Metagenome / Metatranscriptome Family F036991

Overview

Basic Information

• Family ID: F036991
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 169
• Average Sequence Length: 41 residues
• Representative Sequence: MSVARDMSGIVAHDLSGLEWSPMEVTDETDRDATGDPEDAI
• Number of Associated Samples: 126
• Number of Associated Scaffolds: 169

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 30.00 %
• % of genes near scaffold ends (potentially truncated): 70.41 %
• % of genes from short scaffolds (< 2000 bps): 76.92 %
• Associated GOLD sequencing projects: 109
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (73.373 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (10.059 % of family members)
• Environment Ontology (ENVO): Unclassified (22.485 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (40.237 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 0.00%
  Coil/Unstructured: 100.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 169 Family Scaffolds
PF13551	HTH_29	29.59
PF13518	HTH_28	11.83
PF13384	HTH_23	8.28
PF00582	Usp	2.37
PF00166	Cpn10	1.78
PF04014	MazE_antitoxin	1.78
PF00294	PfkB	1.18
PF05016	ParE_toxin	1.18
PF01475	FUR	1.18
PF00753	Lactamase_B	1.18

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 169 Family Scaffolds
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	1.78
COG1921	Seryl-tRNA(Sec) selenium transferase	Translation, ribosomal structure and biogenesis [J]	1.18
COG3547	Transposase	Mobilome: prophages, transposons [X]	1.18
COG0735	Fe2+ or Zn2+ uptake regulation protein Fur/Zur	Inorganic ion transport and metabolism [P]	1.18
COG2353	Polyisoprenoid-binding periplasmic protein YceI	General function prediction only [R]	0.59
COG1982	Arginine/lysine/ornithine decarboxylase	Amino acid transport and metabolism [E]	0.59
COG2003	DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif	Replication, recombination and repair [L]	0.59
COG2008	Threonine aldolase	Amino acid transport and metabolism [E]	0.59
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.59
COG2227	2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase	Coenzyme transport and metabolism [H]	0.59

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	75.74 %
Unclassified	root	N/A	24.26 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	75.74 %
Unclassified	root	N/A	24.26 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	73.37 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	2.37 %
Unclassified	root	N/A	24.26 %

Level 4

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.59 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.59 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2.37 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	39.05 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.59 %
Unclassified	root	N/A	24.26 %

Level 5

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.59 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.59 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	15.38 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	14.20 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.59 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	2.37 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.59 %
Unclassified	root	N/A	24.26 %

Level 6

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.59 %
Betaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis	4.14 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4.73 %
Candidatus Brocadiia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia	0.59 %
Candidatus Firestonebacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria	0.59 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	14.20 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	2.37 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	0.59 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.18 %
Unclassified	root	N/A	24.26 %

Level 7

Name	Rank	Taxonomy	Distribution
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	0.59 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	2.37 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Brocadiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales	0.59 %
Candidatus Desulfobacillus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	1.18 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.59 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	4.14 %
Syntrophorhabdales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales	0.59 %
Unclassified	root	N/A	24.26 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.18 %

Level 8

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Brocadiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Gallionella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella	1.18 %
Marinilabiliales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales	0.59 %
Methylobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter	0.59 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	2.37 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	4.14 %
Syntrophorhabdaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae	0.59 %
Unclassified	root	N/A	24.26 %
unclassified Desulfobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales	0.59 %

Level 9

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	2.37 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacteraceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae	0.59 %
Syntrophorhabdus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus	0.59 %
Syntrophus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus	1.18 %
Unclassified	root	N/A	24.26 %
unclassified Syntrophaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae	1.18 %

Level 10

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	2.37 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 11

Name	Rank	Taxonomy	Distribution
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	2.37 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 12

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	2.37 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 13

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	2.37 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 14

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	2.37 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 15

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	2.37 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 16

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	2.37 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 17

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	2.37 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 18

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	2.37 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 19

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	2.37 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 20

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Coleoptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera	2.37 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 21

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	2.37 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 22

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Cucujiformia	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia	2.37 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 23

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Curculionoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea	2.37 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 24

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Curculionidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae	2.37 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 25

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Entiminae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae	2.37 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 26

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Celeuthetini	tribe	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini	2.37 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Level 27

