Basic Information | |
---|---|
Family ID | F036957 |
Family Type | Metagenome |
Number of Sequences | 169 |
Average Sequence Length | 43 residues |
Representative Sequence | MLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERAVA |
Number of Associated Samples | 131 |
Number of Associated Scaffolds | 169 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 84.34 % |
% of genes near scaffold ends (potentially truncated) | 92.90 % |
% of genes from short scaffolds (< 2000 bps) | 89.35 % |
Associated GOLD sequencing projects | 123 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.089 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.059 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.077 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.379 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 169 Family Scaffolds |
---|---|---|
PF14023 | DUF4239 | 11.24 |
PF17201 | Cache_3-Cache_2 | 7.10 |
PF06983 | 3-dmu-9_3-mt | 6.51 |
PF07366 | SnoaL | 3.55 |
PF00583 | Acetyltransf_1 | 2.37 |
PF16694 | Cytochrome_P460 | 2.37 |
PF00903 | Glyoxalase | 1.78 |
PF00248 | Aldo_ket_red | 1.78 |
PF12681 | Glyoxalase_2 | 1.78 |
PF00724 | Oxidored_FMN | 1.78 |
PF17200 | sCache_2 | 1.78 |
PF01546 | Peptidase_M20 | 1.18 |
PF00226 | DnaJ | 1.18 |
PF09351 | DUF1993 | 1.18 |
PF00199 | Catalase | 1.18 |
PF03350 | UPF0114 | 0.59 |
PF11755 | DUF3311 | 0.59 |
PF08240 | ADH_N | 0.59 |
PF14248 | DUF4345 | 0.59 |
PF07883 | Cupin_2 | 0.59 |
PF00551 | Formyl_trans_N | 0.59 |
PF13407 | Peripla_BP_4 | 0.59 |
PF02517 | Rce1-like | 0.59 |
PF02634 | FdhD-NarQ | 0.59 |
PF13360 | PQQ_2 | 0.59 |
PF07486 | Hydrolase_2 | 0.59 |
PF13302 | Acetyltransf_3 | 0.59 |
PF03601 | Cons_hypoth698 | 0.59 |
PF00027 | cNMP_binding | 0.59 |
PF07509 | DUF1523 | 0.59 |
PF00107 | ADH_zinc_N | 0.59 |
PF13376 | OmdA | 0.59 |
PF00581 | Rhodanese | 0.59 |
PF00106 | adh_short | 0.59 |
PF02203 | TarH | 0.59 |
COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
---|---|---|---|
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 6.51 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 6.51 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.78 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 1.78 |
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 1.18 |
COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.18 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.59 |
COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 0.59 |
COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.59 |
COG2862 | Uncharacterized membrane protein YqhA | Function unknown [S] | 0.59 |
COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.59 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.27 % |
Unclassified | root | N/A | 33.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_105600306 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
3300000787|JGI11643J11755_11391875 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300000891|JGI10214J12806_10182251 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300000955|JGI1027J12803_100634090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1627 | Open in IMG/M |
3300000955|JGI1027J12803_100878886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2211 | Open in IMG/M |
3300000956|JGI10216J12902_115475003 | Not Available | 674 | Open in IMG/M |
3300002239|JGI24034J26672_10105140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
3300004157|Ga0062590_102461421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 551 | Open in IMG/M |
3300004463|Ga0063356_104357733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300004479|Ga0062595_102584029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300004480|Ga0062592_100141428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1591 | Open in IMG/M |
3300004480|Ga0062592_102718786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 501 | Open in IMG/M |
3300005332|Ga0066388_103000685 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300005332|Ga0066388_105246197 | Not Available | 657 | Open in IMG/M |
3300005332|Ga0066388_105454281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
3300005332|Ga0066388_105980552 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005332|Ga0066388_107998956 | Not Available | 529 | Open in IMG/M |
3300005332|Ga0066388_108640251 | Not Available | 506 | Open in IMG/M |
3300005343|Ga0070687_100038827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2388 | Open in IMG/M |
3300005365|Ga0070688_100337426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
3300005365|Ga0070688_100596697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 845 | Open in IMG/M |
3300005434|Ga0070709_10032755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3136 | Open in IMG/M |
