %
UnclassifiedrootN/A8.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005355|Ga0070671_101588490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum580Open in IMG/M
3300005355|Ga0070671_101797801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300005843|Ga0068860_101652084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii663Open in IMG/M
3300009972|Ga0105137_106514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii594Open in IMG/M
3300009975|Ga0105129_114802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300009976|Ga0105128_117392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum546Open in IMG/M
3300009980|Ga0105135_124477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M
3300009981|Ga0105133_122284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300009981|Ga0105133_131414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum507Open in IMG/M
3300009985|Ga0105036_125004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300009989|Ga0105131_134142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum552Open in IMG/M
3300009990|Ga0105132_108520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum825Open in IMG/M
3300009994|Ga0105126_1010290Not Available883Open in IMG/M
3300009994|Ga0105126_1045361All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii549Open in IMG/M
3300009995|Ga0105139_1007532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1306Open in IMG/M
3300009995|Ga0105139_1034257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum834Open in IMG/M
3300009995|Ga0105139_1038964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum800Open in IMG/M
3300009995|Ga0105139_1054669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii710Open in IMG/M
3300010371|Ga0134125_12281520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum588Open in IMG/M
3300010373|Ga0134128_12115818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum620Open in IMG/M
3300010400|Ga0134122_12321382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii582Open in IMG/M
3300010400|Ga0134122_12478760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum567Open in IMG/M
3300010401|Ga0134121_12866500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300015270|Ga0182183_1093412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300015284|Ga0182101_1022536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum815Open in IMG/M
3300015284|Ga0182101_1029236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum754Open in IMG/M
3300015290|Ga0182105_1089246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum541Open in IMG/M
3300015293|Ga0182103_1047278All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum651Open in IMG/M
3300015297|Ga0182104_1005101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1332Open in IMG/M
3300015297|Ga0182104_1048290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum693Open in IMG/M
3300015297|Ga0182104_1090376Not Available560Open in IMG/M
3300015301|Ga0182184_1030372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum752Open in IMG/M
3300015301|Ga0182184_1061591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor597Open in IMG/M
3300015306|Ga0182180_1076953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300015310|Ga0182162_1054901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum688Open in IMG/M
3300015310|Ga0182162_1056384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum682Open in IMG/M
3300015310|Ga0182162_1121106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300015311|Ga0182182_1043398Not Available723Open in IMG/M
3300015311|Ga0182182_1121612Not Available504Open in IMG/M
3300015312|Ga0182168_1074668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum636Open in IMG/M
3300015315|Ga0182120_1126996Not Available522Open in IMG/M
3300015316|Ga0182121_1012048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae1209Open in IMG/M
3300015316|Ga0182121_1143914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300015317|Ga0182136_1017791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1027Open in IMG/M
3300015317|Ga0182136_1060498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii692Open in IMG/M
3300015317|Ga0182136_1061235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300015317|Ga0182136_1072065Not Available650Open in IMG/M
3300015317|Ga0182136_1137353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300015318|Ga0182181_1031487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum781Open in IMG/M