Name	Rank	Taxonomy	Distribution
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.59 %
Candidatus Desulfobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Desulfobacillus → Candidatus Desulfobacillus denitrificans	3.55 %
Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67	0.59 %
Candidatus Gallionella acididurans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans	1.18 %
Candidatus Jettenia caeni	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.18 %
Desulfobacterales bacterium S3730MH5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S3730MH5	0.59 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.59 %
Methylobacter luteus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter luteus	0.59 %
Prolixibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter	0.59 %
Syntrophaceae bacterium PtaB.Bin095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095	1.18 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.59 %
Syntrophus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus	2.37 %
Syntrophus aciditrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	0.59 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.59 %
Unclassified	root	N/A	24.26 %

Associated Scaffolds

Scaffold	Taxonomy	Length
(restricted) 3300013126|Ga0172367_10001721	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	31100
(restricted) 3300029286|Ga0247841_10093924	All Organisms → cellular organisms → Bacteria → Proteobacteria	2505
(restricted) 3300029286|Ga0247841_10202811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1456
2124908028|beta3_all_NODE_16084_len_921_cov_21_985886	Not Available	971
2124908028|beta3_all_NODE_217433_len_1607_cov_14_504045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	1657
2124908037|B3_GZBA_v_NODE_6702_len_1326_cov_15_801660	All Organisms → cellular organisms → Bacteria	1376
2140918024|NODE_432073_length_1718_cov_15.873108	All Organisms → cellular organisms → Bacteria	1768
3300000032|Draft_c0021311	All Organisms → cellular organisms → Bacteria	4153
3300000229|TB_LI09_3DRAFT_1027296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1451
3300000568|Draft_10031021	All Organisms → cellular organisms → Bacteria	1385

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Engineered	Engineered	13.02%
Environmental	Environmental	86.98%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	60.95%
Bioreactor	Engineered → Bioreactor	1.78%
Lab Enrichment	Engineered → Lab Enrichment	1.18%
Solid Waste	Engineered → Solid Waste	1.18%
Terrestrial	Environmental → Terrestrial	26.04%
Wastewater	Engineered → Wastewater	8.88%

Category

Habitat	Taxonomy	Distribution
Anaerobic	Engineered → Bioreactor → Anaerobic	1.18%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	7.10%
Defined Media	Engineered → Lab Enrichment → Defined Media	1.18%
Freshwater	Environmental → Aquatic → Freshwater	53.25%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	1.78%
Landfill	Engineered → Solid Waste → Landfill	1.18%
Marine	Environmental → Aquatic → Marine	3.55%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	2.96%
Peat	Environmental → Terrestrial → Peat	1.18%
Sediment	Environmental → Aquatic → Sediment	0.59%
Soil	Environmental → Terrestrial → Soil	24.85%
Unclassified	Environmental → Aquatic → Unclassified	0.59%
Unclassified	Engineered → Bioreactor → Unclassified	0.59%

Type

Habitat	Taxonomy	Distribution
Anaerobic Media	Engineered → Lab Enrichment → Defined Media → Anaerobic Media	1.18%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	8.88%
Ice	Environmental → Aquatic → Freshwater → Ice	0.59%
Lake	Environmental → Aquatic → Freshwater → Lake	25.44%
Lentic	Environmental → Aquatic → Freshwater → Lentic	4.14%
Loam	Environmental → Terrestrial → Soil → Loam	0.59%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	1.78%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	2.96%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.96%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	12.43%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	7.10%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.18%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	1.18%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	1.18%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.59%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.59%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.59%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	11.83%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	11.24%
Wetlands	Environmental → Aquatic → Marine → Wetlands	3.55%

Subtype

Habitat	Taxonomy	Distribution
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	8.88%
Cave Water	Environmental → Aquatic → Freshwater → Groundwater → Cave Water	0.59%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	4.14%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.59%
Glacier	Environmental → Aquatic → Freshwater → Ice → Glacier	0.59%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	11.83%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.78%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	14.79%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	3.55%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	1.78%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	10.65%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	10.06%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	7.10%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	4.14%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.96%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	2.96%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.37%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.78%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	1.78%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.18%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	1.18%
Unclassified	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified	1.18%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	1.18%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.59%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.59%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.59%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.59%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.59%