3300005436|Ga0070713_101215231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
3300005439|Ga0070711_100168691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1666 | Open in IMG/M |
3300005439|Ga0070711_101534447 | Not Available | 582 | Open in IMG/M |
3300005455|Ga0070663_100368653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1167 | Open in IMG/M |
3300005546|Ga0070696_100850907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
3300005547|Ga0070693_100415068 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300005563|Ga0068855_100513692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1300 | Open in IMG/M |
3300005564|Ga0070664_101180940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
3300005564|Ga0070664_101699538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
3300005577|Ga0068857_101403843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
3300005719|Ga0068861_100016959 | Not Available | 5164 | Open in IMG/M |
3300005764|Ga0066903_101174643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1422 | Open in IMG/M |
3300005834|Ga0068851_10305282 | Not Available | 916 | Open in IMG/M |
3300005843|Ga0068860_101319175 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300005844|Ga0068862_100191249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1842 | Open in IMG/M |
3300006050|Ga0075028_101070423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
3300006163|Ga0070715_10014379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2930 | Open in IMG/M |
3300006172|Ga0075018_10558477 | Not Available | 604 | Open in IMG/M |
3300006196|Ga0075422_10581562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
3300006354|Ga0075021_10757458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
3300006844|Ga0075428_101672371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
3300006845|Ga0075421_102712175 | Not Available | 512 | Open in IMG/M |
3300006852|Ga0075433_10423732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
3300006852|Ga0075433_11855614 | Not Available | 518 | Open in IMG/M |
3300006852|Ga0075433_11901697 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 510 | Open in IMG/M |
3300006853|Ga0075420_101333368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
3300006854|Ga0075425_101759065 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300006871|Ga0075434_102155533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
3300006880|Ga0075429_100534061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
3300006880|Ga0075429_101955968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 508 | Open in IMG/M |
3300006904|Ga0075424_102165338 | Not Available | 585 | Open in IMG/M |
3300006904|Ga0075424_102717269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
3300009092|Ga0105250_10433289 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300009098|Ga0105245_12999230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 523 | Open in IMG/M |
3300009100|Ga0075418_13081590 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300009147|Ga0114129_11004155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
3300009147|Ga0114129_12235406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 658 | Open in IMG/M |
3300009162|Ga0075423_11244690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
3300009545|Ga0105237_10192843 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
3300009545|Ga0105237_11575863 | Not Available | 664 | Open in IMG/M |
3300009678|Ga0105252_10366142 | Not Available | 656 | Open in IMG/M |
3300010046|Ga0126384_10027793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3725 | Open in IMG/M |
3300010046|Ga0126384_10712191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 890 | Open in IMG/M |
3300010046|Ga0126384_11915759 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300010047|Ga0126382_10254172 | Not Available | 1290 | Open in IMG/M |
3300010047|Ga0126382_11046609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 719 | Open in IMG/M |
3300010048|Ga0126373_11287688 | Not Available | 797 | Open in IMG/M |
3300010358|Ga0126370_10366735 | Not Available | 1170 | Open in IMG/M |
3300010358|Ga0126370_12426429 | Not Available | 521 | Open in IMG/M |
3300010359|Ga0126376_10474040 | Not Available | 1151 | Open in IMG/M |
3300010362|Ga0126377_13139946 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010366|Ga0126379_11273730 | Not Available | 841 | Open in IMG/M |
3300010371|Ga0134125_11769995 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300010373|Ga0134128_10094005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3410 | Open in IMG/M |
3300010373|Ga0134128_10578697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1250 | Open in IMG/M |