3300015319|Ga0182130_1013198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1082Open in IMG/M
3300015319|Ga0182130_1111981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015319|Ga0182130_1120627All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum528Open in IMG/M
3300015319|Ga0182130_1130529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300015320|Ga0182165_1090457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii611Open in IMG/M
3300015320|Ga0182165_1091420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii608Open in IMG/M
3300015320|Ga0182165_1098546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii591Open in IMG/M
3300015325|Ga0182148_1003122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1652Open in IMG/M
3300015325|Ga0182148_1079023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum636Open in IMG/M
3300015325|Ga0182148_1105642All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum571Open in IMG/M
3300015325|Ga0182148_1129927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum527Open in IMG/M
3300015326|Ga0182166_1074518All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum647Open in IMG/M
3300015326|Ga0182166_1082325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300015326|Ga0182166_1101912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum577Open in IMG/M
3300015327|Ga0182114_1021083Not Available1059Open in IMG/M
3300015327|Ga0182114_1090852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum638Open in IMG/M
3300015327|Ga0182114_1105756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum601Open in IMG/M
3300015330|Ga0182152_1112563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300015331|Ga0182131_1155080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300015332|Ga0182117_1050109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum823Open in IMG/M
3300015332|Ga0182117_1136528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300015333|Ga0182147_1054087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii788Open in IMG/M
3300015333|Ga0182147_1063616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum743Open in IMG/M
3300015333|Ga0182147_1143699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300015334|Ga0182132_1003184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1806Open in IMG/M
3300015334|Ga0182132_1052033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum802Open in IMG/M
3300015334|Ga0182132_1088139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum659Open in IMG/M
3300015335|Ga0182116_1072674All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii735Open in IMG/M
3300015335|Ga0182116_1149740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300015336|Ga0182150_1031913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum924Open in IMG/M
3300015336|Ga0182150_1083019All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum663Open in IMG/M
3300015337|Ga0182151_1092879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum636Open in IMG/M
3300015338|Ga0182137_1085975All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300015339|Ga0182149_1069348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum729Open in IMG/M
3300015339|Ga0182149_1086467All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum671Open in IMG/M
3300015339|Ga0182149_1092727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
3300015340|Ga0182133_1087136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum702Open in IMG/M
3300015348|Ga0182115_1085481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae978Open in IMG/M
3300015348|Ga0182115_1092307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum944Open in IMG/M
3300015348|Ga0182115_1206214All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum629Open in IMG/M
3300015348|Ga0182115_1270287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300015349|Ga0182185_1025989All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1384Open in IMG/M
3300015349|Ga0182185_1070062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum963Open in IMG/M
3300015350|Ga0182163_1094873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum900Open in IMG/M
3300015352|Ga0182169_1098745All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum933Open in IMG/M
3300015352|Ga0182169_1103657All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae912Open in IMG/M