Habitat

Habitat	Taxonomy	Distribution
Activated Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge	1.18%
Anaerobic Digester Digestate	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate	0.59%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	5.92%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	9.47%
Basal Ice	Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice	0.59%
Beach Aquifer Porewater	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater	0.59%
Bioreactor	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Bioreactor	0.59%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.59%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	1.18%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.59%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	9.47%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.18%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.59%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	3.55%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.78%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.18%
Granular Sludge	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge	0.59%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	4.14%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	2.37%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	1.18%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater	0.59%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	1.78%
Hydrocarbon Resource Environments	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments	1.18%
Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment	4.73%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	1.18%
Marine Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment	0.59%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.78%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.59%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.59%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	8.28%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	1.18%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.18%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	2.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	10.06%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.59%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	6.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	2.37%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.59%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.59%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.59%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.78%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.18%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	1.18%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
2124908028	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3	Environmental
2124908037	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3	Environmental
2140918024	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all	Environmental
3300000032	Oil sands microbial community from Northern Alberta which degrade Naphthaline	Engineered
3300000229	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3	Environmental
3300000568	Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:	Engineered
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental
3300001380	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m	Environmental
3300001410	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012	Environmental
3300001428	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
beta3_all_01126770	2124908028	Soil	RMYGNLLEASKLSGFVAHKLSGLLWSPMEVTDETDGVVTGDPEDAI
beta3_all_01371860	2124908028	Soil	GASKLSGFVAHNLSGLLWSPLEVMDETDGDATGDPEDAI
B3_GZBA_v_00275340	2124908037	Soil	SEASNMSGIVARNLSGLIWSPMEVPDETDRDVTGDPGDAI
B_all_v_00317680	2140918024	Soil	LSGASKLSGFVAHNLSGLLWSPLEVMDETDGDATGDPEDAI
Draft_00213112	3300000032	Hydrocarbon Resource Environments	MSSTKKLSLLGARKLSGFVAHDLSGLLRSPLEVTDEADGDATGDPEDAI*
TB_LI09_3DRAFT_10272962	3300000229	Groundwater	LSVTRDMSGFVAHDLSGLLWSPKEVTDETGRDATGDPENAI*
Draft_100310212	3300000568	Hydrocarbon Resource Environments	LSITRDMSGFVTHDLSGIRYSLMEVADATDKDATGDPEDVI*
Draft_100494872	3300000568	Hydrocarbon Resource Environments	PVRQRDMNTMSVTHDMSGFVAHDMSGLLWSPLEVTGEADRDATGDSEDAI*
Draft_101655092	3300000568	Hydrocarbon Resource Environments	MVSVTHDMSGFVAHDMSGLLWSPLEVTGEADRDATGDSEDAI*
JGIcombinedJ13530_1063505941	3300001213	Wetland	MSRARKLSSIVARKLSGLLWSRMEVTDETDGDATGDPKDVI*
JGI1356J14229_100047805	3300001380	Groundwater	MLGARKLSGIVAHNLSGLRCRLEVTDEADRMATGDQEDAI*
JGI1356J14229_100512404	3300001380	Groundwater	MVKVNRHVLLGASKLSGIVAHYLSGLRCHEEVTNETVRIA
JGI20179J14886_10031712	3300001410	Arctic Peat Soil	LSVANDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDAI*
JGI20201J14949_10072962	3300001428	Arctic Peat Soil	VSEASNMSGIVARNLSGLIWSPMEVPDETDRDVTGDPGDAI*
JGI20197J15136_10052942	3300001453	Arctic Peat Soil	RYLCQGKIDCLSEASNMSGIVARNLSGLIWSPMEVPDETDRDVTGDPGDAI*
JGI24145J26757_100247111	3300002183	Arctic Peat Soil	RMSVANDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDAI*
NAPDCCLC_100396771	3300002446	Hydrocarbon Resource Environments	MSVTHDMSGLVAHHMSGFIWSPLEVINGTDRIATGDPEDAFE
JGI24132J36420_100425281	3300002538	Arctic Peat Soil	MVQMSVANDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDAI*
JGI24136J36422_100891341	3300002569	Arctic Peat Soil	MSVANDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDAI*
JGI11641J44799_100415952	3300002961	Wetland	LLRAHDMSGFVAHDLSGLGWSPMEVTDETDGVXTGDPEDEI*
Ga0052186_100914631	3300003154	Bioreactor	VSRAHDMSCYVAHKLSGFIRSLMEVIDETDRDATGDPEDAI*
Ga0031655_100774992	3300003852	Freshwater Lake Sediment	VSEASNMSGIVARNLSGLIWSPMEVADETDRDVTGAPEDAI*
Ga0031655_101529972	3300003852	Freshwater Lake Sediment	MSGARKLPGIVAHNLSGLLWSPLEMTDETDGDVTGDPGDAI*
Ga0031655_103690652	3300003852	Freshwater Lake Sediment	DCQSLFDIMLLTRDMSGFIARDLSGLLRSPMEVTDEADGGATGEPGDAI*
Ga0055471_102316612	3300003987	Natural And Restored Wetlands	SVASNMSGFVAHDLSGLLKSSLEVTDETDGDATGDPEDAI*
Ga0066631_101837281	3300004212	Groundwater	VSGARDMSGFVARNLSGLEWSPMEVTNEADRDATGDTEDAI*
Ga0066635_104016951	3300004238	Groundwater	MIVKANHQVSGARDMSGFVARNLSGLEWSPMEVTNEADRDATGDTEDAFEG
Ga0007798_100208371	3300004775	Freshwater	SLYQKSAQGAMIIIFLSEASKLSGFVAHNLSGLLRSPMEVTDETDRDATGDPEDAI*