3300010373|Ga0134128_11289068 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300010373|Ga0134128_12383936 | Not Available | 583 | Open in IMG/M |
3300010398|Ga0126383_11581839 | Not Available | 745 | Open in IMG/M |
3300010403|Ga0134123_10086266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2461 | Open in IMG/M |
3300010403|Ga0134123_11095726 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300010403|Ga0134123_12393761 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300011406|Ga0137454_1030031 | Not Available | 788 | Open in IMG/M |
3300012494|Ga0157341_1020613 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300012505|Ga0157339_1052739 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 543 | Open in IMG/M |
3300012507|Ga0157342_1015089 | Not Available | 842 | Open in IMG/M |
3300012507|Ga0157342_1085090 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012519|Ga0157352_1059852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 590 | Open in IMG/M |
3300012896|Ga0157303_10205393 | Not Available | 571 | Open in IMG/M |
3300012897|Ga0157285_10008895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1917 | Open in IMG/M |
3300012897|Ga0157285_10023380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
3300012898|Ga0157293_10150419 | Not Available | 657 | Open in IMG/M |
3300012901|Ga0157288_10266946 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300012911|Ga0157301_10020010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1467 | Open in IMG/M |
3300012951|Ga0164300_10067596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1473 | Open in IMG/M |
3300012955|Ga0164298_10667048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
3300012955|Ga0164298_10733657 | Not Available | 698 | Open in IMG/M |
3300012957|Ga0164303_10817444 | Not Available | 643 | Open in IMG/M |
3300012957|Ga0164303_10846085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
3300012960|Ga0164301_10020599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2944 | Open in IMG/M |
3300012961|Ga0164302_10002018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 6647 | Open in IMG/M |
3300012961|Ga0164302_10315371 | Not Available | 1028 | Open in IMG/M |
3300012971|Ga0126369_10839348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
3300012986|Ga0164304_11825798 | Not Available | 509 | Open in IMG/M |
3300013307|Ga0157372_11272193 | Not Available | 849 | Open in IMG/M |
3300015371|Ga0132258_12438109 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300015372|Ga0132256_101833222 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300015372|Ga0132256_102636296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 603 | Open in IMG/M |
3300016319|Ga0182033_11966461 | Not Available | 532 | Open in IMG/M |
3300016341|Ga0182035_11111549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 704 | Open in IMG/M |
3300018052|Ga0184638_1216930 | Not Available | 669 | Open in IMG/M |
3300018053|Ga0184626_10441116 | Not Available | 514 | Open in IMG/M |
3300018061|Ga0184619_10331289 | Not Available | 695 | Open in IMG/M |
3300018064|Ga0187773_11052535 | Not Available | 537 | Open in IMG/M |
3300018481|Ga0190271_10107782 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
3300018481|Ga0190271_11743969 | Not Available | 735 | Open in IMG/M |
3300021478|Ga0210402_10899285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 812 | Open in IMG/M |
3300021478|Ga0210402_10959351 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300021478|Ga0210402_11980831 | Not Available | 508 | Open in IMG/M |
3300021560|Ga0126371_12778815 | Not Available | 593 | Open in IMG/M |
3300021560|Ga0126371_13535283 | Not Available | 527 | Open in IMG/M |
3300022694|Ga0222623_10381583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
3300025735|Ga0207713_1139107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
3300025900|Ga0207710_10027867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2450 | Open in IMG/M |
3300025905|Ga0207685_10084010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1325 | Open in IMG/M |
3300025912|Ga0207707_10454264 | Not Available | 1096 | Open in IMG/M |
3300025916|Ga0207663_10261874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
3300025916|Ga0207663_10319013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1167 | Open in IMG/M |
3300025917|Ga0207660_10543440 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300025920|Ga0207649_11451111 | Not Available | 543 | Open in IMG/M |
3300025924|Ga0207694_10993050 | Not Available | 710 | Open in IMG/M |
3300025926|Ga0207659_10394696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1156 | Open in IMG/M |
3300025927|Ga0207687_10546584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. AP50 | 971 | Open in IMG/M |