3300015352|Ga0182169_1146344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum770Open in IMG/M
3300015352|Ga0182169_1195690Not Available661Open in IMG/M
3300015352|Ga0182169_1234660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii597Open in IMG/M
3300015352|Ga0182169_1253190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300015352|Ga0182169_1261534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum561Open in IMG/M
3300015353|Ga0182179_1035254All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1290Open in IMG/M
3300015353|Ga0182179_1126895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum782Open in IMG/M
3300015353|Ga0182179_1139899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii749Open in IMG/M
3300015353|Ga0182179_1164307Not Available697Open in IMG/M
3300015354|Ga0182167_1025265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1834Open in IMG/M
3300015354|Ga0182167_1040979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1546Open in IMG/M
3300015354|Ga0182167_1236859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii661Open in IMG/M
3300017412|Ga0182199_1057834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum811Open in IMG/M
3300017412|Ga0182199_1060019All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum801Open in IMG/M
3300017414|Ga0182195_1093677All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300017414|Ga0182195_1130970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300017414|Ga0182195_1156670Not Available580Open in IMG/M
3300017422|Ga0182201_1125173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300017432|Ga0182196_1058828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum705Open in IMG/M
3300017432|Ga0182196_1073720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
3300017432|Ga0182196_1076642All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum644Open in IMG/M
3300017432|Ga0182196_1109454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum570Open in IMG/M
3300017432|Ga0182196_1118072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300017439|Ga0182200_1064066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum698Open in IMG/M
3300017439|Ga0182200_1077599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum655Open in IMG/M
3300017440|Ga0182214_1069693Not Available723Open in IMG/M
3300017445|Ga0182198_1167934All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300017447|Ga0182215_1085132Not Available695Open in IMG/M
3300017691|Ga0182212_1164007All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300017692|Ga0182210_1149041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii520Open in IMG/M
3300017693|Ga0182216_1000156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta6955Open in IMG/M
3300017693|Ga0182216_1201309All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum525Open in IMG/M
3300017694|Ga0182211_1142563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300026088|Ga0207641_11872782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum601Open in IMG/M
3300026088|Ga0207641_12212494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum550Open in IMG/M
3300028049|Ga0268322_1043756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300028050|Ga0268328_1034166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300028052|Ga0268300_1011091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300028055|Ga0268338_1016632All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300028061|Ga0268314_1018841All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum729Open in IMG/M
3300028064|Ga0268340_1080114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300028151|Ga0268308_1001733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1285Open in IMG/M
3300028152|Ga0268336_1031268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae502Open in IMG/M
3300028154|Ga0268341_1029242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum517Open in IMG/M
3300028248|Ga0268312_1025164All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum578Open in IMG/M
3300028253|Ga0268316_1015178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum587Open in IMG/M
3300028253|Ga0268316_1017796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii558Open in IMG/M
3300028467|Ga0268333_1002696All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum812Open in IMG/M
3300028477|Ga0268309_1005981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum724Open in IMG/M
3300028477|Ga0268309_1014791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum566Open in IMG/M