Ga0068994_100148522	3300005216	Natural And Restored Wetlands	SEASKLSCIVAHKLSGLLWSPLEVTDETDRAITGAIEDAI*
Ga0074471_107409452	3300005831	Sediment (Intertidal)	IYHFVSVTSKLSGVVTSKLSGLRFHLEVRDEADRDTTGDPEDAI*
Ga0075276_100186611	3300005898	Rice Paddy Soil	QGLILLLSVASNMSGFVAHDLSGLLKSSLEVTDETDGDATGDPEDAI*
Ga0066797_12024621	3300006864	Soil	NDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDAI*
Ga0075524_100592223	3300006950	Arctic Peat Soil	SVANDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDAI*
Ga0105152_101276212	3300009039	Lake Sediment	DMSGIVAHNLSGLGWSPLEVTDETDGDATGEPEDAI*
Ga0105152_101342082	3300009039	Lake Sediment	MLVTNDMSGIVAHNLSGLGWSPLEVTDEMDRDATGDPEDAI*
Ga0105152_101887913	3300009039	Lake Sediment	MSVTNDMSGIVAHNLSGLVWSLLEVADEMDRDATGDPEDAIRGDVFWME*
Ga0105152_102091782	3300009039	Lake Sediment	VSVAHDMSGFVAHDLSGLRWSPMEVTDETDRDATG
Ga0105152_103510812	3300009039	Lake Sediment	LVAHDMSGFVAHDLSGLRWSPVEVTDETDGDTTGEPEDAI*
Ga0105152_103663102	3300009039	Lake Sediment	MLEASNMSGIVARNLSGLIWSPMEVADETDRDVTGDPEDAI*
Ga0105152_103849921	3300009039	Lake Sediment	MSGFVAHDLSGLRWSPMEVTDETDRDATGDPEDAI
Ga0102851_101989862	3300009091	Freshwater Wetlands	MYVKLVEGKMLEARKVSGFVAHNLSGLLWSPLEVTDEADGDATGDPEDAI*
Ga0115027_117601762	3300009131	Wetland	VSRVRDMSGFVARNLSGLLWSPLEVMDETDGDATGDPEDAI*
Ga0113563_114267442	3300009167	Freshwater Wetlands	QGILFRLSGASKLSGFVAHNLSGLLWSPLEVTDETDGDTTGDPEDAI*
Ga0105104_104731281	3300009168	Freshwater Sediment	HGANSVLGARKLSGFVAHDLSGLLRSPLEVTDEADGDATGDPENAI*
Ga0114951_100899332	3300009502	Freshwater	MSGIVAHNLSGLRCRREVTDEADRMAAGDPEDAI*
Ga0116128_10713732	3300009518	Peatland	MLEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDPEDAI*
Ga0129287_100981062	3300009538	Beach Aquifer Porewater	MSVARDMSGIVAHDLSGLEWSPMEVTDETDRDATGDPEDAI*
Ga0116147_12007212	3300009667	Anaerobic Digestor Sludge	SVTHDMSGFVAHHMSVFIRLPLEVIDGTDRDSTGDSEDAI*
Ga0116171_100644842	3300009692	Anaerobic Digestor Sludge	VCQEDNSLLSVTRKLSGIVAHNLSGLDSHRMEVTDAMDRDATGDPEDAI*
Ga0116162_104424321	3300009772	Anaerobic Digestor Sludge	LSETRVSVTRKLSGFVTRDLSGSGWPLLEVANETDKGVTGGLEDAI*
Ga0116248_102097652	3300010351	Anaerobic Digestor Sludge	MSVTHDMSGFVAHHMSVFIRLPLEVIDGTDRDSTGDSGDAI*
Ga0116236_102731581	3300010353	Anaerobic Digestor Sludge	GKGKIVEMSLTHDMSGFVAHHMSGLIRSPLEVIDGPDRIATGDTEDAI*
Ga0116236_102863691	3300010353	Anaerobic Digestor Sludge	SVTRKLSGFVTRDLSGLGWPLLEVADETDRGVTGDPEDAI*
Ga0116249_119698682	3300010357	Anaerobic Digestor Sludge	RCQISFSAMSVTHDMSGFVAHHMSVFIRLPLEVIDGTDRDSTGDSGDAI*
Ga0139299_11251632	3300011007	Basal Ice	MSGIVAQHLSGLRCYQEVTDETDGDTTGDPEDAI*
Ga0163202_10041831	3300013086	Freshwater	MSGIVAHDLSGLEWSPLEVTDETDRDATGDPEDAI
Ga0163202_10206641	3300013086	Freshwater	MFFIGMSVARDMSGIVAHDLSGLEWSPLEVTDETDRDATGDPEDA
Ga0163202_10618391	3300013086	Freshwater	MSGIVAHDLSGLDWSPLEVTDETDRDATGDPEDAI*
Ga0163202_11356971	3300013086	Freshwater	FWDTSGANDMSGFVAHDLSGLLWSPSEVTDETDGDATGDPEDAI*
Ga0163200_10313131	3300013088	Freshwater	MALSVTNDMSGFVAHNLSGLLWSPMEVTDETDGDTTGEPEDAI
Ga0163200_11573522	3300013088	Freshwater	YVRFVAHNLSGLLWSPTEVTDETDGDATGDPEDAI*