3300025939|Ga0207665_10387311 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1062 | Open in IMG/M |
3300025942|Ga0207689_11342714 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300025945|Ga0207679_12048754 | Not Available | 520 | Open in IMG/M |
3300025957|Ga0210089_1011392 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300025986|Ga0207658_10188239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1713 | Open in IMG/M |
3300026023|Ga0207677_11365724 | Not Available | 652 | Open in IMG/M |
3300026116|Ga0207674_11253776 | Not Available | 711 | Open in IMG/M |
3300026118|Ga0207675_100014220 | All Organisms → cellular organisms → Bacteria | 7419 | Open in IMG/M |
3300026118|Ga0207675_101868898 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300026118|Ga0207675_102072788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 586 | Open in IMG/M |
3300027360|Ga0209969_1029898 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300027401|Ga0208637_1044596 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300027911|Ga0209698_10223185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1515 | Open in IMG/M |
3300028608|Ga0247819_10136149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1269 | Open in IMG/M |
3300031521|Ga0311364_10792704 | Not Available | 951 | Open in IMG/M |
3300031547|Ga0310887_10974392 | Not Available | 540 | Open in IMG/M |
3300031858|Ga0310892_11005476 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300031892|Ga0310893_10285419 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300031908|Ga0310900_11164123 | Not Available | 640 | Open in IMG/M |
3300031912|Ga0306921_11371150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 779 | Open in IMG/M |
3300031941|Ga0310912_11479655 | Not Available | 512 | Open in IMG/M |
3300031942|Ga0310916_11574707 | Not Available | 534 | Open in IMG/M |
3300031943|Ga0310885_10413844 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300031944|Ga0310884_10728343 | Not Available | 602 | Open in IMG/M |
3300032075|Ga0310890_10757235 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300032122|Ga0310895_10069902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1349 | Open in IMG/M |
3300032174|Ga0307470_10153521 | Not Available | 1411 | Open in IMG/M |
3300032205|Ga0307472_101295036 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 701 | Open in IMG/M |
3300032211|Ga0310896_10286263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 847 | Open in IMG/M |
3300032261|Ga0306920_103590996 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300033289|Ga0310914_10125250 | Not Available | 2241 | Open in IMG/M |
3300033551|Ga0247830_11479705 | Not Available | 543 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.06% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.51% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.37% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.37% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.37% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.78% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.78% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.18% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.18% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.18% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.18% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.18% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.59% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.59% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1056003062 | 3300000364 | Soil | MLRNLISVIGHALILAISTTASVWAADFGTAEEAK |
JGI11643J11755_113918752 | 3300000787 | Soil | MLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAKPC |
JGI10214J12806_101822511 | 3300000891 | Soil | MLRNLISVIGHALILAISTTASVWAADFGTAEEAKAM |
JGI1027J12803_1006340903 | 3300000955 | Soil | MLRNLAFVVSFAVFQVLSTTAPVCAAEFGTAEEAKAMLERAVA |
JGI1027J12803_1008788861 | 3300000955 | Soil | MLRNLVSVIGHALILVLSTTASVWAADFGTAEEAKAML |
JGI10216J12902_1154750031 | 3300000956 | Soil | MLRNLAFVAGYAVITTASVWAADFGTAEEAKAMLERAV |
JGI24034J26672_101051401 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAKAMLEKAVA |
Ga0062590_1024614211 | 3300004157 | Soil | MLRNLAFVVGYALILVLSNTASVWAADFGTAEEAKAMLERAVAAVKEDKA |
Ga0063356_1043577332 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLRNLAFVVGYALILVLSNTASVWAADFGTAEEAKAMLERAVAAVKEDK |
Ga0062595_1025840291 | 3300004479 | Soil | MLRNRAFAFGCAVSLIIFCTAASFAAADFGTPEEAKAMLEKAVA |
Ga0062592_1001414283 | 3300004480 | Soil | MIRKLAFVVGYAVFQLLSTTASVWAAEFGTAEEAKSMLERAVAAV |
Ga0062592_1027187861 | 3300004480 | Soil | MLRTLALVVGYAVIQVLFTTSSVWAADFGTAEEAKAMLERAVA |
Ga0068999_100770571 | 3300005205 | Natural And Restored Wetlands | MLRNLAFVVGYAAALVLFTTGSSVPAAQYGTAEEAKAMLDRAVDAVKEDKTKA |