3300028526|Ga0268339_1010135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii621Open in IMG/M
3300032465|Ga0214493_1130305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum589Open in IMG/M
3300032465|Ga0214493_1161248All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300032467|Ga0214488_1075473All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum744Open in IMG/M
3300032469|Ga0214491_1089808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum740Open in IMG/M
3300032469|Ga0214491_1147151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum550Open in IMG/M
3300032551|Ga0321339_1117822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
3300032593|Ga0321338_1130260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum895Open in IMG/M
3300032625|Ga0214501_1284850All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300032697|Ga0214499_1186382Not Available642Open in IMG/M
3300032789|Ga0314725_1045658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300032792|Ga0314744_1047112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum843Open in IMG/M
3300032824|Ga0314735_1084087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum594Open in IMG/M
3300032875|Ga0314737_1043260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum783Open in IMG/M
3300032889|Ga0314751_1008067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1773Open in IMG/M
3300032913|Ga0314739_1050228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum785Open in IMG/M
3300032914|Ga0314750_1142746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii557Open in IMG/M
3300032916|Ga0314734_1008804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1685Open in IMG/M
3300032934|Ga0314741_1038484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1089Open in IMG/M
3300033530|Ga0314760_1051028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1022Open in IMG/M
3300033530|Ga0314760_1088147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum768Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere75.45%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere9.58%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated8.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.20%
Switchgrass LeafHost-Associated → Plants → Phylloplane → Endophytes → Unclassified → Switchgrass Leaf0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009985Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_101 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028052Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028061Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028151Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028154Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028248Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028253Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028467Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028477Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028526Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032789Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032792Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032824Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032875Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032913Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032914Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032916Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032934Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070671_10158849013300005355Switchgrass RhizosphereLFPKTLSRGSVLHPTLPVDRVTRRKLRMAQDSDDLFVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0070671_10179780113300005355Switchgrass RhizosphereVDRVTHRKFRMAQDSDDPLSVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0068860_10165208423300005843Switchgrass RhizosphereQRKIQTSFPKTLSRGSVLHPTLPVDRVTRRKFRMAQDSDDPLFVVNIIVWVLVVILAIVALHCPLPRRVVR*
Ga0105137_10651423300009972Switchgrass AssociatedSRDSVLHPILLVDRVTELRMAQDSNDLFIVNIVVWVLVVILAIVAFHCPLPRRVVR*
Ga0105129_11480213300009975Switchgrass AssociatedMDKVTRRKFRMAQDTDDPLFVVNIIVWVLVVILAIVALHCPLPRRVV
Ga0105128_11739223300009976Switchgrass AssociatedFPQRSSRGSVLRPTLPVDRVTRRKFRMAQDSDDPLFVVNIIVWVLVVILAIVALHCTLPQRVVR*
Ga0105135_12447713300009980Switchgrass AssociatedPHSLFLQKKIQTSFRTTLSRGTVLHPALHVDRVTRRKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0105133_12228413300009981Switchgrass AssociatedVDRVTRRKFRIAQDSDDPLFVVNIVVWVLIVILAIVARRRLRRW