Ga0163199_11125172	3300013092	Freshwater	MGLDDFFLLVTNDMSGIVAQDLSGLGWSPLEVTDEMDRGATGDPEDAI*
(restricted) Ga0172367_1000172123	3300013126	Freshwater	MSCFVAHNLSGLYCCQEVTSEPDTMATGDQAYEIQ
Ga0181521_101327713	3300014158	Bog	LLEARNMSGIVARNLSGLIWSPMEVPDETDRVDAGDPEDAI*
Ga0172377_113336292	3300014206	Landfill Leachate	LLEARDMSGLVAHNLSGLRRGYREVTDETDRDTTGDSEDAI*
Ga0075319_10639382	3300014257	Natural And Restored Wetlands	MSVTRDMSGFVAHNLSGLGLSPLEVTDETDGDVTGDPEDAI*
Ga0182021_106957771	3300014502	Fen	MLEASKLSGFVAHKLSGLLWSPMGVTDDTDGVVTED
Ga0182021_126416433	3300014502	Fen	ENPLMLEASKLSGFVAHKLSGLLWSPMEVTEETDGVVTGDPEDAI*
Ga0180009_101079083	3300015370	Groundwater	SVTNDMSGIVAHNLSGLGWSLLEVADEMDRDATGDPEDAIRGDVFWME*
Ga0187849_10003401	3300017929	Peatland	MSGIVARNLSGLIWSPMEVPDETDGDVTGDPEDAI
Ga0187849_10007381	3300017929	Peatland	VSEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDPEDAI
Ga0187849_100251317	3300017929	Peatland	MLEASNLSGIVARNLSGLIWSPMEVSDETDRDVTGDPEDET
Ga0187849_10732103	3300017929	Peatland	LQYLLSYLLEASNMSGIVARNLSGLIWSPMEVPDETDGDVT
Ga0187877_10955913	3300017931	Peatland	VSEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDPEDA
Ga0187853_100925683	3300017940	Peatland	LQYLLSYLLEASNMSGIVARNLSGLIWSPMEVPDE
Ga0187850_101479062	3300017941	Peatland	MLEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDPEDAI
Ga0187850_103538681	3300017941	Peatland	LQYLLSYLLEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDPEDA
Ga0187870_100172721	3300017998	Peatland	MSEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDPE
Ga0187870_13051763	3300017998	Peatland	VLEARNMSGIVARNMSGLIWSPMEVADETDRDVTGDPE
Ga0187865_100433414	3300018004	Peatland	VSEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDPED
Ga0187873_13028012	3300018013	Peatland	LQYLLSYLLEASNMSGIVARNLSGLIWSPMEVPDETDGDV
Ga0187885_103311971	3300018025	Peatland	LQYLLSYLLEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDP
Ga0187858_101000624	3300018057	Peatland	VSEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDPE
Ga0180732_10498223	3300020171	Groundwater	MFGIVAHNLSGLGWSPLEVTDEMDRDATGDPEDAI
Ga0214071_11568553	3300020812	Anaerobic Digester Digestate	SRAQDMSAFVAHKLSGLKWSLMEVTDALDRDATGDSEDAI
Ga0214088_11944371	3300020814	Granular Sludge	MSAFVAHKLSGLKWSLMEVTDALDRDATGDSEDAI
Ga0212124_101237701	3300022553	Freshwater	SLLGASMLSGIVAHNLSGLRCRQEVTDETDRMATGDPEDAI
Ga0212124_101417041	3300022553	Freshwater	MFFIGMSVARDMSGIVAHDLSGLEWSPLEVTDETDRDATGDPEDAI
Ga0212124_105790241	3300022553	Freshwater	YVRFVAHNLSGLLWSPTEVTDETDGDATGDPEDAI
Ga0236337_11351892	3300022653	Freshwater	MSGIEARNLSGLIWSQLEVADETDGDVTGDPEDAI
Ga0208968_11088683	3300025111	Soil	MCFEKRQGENNXMLEASKLSGFIAHDLSGLIWSPMEVTDETDRVAAGDSEDAI
Ga0208046_10194852	3300025285	Freshwater	MFFIGMSVARDMSGIVAHDLSGLEWSPLEVTDETDRD
Ga0208045_10192992	3300025306	Freshwater	SNMSGIVARNLSGLIWSPMEVPDETDRDVTGDPEDAI
Ga0208566_10336661	3300025307	Freshwater	QHPFRFVLEASNMSGIVARNLSGLIWSPMEVPDETDRDVTGDPEDAI
Ga0207931_10155262	3300025499	Arctic Peat Soil	VCQEDFGHMSEASNMSGIVARNLSGLIWSPMEVPDETDRDVTGDPGDAI
Ga0207931_10868962	3300025499	Arctic Peat Soil	LSVANDMSGIVAHNLSGLLCSPLEVTDATDGDATGDPEDAI
Ga0208584_10085631	3300025533	Arctic Peat Soil	TRDMSSFVAHDLPGLRWSLMEVADATDRDAAGDTEDAI