Ga0105133_13141413300009981Switchgrass AssociatedTLPVDSVTRRKLCMVQDFEDPFVVNVIVWVLVVILAIVALHCPLPRRVVR*
Ga0105036_12500413300009985Switchgrass LeafMLSRGSVLHLTLPVDRVTRRRYRMAQDSDDPLFIINIIVWVWVVILSIVALLY
Ga0105131_13414213300009989Switchgrass AssociatedTLPVVRVTRRKLRMAQDSDDLYMVHVLVWVLVLVLTIVALHCPLPRRVV*
Ga0105132_10852013300009990Switchgrass AssociatedPVDRVTRRKFRMAQDSDDPLFIVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0105126_101029013300009994Switchgrass AssociatedPRTLGRDSVLHPTLPVDRVTRRKLHMAQDSDDLFVVNVLVWVLVVILAIVALHCPLPRRVVR*
Ga0105126_104536123300009994Switchgrass AssociatedRKIQTLFSKTFSKDSVLHPTLLVDRVTHRKLRMTQDSDDLFVVNIVVWVLVVILAIVALHYPLPRIVVR*
Ga0105139_100753223300009995Switchgrass AssociatedVVALHPTLPVDRVTRRKLRMAQDSDDLFVVNTVVWVLVVILAIVALH
Ga0105139_103425723300009995Switchgrass AssociatedDRVTRRKLRMVQGSDDLFVVNVVVWVLVVILAIVALHCPLPRRVVR*
Ga0105139_103896423300009995Switchgrass AssociatedVHRVTRRKLRMAQDSDDLYVVNIIVWVLVVILAIVALHCPLPRRVVR*
Ga0105139_105466913300009995Switchgrass AssociatedDRVTRREFRMAQDYDDPLFVVNIVVWVLVVILAIVALHCLLPRKVVR*
Ga0134125_1228152023300010371Terrestrial SoilLSRGSVLHPTLPVDRVTRRKFRMAQDSDDPLFVVNIVVWLLVVILVIVALHCPLPRRVVR
Ga0134128_1211581813300010373Terrestrial SoilVVRVTCRKLRVAQDSDDLDMVHVLVWVLVVILAIVALHCPLPRRVVR*
Ga0134122_1232138223300010400Terrestrial SoilGSVLHPTLPVDRVPRRKLRMAQDSDDLFVVNVIVWVLFVILAIVVLHCPLPRRVVR*
Ga0134122_1247876013300010400Terrestrial SoilVLHPTLPVDRVTRRKLRMAQDSDDLFVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0134121_1286650013300010401Terrestrial SoilMFPKTLSRGSVLHPTLPVDRVTRRKLRMTHDSDDLFVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0182183_109341213300015270Switchgrass PhyllosphereLHPTLTADRVTRRKLRMVQDSDDLFVVNVVVWVLFVIPAIVALHCPLPRRVVR*
Ga0182101_102253613300015284Switchgrass PhyllosphereKTQTSFPKTLSRGSVLHPTLPVDRVTRRKLRMAQDSDDLFVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0182101_102923613300015284Switchgrass PhyllosphereLFSKTFSKDSVLHPTLLVDRVTRRKLRMTQDSDDLFIVNVVVWVLVVILAIVALYCPLPRRVVR*
Ga0182105_108924613300015290Switchgrass PhyllospherePKSLSRGSVLHPTLPVDRVTRRKFRMAQDSDDPLFVVNIIVWVLVVILALVALHCPLPRRVVR*
Ga0182103_104727823300015293Switchgrass PhyllosphereCSVLHPTLPVDRITRRKFRMAQDSDDPLFVVNIIVWVLVVILAIVALHCPLPRRVVR*
Ga0182104_100510113300015297Switchgrass PhyllosphereLSRGSVLHPTLPVDRVTRRKFCMAQDSDDFFVLHVLVWVVVVVLAIVALHYPLPHIVVW*
Ga0182104_104829013300015297Switchgrass PhyllosphereMDRVTSRKFRMAQDSDDPHFIVNIVVWVLVVILAIVALHCPLPRRV
Ga0182104_109037623300015297Switchgrass PhyllosphereLHPTLPMDRVTRRKLRMVQDSDYLFIVNIVVWVLVVILAIVALHCPLPL*
Ga0182184_103037213300015301Switchgrass PhyllosphereLNRGSVLHPTFPVDRVARRKLRMGQDSDDLFVVNIVVWVLVVILAIVALHCPLPRRIVRWFTI*
Ga0182184_106159123300015301Switchgrass PhyllosphereVSRGSILHPTLPVDRVARRELRMAQDSDDFSVLHVLVWVIVVVLAIVALHCPLPRRVVW*
Ga0182180_107695313300015306Switchgrass PhyllosphereQRKIQTSSLTTLSRRTVLHPAFLVDRVTRRKFRMAQDSDDPLFVVNVVVWILVVILAIVALHCPLPHRVVR*
Ga0182162_105490113300015310Switchgrass PhyllosphereVLHPTLPVVRVTRRKLRMAQDSDDLYMVHVLVWVLVLVLAIVALHCPLPRRAVW*
Ga0182162_105638413300015310Switchgrass PhyllospherePTLPVDRVTRRKLRMAQDSDDLFVVNVVVWVLVVILAIVALHCPLPCRVVR*
Ga0182162_112110613300015310Switchgrass PhyllosphereLHPTLPVDRVTHKKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPCRVVR*
Ga0182182_104339823300015311Switchgrass PhyllosphereSVLHPTLPVDRVTRRKLRMAQDSDDLFVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0182182_112161213300015311Switchgrass PhyllosphereSRGPVLHPTMPMDRVTRRKFRMVPDSDDLFIVNIVIWVLVVILAIVALHCPLPRRVVR*
Ga0182168_107466823300015312Switchgrass PhyllosphereSVLHPTLPVDRVTRKKLRLAQDSDDLFVVHVLVWVLVVVLAIVTLHCPLPCRVIR*
Ga0182120_112699613300015315Switchgrass PhyllosphereMLSRDFVLHPTLPVDRVTRRSSVWCTTDDFFVLHVLIWVVVVVLAIVALHCPL
Ga0182121_101204823300015316Switchgrass PhyllosphereLPVDRVTRRKFRMAQDSDDPLFIVNIILWVLVVILAIVALHCPLPRRVVQ*
Ga0182121_114391413300015316Switchgrass PhyllosphereALPVDRVTRKKFRMAQDSDDPLFIVNVVVWVSVVILAIVALHCPLPRRVVR*
Ga0182136_101779113300015317Switchgrass PhyllosphereWIRVTYRRFCMAQDSDDPLFVVNVVVWVLVVILAIVALHCPLPRRFVR*
Ga0182136_106049813300015317Switchgrass PhyllospherePVDRVTRRKIRMVQDSDDPLFVVNIIVWVLVVILAIVAFHCPITCRVVR*
Ga0182136_106123523300015317Switchgrass PhyllospherePRTLSRGSVLHPTLPVDRVTCRKLCMTQDFDDLFVLHVLVWVVVVVLAIVALHCQLPRRVVR*
Ga0182136_107206513300015317Switchgrass PhyllosphereLPVDSVTRRKFCMAQDSDDFFVLHVLVWVVVVVLAIVALHCPLPRRVVR*
Ga0182136_113735313300015317Switchgrass PhyllospherePVVRVTRRKLRMAQNSDDLFVVNIVVWVLVIILAIVALHCPLPRRVVR*
Ga0182181_103148723300015318Switchgrass PhyllosphereLPVDRITRRKFRMTQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0182130_101319813300015319Switchgrass PhyllospherePVDRVTRRKLRMAQDSDDLCIVNIAVWVLVVILAIVALHYPLPRRVVH*
Ga0182130_111198113300015319Switchgrass PhyllosphereIQTLFPRTLSRGSVLHPTLPVDRVTRRKLRMAQDSDDLFVANIVVWVLVIILAIVALQCPLPRRFLW*
Ga0182130_112062713300015319Switchgrass PhyllosphereTLFPRTLSRGSVLHPTLPMDRVTRRELRMAQDSDDLFVVNIVVWVLVLALAIVALHCPLPHRVVR*
Ga0182130_113052913300015319Switchgrass PhyllosphereMDRVARRKLGITQDSNDLYVVNIIVWVLVVILAIVALHCPLPRRV
Ga0182165_109045723300015320Switchgrass PhyllosphereSILHTALPMVRVTRRKFRMAQDFDDPLFVVNVVVWVLVVILAIVALHCPLPHRVVR*
Ga0182165_109142013300015320Switchgrass PhyllospherePVDRVTRRKFRMAQDSDDPLFVVNIIGWVLVVILAIVALHCPLPCRVIW*
Ga0182165_109854613300015320Switchgrass PhyllosphereDSFPKTLSRGPVLHPTLHVDRVTRRKFRMAQDSDDPLFIVNVVVWVLLVILAIVALHCPLPRRVVR*
Ga0182148_100312223300015325Switchgrass PhyllosphereSRGSVLHPTLPVDRVTRRKFRMAQDSDDPLFVVNIVVWLLVVILVIVALHCPLPRRVVR*
Ga0182148_107902313300015325Switchgrass PhyllosphereMVRVARRKFRMAQDSDDLLFVVNIVVWVLVVILAIVALHCPL
Ga0182148_110564213300015325Switchgrass PhyllosphereSFPKTLSRGPVLHPNLPVDRVTRMKFHMAQDSYDPLFVVNIVVWVLVVILAIVALHCPLPCRVVR*
Ga0182148_112992713300015325Switchgrass PhyllosphereCTQPLPVDRVTRRKFRMAQDSDDPLFVVNIIVWVLVVVLAIVALHCPLPRRVVR*
Ga0182166_107451813300015326Switchgrass PhyllosphereMSKGSVLHPALPVDRVTRRKFRMAQDPDDLFIVNVVVWVLVVILAIVALHCPLPRRVIR*
Ga0182166_108232513300015326Switchgrass PhyllosphereLFPKTLSRGSVLHPTLPMDRVTRRKLRMAQDSDDLFVVNVVVWVLVVILAIVALHYPLPRGVVR*
Ga0182166_110191213300015326Switchgrass PhyllosphereLFPKTLSRVSVLHPTLHVDRVTRSKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRRVLR*
Ga0182114_102108313300015327Switchgrass PhyllosphereTSFLKTLSRGSVLHSILPVDRVIRRKLRMTQDSDDLFVVNIVVWFLVVILAIVALHCPLPRRVVR*
Ga0182114_109085233300015327Switchgrass PhyllospherePTLPVDRVTRRKLRMAQDSDDLFVVNIVVWVLVVILAIVALHCPLPRRVVQ*
Ga0182114_110575623300015327Switchgrass PhyllosphereGSVLHPTLPVDRVTRRKFRMAQDSDDPLFVVNIVVWLLVVILVIVALHCPLPRRVVR*
Ga0182152_111256313300015330Switchgrass PhyllosphereGSILHPTLSVDRVNRRKLRMAQDSDDLFIVNVVVWVLVVIFAIVMLHCPLPRRVVR*
Ga0182131_115508013300015331Switchgrass PhyllosphereVLHPTLPVVRVTRRKLHMAQDSDDLIVVHVLVWFLVVVLAIVALHCPLPRRVVR*
Ga0182117_105010923300015332Switchgrass PhyllosphereLPVDRVTRRKLRMAQDSDDLFVVNVVVWVLVVILAIVALHCPLPRRVVR*
Ga0182117_113652813300015332Switchgrass PhyllosphereMLSRGSVLHLTLPVDRVTRRKLHMVQDSDDLFVLHVLVWVIVVVLAIVALHCPLPHRVVR
Ga0182147_105408713300015333Switchgrass PhyllosphereMPVDRVTRRKFRMAQDSDDPLFVVNIIVWVLVVILAIVALHCPLPRRVVR*
Ga0182147_106361613300015333Switchgrass PhyllosphereFLQRRIQNLIPRTLSRHSVLQPTLPVDRVTRRKLRMVQDSDDLFVVHVLVCDLVLVLAIVALHCPLPRRVVQ*
Ga0182147_114369913300015333Switchgrass PhyllosphereSPHSQFLQRKTQTLFPKMSSRGSVLHPTLPVNRVTHRKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0182132_100318413300015334Switchgrass PhyllosphereQRKIQTSFPKTLSRGSVLHPTLPVDRVTRRKLRMVQDSDDLFVVNIVVWVLVVILAIVALHCPLPRRVVR*
Ga0182132_105203313300015334Switchgrass PhyllosphereRGSVLHPTLPVVRVTCRKLRMAQDSDDLYMVHVLVWVLIFVLAIVALHCPLPRRVVR*
Ga0182132_108813923300015334Switchgrass PhyllosphereSILHPTLPVDRVTRIKFHIAQDSDDPLFVVNVVVWVLVVILAIVALHCPLPRRVVR*
Ga0182116_107267413300015335Switchgrass PhyllosphereLWSRVTRRRFRMAQDSDDPLFVVNVVVWVLVVILAIVALHCPLPRRVVR*
Ga0182116_114974013300015335Switchgrass PhyllosphereFLQRKIQTLFPRTTSRGSVLHPTLPVDRVTRRKLGMVQDYDDLFIVNIVVWVLVVILEIVALHCLLPHRVVW*
Ga0182150_103191323300015336Switchgrass PhyllosphereTSFPKTSSIGSVLHTTLPVDRVTRRKFRMTQDSDDPLFIVNIVVWVLVVSREIVALHCPLPRSVVR*
Ga0182150_108301913300015336Switchgrass PhyllosphereRKIQTLFPRTLSRGSVLHLTLPVDRVTRRKICMAQDSNDLFVLHVLVWVVVVVIAIVTLYCPLPRRVVR*
Ga0182151_109287923300015337Switchgrass PhyllospherePVDRVTRRKFRMAQDSDDPLFVVNIVVWVCVVILAIVALHCPFPRRVVL*
Ga0182137_108597523300015338Switchgrass PhyllosphereTLFPKTLSRGSVLHPILPVDSVTRRKFCMAQDSDDFFVLHVLVWVVVVVLAIVALHYPLPRRVVR*
Ga0182149_106934813300015339Switchgrass PhyllosphereLFPKKLSRGSVLHPTLSVDRVNCRKLRMAQDSDDLFIVNVVVWVLVVILAIVALHCPLLCRVVR*
Ga0182149_108646723300015339Switchgrass PhyllosphereGTVLHPALPVDRVTRRKFRMAQDSDDPLFIVNVVVWVLVVILAIVALHCPLPRRVVQ*
Ga0182149_109272713300015339Switchgrass PhyllosphereMVRVTRRKFRMAQDSDDPLFVVNIVVWVLVVILAIVALH
Ga0182133_108713613300015340Switchgrass PhyllosphereTLPVDRVTRRKFRMAQDSDDPLFVVNIIVWVLVVILAIVALHCPFPRRVIR*
Ga0182115_108548123300015348Switchgrass PhyllosphereLFPRTLSRGSVLHPTLPVVRVTRRKLRMTPDSDDLFVVNIVVWVLVVILTLVALHCPLPRRAVR*