Ga0208716_10047801	3300025548	Arctic Peat Soil	RSEASNMSGIVARNLSGLIWSPMEVPDETDRDVTGDPGDAI
Ga0210076_10404732	3300025567	Natural And Restored Wetlands	KIVDMVSGASKLSGFVAHNLSGLIRSPMEVTDETDGDATGDPEDAI
Ga0209386_10755082	3300025582	Arctic Peat Soil	MSVDDMSVIRDLSGFVAHNLSGLLKPPQEVADAKDGDSTGDPEDAI
Ga0209203_11416131	3300025702	Anaerobic Digestor Sludge	INGLGRIVSVTRKLSGFVTRDLSGLGWPLLEVADETDRGVTGDPEDAI
Ga0209746_11898331	3300025716	Arctic Peat Soil	LSVANDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDA
Ga0208457_10259382	3300025812	Peatland	LSYLLEASNMSGIVARNLSGLIWSPMEVPDETDGDVTGDPEDAI
Ga0209748_12500772	3300025836	Arctic Peat Soil	MQHDAIISLSVANDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDAI
Ga0209182_101277221	3300025843	Lake Sediment	MSGFVAHDLSGLRWSPVEVTDETDGDTTGEPEDAI
Ga0209538_13346121	3300025846	Arctic Peat Soil	SSASVKGKSLSVSVANDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDAI
Ga0209099_10885421	3300025858	Anaerobic Digestor Sludge	LLSRAHDMSAFVAHKLSGLKWSLMEVTDASDRDATGDTEDAI
Ga0209540_101369422	3300025888	Arctic Peat Soil	GPIFSLSVANDMSGIVAHNLSGLLWSPLEVTDATDGDATGDPEDAI
Ga0208773_10100062	3300026034	Rice Paddy Soil	SNMSGFVAHDLSGLLKSSLEVTDETDGDATGDPEDAI
Ga0209009_10682721	3300027667	Forest Soil	RLSGFVAHNLSGLLRSQSEVTDETDGDATGDPEDAI
Ga0209704_11112633	3300027693	Freshwater Sediment	MSQAQGMSGFVAHRLSGLRLSPMEVTDATDRATTGDPED
Ga0209593_102052382	3300027743	Freshwater Sediment	RKLLGARKLSGFVAHDLSGLLRSPLEVTDEADGDATGDPENAI
Ga0209514_1000022251	3300027819	Groundwater	MLGARKLSGIVAHNLSGLRCRLEVTDEADRMATGDQEDAI
Ga0209514_100217831	3300027819	Groundwater	LGASKLSGIVAHYLSGLRCHDEVTNETVRDATGDPEDAICR
Ga0209514_100585726	3300027819	Groundwater	LGASKLSGIVAHYLSGLRCHDEVTNETVRDATGDPEDAICRGI
Ga0209514_101344752	3300027819	Groundwater	LGASKLSGIVAHYLSGLRCHEEVTNETVRIAAGDPEDAICRGI
Ga0209514_101750713	3300027819	Groundwater	MLGASKLSGIVAHYLSGLRCHEEVTNETVRIAAGDPEDAICR
Ga0209397_107049301	3300027871	Wetland	GICYRLSRVRDMSGFVARNLSGLLWSPLEVMDETDGDATGDPEDAI
Ga0209777_100636934	3300027896	Freshwater Lake Sediment	LLVTRDMSGFVAHDLSGLGWSPLEVTDATDRDATGDPEDAI
Ga0209777_101540721	3300027896	Freshwater Lake Sediment	MSGFVAHKLTGLGYSPMEVNHEVDRAITGDLLKVRF
Ga0209777_106695672	3300027896	Freshwater Lake Sediment	MSGFVAQDLSGLRWSPLEVTDETDRDATGDPEDAI
Ga0265292_10482151	3300028028	Landfill Leachate	LPTAFPPLSVTRKLSGFVAHDLSGLLRSSMEVTDETDGDATGDPEDAI
Ga0265296_10017461	3300028032	Groundwater	LVTNDMSGIVAHNLSGLGWSPLEVTNEMDRGARGDPEDAI
Ga0265296_13245831	3300028032	Groundwater	MRDMSSFVAHDLSGLRLSLMEVADATDRDATEDPEDAI
Ga0268284_10188163	3300028176	Saline Water	MSEARKLSGFIAHDLSGLIWSPMEVTDETDRVVAG
Ga0268284_10190041	3300028176	Saline Water	VSEARKLSGFIAHDLSGLIWSPMEVTDETDRVVAGD
Ga0268283_11355812	3300028283	Saline Water	LSEARKLSGFIAHDLSGLIWSPMEVTDETDRVVAGDS
Ga0268280_10111375	3300028298	Saline Water	MSEARKLSGFIAHDLSGLIWSPMEVTDETDRVVAGDSE
Ga0268280_10373012	3300028298	Saline Water	LSGVVAHNLSGLVWPPLEVADETDRVATGDPEDAI
Ga0302253_10019071	3300028622	Activated Sludge	MSVTRKLSGIVAHNLSGLDSHRMEVTDAMDRDATGDPEDAI
Ga0302253_10238632	3300028622	Activated Sludge	SVTRKLSGIVAHNLSGLDSHRMEVTDAMDRDATGDPEDAI