Ga0182115_109230713300015348Switchgrass PhyllosphereRGSVLHPTLPVDRVTRRKFHMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPHRVVR*
Ga0182115_120621413300015348Switchgrass PhyllosphereHPTLPVDRVTRRKLRMAQDSDELFVVNIIVWVLVVILAIVALRCLLPCRIVR*
Ga0182115_127028713300015348Switchgrass PhyllospherePTLPVDRVTRRKFRMAQDSDDPLFVVNIVVWVLVIILAIVALHCPLPRRVVR*
Ga0182185_102598933300015349Switchgrass PhyllosphereRRATATTTTILHPTLPVDRVTRRRFRMAQDSDDPLFIVNIVVWVLVVIFAIVALHCPFPRRVVR*
Ga0182185_107006213300015349Switchgrass PhyllosphereVLHPALPVDRVTRRKFRMAQDSDDPLFVVNIIVWVLVVILAIVALHCPLPRRVVR*
Ga0182163_109487313300015350Switchgrass PhyllosphereFPKTLSRGSVLHPTLPVVRVTKLRMAQDSDDFFVLHILVWVVVVVLAIVALHCPLLRRVVR*
Ga0182169_109874513300015352Switchgrass PhyllosphereTSFPKTLSRGSVLHPTLPVDRVTRRKLRVAQDSDDLFIVNIVVWVLVVILAIVALHCPLPHRVVR*
Ga0182169_110365723300015352Switchgrass PhyllosphereRVTRRKLRMAQDSDDLFVVNIVVWVLVVILALVALHCPLPRRAVR*
Ga0182169_114634413300015352Switchgrass PhyllosphereTSFPKTLSRGYVLHPTLPVDRVTRRKFRMVQDSDDPLFVVNIIVWVLVVILAIMALHCPLPRRVVR*
Ga0182169_119569023300015352Switchgrass PhyllosphereVRVTRRKLRMAQDSDDLFVVRVLVCVLVVVLAIVALHCPFPRRVVR*
Ga0182169_123466013300015352Switchgrass PhyllospherePVDRVTRRKFPMAQDSDDPLFVVNIIVWVLVVILTIVAIHCPLPRRVVR*
Ga0182169_125319023300015352Switchgrass PhyllosphereIQTSFPKTLSRGSVLHPTLPMDRVTRRKLRMAQDSDDLFVVNIVVWVLVVILAIVALHCPLPR*
Ga0182169_126153413300015352Switchgrass PhyllosphereSRGSVLHPTLPVDRATRRKLRMAQDSDDLFVINVVVWVLVVILAIVALHCPLPHIVVR*
Ga0182179_103525413300015353Switchgrass PhyllospherePTLPVDRVTRRKLRMAQDSDDLFVVNIIIWVLVVILAIMALHCPLPRRFVW*
Ga0182179_112689523300015353Switchgrass PhyllospherePVDRVTRRKFRMAQDSDDPLFVVNIVVWLLVVILVIVALHCPLPRRVVR*
Ga0182179_113989923300015353Switchgrass PhyllosphereFPKTLSRGSVLHPTLPVDRVTRRKIRMVQDSDDPLFVVNIVVWVLVVILAIVAFHCPLLRRVVR*
Ga0182179_116430723300015353Switchgrass PhyllosphereLPVDRVTRRELRMAQDSDGLFVVNVVVWVLVVILAIVALHCPLLRRVVC*
Ga0182167_102526513300015354Switchgrass PhyllosphereRGSVLHPTLPVDRVTRRKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPCRVVQ*
Ga0182167_104097923300015354Switchgrass PhyllospherePVVRVTRRKLRMAQDSDDLFVVHVFVWVLVVVLAIVALHCPLPRRVIRRCTI*
Ga0182167_123685913300015354Switchgrass PhyllosphereVTRRKFRMAQDSNDPLFGVNIVVWVLVVILAIVALHRPLPRRVVQ*
Ga0182199_105783413300017412Switchgrass PhyllosphereWLDLLSMFVLTLAQFLQRKIQSLFPRMLSRGSVLHPILPVDRVTRRRFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLARTVVR
Ga0182199_106001913300017412Switchgrass PhyllosphereALPVDRVTRRKFRMAQDSDDPLFIVNIFVWVLVVILVIVALHCPLPCRVVR
Ga0182195_109367723300017414Switchgrass PhyllosphereKTLSRGSVLHPTLPVDRVTRRKFRMVQDSDDPLFVVNIVVWVLVVIRAIVALHCPLTRRVVR
Ga0182195_113097013300017414Switchgrass PhyllosphereVLHPTLPVDRVTRRKLRMAQDSDDLFVVNVVVWVLVVILAIVALHCPLPRRVVR
Ga0182195_115667013300017414Switchgrass PhyllosphereLFLTTLSRGTVLHPALPVVWVTRRKFCMAQDSDDPLFVVNVVVWVLVVILAIVALHCPLPRRVV
Ga0182201_112517313300017422Switchgrass PhyllosphereRGSVLHPTLSVDRATRRKLRMAQDSDDLFVVNIIVWVLVVILAIVALHSPLPRIVVR
Ga0182196_105882823300017432Switchgrass PhyllosphereLPVVRVTRRKLRMAQDSDDLFVVHVLVWVLVVVIAIVALHCPLLRRVVW
Ga0182196_107372013300017432Switchgrass PhyllosphereLPVDRVTRRKFRMAQDSDDPLFVVNIVVWMLVVILAIVALHCPLPRRVVR
Ga0182196_107664213300017432Switchgrass PhyllosphereKIRTSFPKTSSRGSVLHPTLPVDRVTRRKFRMAQDSDDPLFVVNIVVWVLVAILVIVALHCPLPHRVVR
Ga0182196_110945413300017432Switchgrass PhyllosphereILFPRTLSRGPVLHPTLLLDRVTRRKLRMAQDSDDLFVVNIVVWVLFVILAIVALHCPLPRRVVW
Ga0182196_111807213300017432Switchgrass PhyllosphereTSFPKTLNRGSVLHPILPVDRVTRRKLRMVQDSDDLFVVNVVVWVLVVILGIVALHCPLPRRVVR
Ga0182200_106406623300017439Switchgrass PhyllosphereSVDRVTRRKIRMTQDSDDPFFVVNIVVWVLVVILVMVAFQ
Ga0182200_107759913300017439Switchgrass PhyllospherePSLHVVRVTRRKLRMAQNSDDLYMVHVLVWVLVLVLAIVVLHCPLPRRVVW
Ga0182214_106969313300017440Switchgrass PhyllosphereVDRTRRKLRMAQDSDDLFVVNVLVWVLVVILAIVALHCPLPRRVVR
Ga0182198_116793413300017445Switchgrass PhyllosphereQNLFPRTLSRGSVQHPTLPMVRMTRRKLRMAQDSDDLFVVHVLVWVLVVVIAIVALHCPLLRRVVR
Ga0182215_108513213300017447Switchgrass PhyllospherePTLHVDRVTRRKFCMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRRVIW
Ga0182212_116400713300017691Switchgrass PhyllosphereVDRVGRRKFRMVQDSDDPLFVVNIIVWVFVVILAIVALHCPLPRIVVQ
Ga0182210_114904113300017692Switchgrass PhyllosphereLHPTLPVYRVSRRKFRMVQESDDPLFVVNIVVWVLVVILAIVALHCPLPRRVVR
Ga0182216_100015613300017693Switchgrass PhyllosphereFLQRKIQTSFPKMLSRGSVLHPTLPVDRVTRRKIRMAQDSDDPLFVVNIVVWLLVVILVIVALHCPLPRRVVR
Ga0182216_120130913300017693Switchgrass PhyllosphereRGSVLHPTLPVDRVTHRKFHMAQDSDDPLFVVNIIVWVLVVILAIVALYCPLPCRVVR
Ga0182211_114256313300017694Switchgrass PhyllosphereGSVLHPTLPVDRVTRRKFRMAQDSDDPLFIVNIVVWVLVVILAIVALHCPLPRRVVR
Ga0207641_1187278213300026088Switchgrass RhizosphereLFPRTLSRGSVLHPTLPVDRVTRRKLRMAQDSDDLFVLHVLVWVVVVVLAIVALHCPLTR
Ga0207641_1221249413300026088Switchgrass RhizosphereLPMDRVTRRKLRMAQDSDDLFVLHVLVWVVVVVLAIVALHCPLPRIVIR
Ga0268322_104375623300028049PhyllosphereVLHPTLPVDRVTRRKFRMAQDSDDPLFVVNIIVWVLFVILAIVALHCPLLRRVVW
Ga0268328_103416623300028050PhyllosphereFLQRKIQTSFPKMLSRGSVLHPTLPVDRVTRRKFRMAQDSDDPLFVVNIVVWLLVVILVIVALHCPLPRRVVR
Ga0268300_101109113300028052PhyllosphereMLSRGPVLHPNLPVDRVTRMKFCMAQDSDDPLFVVNIIVWVLVVILALVALHCPLPHRVV
Ga0268338_101663213300028055PhyllosphereMLSRGSILHPTLPVDRVTRRKFRMAQDSDDPLFIVNIIVWVLVVILAIVALHCPLPR
Ga0268314_101884123300028061PhyllosphereVGLDLLSTFVLTLAYFLQRKIQNLFPRTLSRGSVLHPTLHVVRVTCRKLRVVQDSDDLDMVHVLVWVLVLVLAIVALHCPLPRRVVR
Ga0268340_108011423300028064PhyllospherePKTLSRGSVLHPTLPMDRVTRRKLRMAQDSDDLFVVNIVVWVLVVILAIVALHCPLPR
Ga0268308_100173313300028151PhyllosphereKTLSRGSVLHPTLPVDRVTRRKFCMAQDSDDPLFVVNIVVWVLVVIFAIVALHCPLLRRVVR
Ga0268336_103126823300028152PhyllospherePVDRVTRRKFRMAQDSDDPLFIVNIVVWVLVVILAIVALHCPLPRRVVR
Ga0268341_102924213300028154PhyllosphereMVRVTRRKFRMAQDFDDPLFVVNVVVWVLVVILAIVALHCPLPRRVVR
Ga0268312_102516423300028248PhyllospherePHPLFLQRKIQTSFLATLSRGTVLHPALPVNRVTRRKFHMAQDSDDPLFIVNVVVWVLVVILAIVALHCPLPRRVVR
Ga0268316_101517823300028253PhyllosphereLFSKTFSKDSVLHPTLLVDRVTRRKLRMTQDSDDLFVVNVVVWVLVVILAIVALHCPLPRRVVR
Ga0268316_101779613300028253PhyllosphereLPVDRVTRRKFRMAQDSDDPLFVVNVVVWVLVVILAIVALHYPLLRRVVR
Ga0268333_100269623300028467PhyllosphereVGVVGLAEYVCTHPILNLQRKIQTSFPKTLSRGSVLLPTLPVDRVTRRKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRRVVR
Ga0268309_100598123300028477PhyllospherePRTLSRGPVLHPTLPVDRVTRRKFRVAPDSDDLFIVNIVIWVLVVILAIVALHCPLLRRAVR
Ga0268309_101479123300028477PhyllosphereLSVDRVTRRKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRSVVR
Ga0268339_101013513300028526PhyllosphereCLWIRDTCRRFRMVQDSDDPLFVVNVVVWVLVVILAIVALHYPLLRRVVR
Ga0214493_113030523300032465Switchgrass PhyllosphereMHPTLLVDWVTRRKFRMAQDSDDPLFVVNIVVWVLVVILTIVALHCPLPRRVV
Ga0214493_116124813300032465Switchgrass PhyllospherePVDRVTRRKLRMAQDSDDLFVVNILVWVLVIILAIVALHCPLPRRVVR
Ga0214488_106977313300032467Switchgrass PhyllosphereMLSRGPVMHPTLLVDWVTRRKFRMAQDSDDPLFVVNIVVWVLVVILAIVA
Ga0214488_107547313300032467Switchgrass PhyllosphereVPVDRVTRRKSRMVQDSDDPLFVVNIVVWVLVVILAIVALHC
Ga0214491_108980813300032469Switchgrass PhyllosphereLPVDRVTRRKSRMVQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRR
Ga0214491_114715113300032469Switchgrass PhyllosphereKTLSRGPVLHPNLPVDRVTRMKFHMAQDSYDPLFVVNIVVWVLVVILAIVALHWPLTRRVVR
Ga0321339_111782213300032551Switchgrass PhyllosphereMHPTLLVDWVTRRKFRMAQDSDDPLFVVNIVVWVLVVILTIVALHCPLPRRVVR
Ga0321338_113026013300032593Switchgrass PhyllosphereMLSRGPVMHPTLLVDWVTRRKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRRIV
Ga0214501_128485013300032625Switchgrass PhyllosphereMYSPLSKFLQRKIQTSFPKTLNRGSVLHPTLHVDRVTRRKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLPRRVVR
Ga0214499_118638213300032697Switchgrass PhyllosphereVMHPTLLVDWVTRRKFRMAQDSDDPLFVVNIVVWVLVVILTIVALHCPLPRRVVR
Ga0314725_104565813300032789Switchgrass PhyllosphereLSRGPVLHPNLPVDRVTRMKFHMAQDSYDPLFVVNIVVWVLVVILAIVALHCPLPRRVVW
Ga0314744_104711213300032792Switchgrass PhyllosphereMDRVTRKKFRMAQDSDGPLFVVNIVVWVLVVILTIVALHCPLPH
Ga0314735_108408723300032824Switchgrass PhyllosphereMLSRGSVLHPTLPVDRVTRRKFRMAQDSDDLFVVNVVVWILVVILAIVALPWPLPRRVVR
Ga0314737_104326013300032875Switchgrass PhyllosphereRGSVLHPTLPVDRAIRREFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLSRRVVR
Ga0314751_100806713300032889Switchgrass PhyllosphereQTLFPRTLSKGSVLHPTLPVDRVTRRKFRMAQDSNDPLFVVNIVVWVLVVILAIVALHCPLPRRVVR
Ga0314739_105022813300032913Switchgrass PhyllosphereIQTSFPNTLSTGSVLHPALPVDRVTRRNFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCPLSRRVVQ
Ga0314750_114274613300032914Switchgrass PhyllosphereALPVVRVTRRKFRMAQDSDDPLFVVNVVVWVLVVILAIVALHCPLPRRVVR
Ga0314734_100880413300032916Switchgrass PhyllosphereTSFPKMLSRGPVMHPTLLVDWVTRRKFRMAQDSDDPLFVVNIVVWVLVVILTIVALHCPLPRRVVR
Ga0314741_103848413300032934Switchgrass PhyllospherePVDRVTRRKFRMAQDSDDPLFVVNIVVWVLVVILAIVALHCLLPRRVVR
Ga0314760_105102813300033530Switchgrass PhyllosphereMHPALPVDRVTRRKFRMAQDSDDPLFVVNVVVWVLVVILAIVALHCPLPRRVVR
Ga0314760_108814713300033530Switchgrass PhyllosphereMSSRGSVLHPTLPVDRVTRRSSVWRKTLKIFFVLHVLVWVVVVVLAIVALHYPLPCRVVR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.