(restricted) Ga0247841_100939241	3300029286	Freshwater	GNGKKHSFFMSEASKLSGFVARNLSGLIGSPMEVTDETDRVATGDPEDAI
(restricted) Ga0247841_102028111	3300029286	Freshwater	QSVRFVAHNLSGLLWSPLEVADETDGDATGDPEDAI
Ga0307371_1372192	3300029601	Anaerobic Digestor Sludge	MAVSVTRKLSGIVAHNLSGLDSHRMEVTDEMDRDATGDPEDAI
Ga0272442_100537752	3300030616	Marine Sediment	MWILCGLSLARNMSGLVAHNLSGLRKGHQEVIHEMDRATTGDQDHAI
Ga0315291_112383521	3300031707	Sediment	MSVTNDMSGFIAHNLSGLVGSPLEVTNETDRDATGEP
Ga0315293_102905892	3300031746	Sediment	MLVAHDMSGFVARDLSGLRWSPMEVTDETDRDATGDPEDAI
Ga0315288_101311301	3300031772	Sediment	MSVTNDMSGFIAHNLSGLVGSPLEVTNETDRDATGEPEDAIR
Ga0315288_114598762	3300031772	Sediment	VSVAHDMSGFVAHDLSGLRWSPMEVTDETDRDATGDTEDAI
Ga0315290_102986452	3300031834	Sediment	ETLLEASNMSGIVARNLSGLIWSPMEVPDETDRDVTGDPEDAI
Ga0315297_100198061	3300031873	Sediment	MSGFIAHNLSGLVGSPLEVTNETDRDATGEPEDAI
Ga0315285_101569571	3300031885	Sediment	NDMSGIVAHNLSGLGWSPLEVTDEMDRDATGDPEDAI
Ga0214473_115818822	3300031949	Soil	MSGSVAHDLSGLLKSPLEVTDATDGDATGDPEDAI
Ga0315294_100944604	3300031952	Sediment	VALLEASNMSGIVARNLSGLIWSPMEVPDETDRDV
Ga0315294_114104441	3300031952	Sediment	VLATNFVLEASNLSGIVARNLSGLIWSPLEVPDETDRDV
Ga0315278_102295614	3300031997	Sediment	MLEASNMSGIVARNLSGLIWSPMEVADETDRDVTGDPEDAI
Ga0315289_1000689020	3300032046	Sediment	MSEASKVSGFVARNLSGLIWSPLEVPDETDRDVTGDP
Ga0315277_104025702	3300032118	Sediment	DMSGIVAHNLSGLRCHREVTDETDRIDTGDPEDAI
Ga0315268_126964691	3300032173	Sediment	SEASKLSGFVAHNLSGLLRSPSEVTDETDGDATGDPEDAI
Ga0315276_103884603	3300032177	Sediment	VTRDMSGFVAHNLSGLLRSPMEVTDETDGDATGDPEDAI
Ga0315276_117665131	3300032177	Sediment	YDRFIAHNLSGLLWSPMEVTDETDGDATGEPEDAI
Ga0315273_117231532	3300032516	Sediment	MQLLEASNMSGIVARNLSGLIWSPMEVSNETDRDVTGDPEDAI
Ga0334722_111024451	3300033233	Sediment	DLVLQLLGARDMSGIVAHNLSGLRCRREVTDETDRMATGDPENAI
Ga0316605_103690112	3300033408	Soil	MSRVRDMSGFVARNLSGLLWSPLEVMDETDGDATGDPEDAI
Ga0316625_1026158682	3300033418	Soil	KRKGEKMSVTNDMSGFVAHNLSGLRWSPMEVTDEADRDATGDPEDAI
Ga0326726_120789761	3300033433	Peat Soil	MSGLVAHKLSGLKLPFMEVTDETDGDVTGDPEDAI
Ga0316627_1019355361	3300033482	Soil	RDMSGIVAHNLSGLRCHQEVTNETDRMATGDQEDAI
Ga0316624_100041435	3300033486	Soil	MSRHPGKIVTRDMSGFVAHDLSSLRWSLMEVADETDRDATGDPEDTI
Ga0316624_105765022	3300033486	Soil	SRKTRHLLVAHDMSGFVAHDLSGLRWSPMEVTDETDRDTTGEPEDAI
Ga0316621_102469941	3300033488	Soil	YVRFIAHNLSGLLWSPTEVTDETDGDTTGDPDDAI
Ga0316621_103505411	3300033488	Soil	YVRFVAHNLSGLLRSPTEVTDETDGDATGDPEDAI
Ga0316628_1003038593	3300033513	Soil	MSGFVAHDLSSLRWSLMEVADETDRDATGDPEDTI
Ga0316616_1003818341	3300033521	Soil	LLRARDMSGFVAHDLSGLGWSPMEVTDETDGVVTGDPEDEI
Ga0316617_1010764632	3300033557	Soil	KRGKVSGASKLSGFVAHSLSGLLWSPLEVADETDGDTTGDPEDAI
Ga0316617_1012908342	3300033557	Soil	MSGFVAHDLSGLLRSPQEVTDEADGDATGDPEDAI
Ga0334848_077016_431_556	3300033827	Soil	MSVTNDMSGFVAHNLSGLLWSPVEVTDETDRDATGDPGDAI
Ga0370479_0029417_3_161	3300034123	Untreated Peat Soil	LYKELSSEIFRVSVTHDMSGFVAHNLSGLRWSPLEVTDETDGGMAGEPEDAI
Ga0370507_0158907_107_214	3300034158	Untreated Peat Soil	MSSFVAHDLSGLRWSLMTVADATDRDATGDPEDAI
Ga0370480_0171442_603_737	3300034169	Untreated Peat Soil	IEEVSVTNDMSGFVAHNLSGLRWSPMEVMDEADRDATGDPEDAI