Ga0068996_101369551 | 3300005218 | Natural And Restored Wetlands | MLRNLAFVVGYAAALVLFTTGSSVPAAQYGTAEEAKAMLDRAVDAVKEDKTKALDRRL* |
Ga0066388_1030006851 | 3300005332 | Tropical Forest Soil | MFRNLTFVVGYAVIQLLFTTASVWASNWGTAEEAKAMLEK |
Ga0066388_1052461972 | 3300005332 | Tropical Forest Soil | MTRKLAFVVAYAVILVSSTLTLVAAADFGTPEEAKAMLERAV |
Ga0066388_1054542811 | 3300005332 | Tropical Forest Soil | MIRNLAFVVGYAAILVLSTTASVWAADFGTAEEAKAMLERAVAA |
Ga0066388_1059805521 | 3300005332 | Tropical Forest Soil | MIRNLAFVGFALILVLSTARLVGAVEFGTAAEAKAMLERAVAAVKEDKA |
Ga0066388_1079989563 | 3300005332 | Tropical Forest Soil | MLRNLAFVVGYAVILVLSTAASVAAAEFGTAEEAKAMLERA |
Ga0066388_1086402511 | 3300005332 | Tropical Forest Soil | MAAQWRLVMLRNLAFVAGYAVIQLLFTTASVWATDFGTPEEAKAMLE |
Ga0070687_1000388275 | 3300005343 | Switchgrass Rhizosphere | MLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAVAAVKE |
Ga0070688_1003374262 | 3300005365 | Switchgrass Rhizosphere | LIYAIVFAVGCAVSLIVVCTAASLAAADFGTPEEAKAMLEKAVAAVKQDKA |
Ga0070688_1005966971 | 3300005365 | Switchgrass Rhizosphere | MSRNLGFVVSFALILVLSTTASVWGADFGTAEEAKAMLERAVAAVKEDKAK |
Ga0070709_100327551 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAKA |
Ga0070713_1012152311 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAKA |
Ga0070711_1001686913 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAK |
Ga0070711_1015344472 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRNLAFVVGYAVIQVLSATALVWAADFGTAEEAKAMLERAVAAVKEDKAK |
Ga0070663_1003686531 | 3300005455 | Corn Rhizosphere | MLRNLAFAVGCAVSLIVLSTAASLAAADFGTPEEAKAMLEKAVAAV |
Ga0070696_1008509072 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRNIAFVVGFAVIQVLSTAASVAAADFGTAEEAKAMLERAVA |
Ga0070693_1004150681 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRNLAFVISYAVIQVLFTTSSVWAADFGTPEEAKAMLERAV |
Ga0068855_1005136921 | 3300005563 | Corn Rhizosphere | MLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAML |
Ga0070664_1011809402 | 3300005564 | Corn Rhizosphere | MLRNLAFAVGCAVSLIVLSTAASLAAADFGTPEEAKAMLEKAVAAVK |
Ga0070664_1016995381 | 3300005564 | Corn Rhizosphere | MPRNPASVIGHALILVLSTAASAWAAEFGTAEEAKAMLERAVAAV |
Ga0068857_1014038431 | 3300005577 | Corn Rhizosphere | MLRHLALVVGYAVALACVTAAPVPAAQFGTPEEAKAMLE |
Ga0068861_1000169591 | 3300005719 | Switchgrass Rhizosphere | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKED |
Ga0066903_1011746431 | 3300005764 | Tropical Forest Soil | MMRKLAFAVTGYAVITTASAWAADFGTAEEAKAMLERAVAAVKE |
Ga0068851_103052822 | 3300005834 | Corn Rhizosphere | MLRNLAFAVGCAVSLIVVCMAASWAAADFGTPEEAKAMLEK |
Ga0068860_1013191751 | 3300005843 | Switchgrass Rhizosphere | MLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAM |
Ga0068862_1001912493 | 3300005844 | Switchgrass Rhizosphere | MLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAML |
Ga0075028_1010704232 | 3300006050 | Watersheds | MLRNLVFVVGYAVILVLSTTASVWAADFGTAEEAKAMLERAVA |
Ga0070715_100143795 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRNLAFVISYAVIQVLFTTSSVWAADFGTPEEAKAMLER |
Ga0075018_105584773 | 3300006172 | Watersheds | MLRNIAFVVCFALIQVFSTAAFAADFGTAEEAKAMLEK |
Ga0075422_105815622 | 3300006196 | Populus Rhizosphere | MLRNLAFVVGYAVIQVLCTTASVWAADFGTAEEAKAMLEKA |
Ga0097621_1021990302 | 3300006237 | Miscanthus Rhizosphere | MKLVMLRNLTFLFGYAAVLVLLTAGSVQAAQYGTGEEAKAMLERAV |
Ga0075021_107574582 | 3300006354 | Watersheds | WRLVMLRNLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLEKQWPR* |
Ga0075428_1016723713 | 3300006844 | Populus Rhizosphere | MLRHLAFVGCAVIQILSTAAPLPAAQFGTAEEAKAMLER |
Ga0075421_1027121751 | 3300006845 | Populus Rhizosphere | MLRNLAFVVGYGVIQVLSTATLVWAGDFGTAEQAKAMLER |
Ga0075433_104237324 | 3300006852 | Populus Rhizosphere | MLRNLAFVVFVVFYLLATSAWAAEFGTAEEAKAMLERAVA |
Ga0075433_118556142 | 3300006852 | Populus Rhizosphere | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEA |
Ga0075433_119016972 | 3300006852 | Populus Rhizosphere | MSRNLGFVVSFALILVLSTTASIWAAEFGTAEEAK |
Ga0075420_1013333682 | 3300006853 | Populus Rhizosphere | MLRNLVFVAGYAVITAASVWAADFGTAEEAKAMLERA |
Ga0075425_1017590652 | 3300006854 | Populus Rhizosphere | MLRNLAFVISYAVIQVLFTTSSVWAADFGTAEEAKAMLER |
Ga0075434_1021555331 | 3300006871 | Populus Rhizosphere | MLRNLVFVAGYAVITAASVWAADFGTAEEAKAMLERAVTAVK |
Ga0075429_1005340612 | 3300006880 | Populus Rhizosphere | MLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAK |
Ga0075429_1019559681 | 3300006880 | Populus Rhizosphere | MLRNLAFVVGYALILVLSNTASVWAADFGTAEEAKAMLERAVAAV |
Ga0075424_1021653382 | 3300006904 | Populus Rhizosphere | MLRHLAFVGCAVIQILSTAAPLPAAQFGTAEEAKA |
Ga0075424_1027172692 | 3300006904 | Populus Rhizosphere | MLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAV |
Ga0105250_104332892 | 3300009092 | Switchgrass Rhizosphere | MLRNLAFVISYAVIQVLFSTSSGWAADFGTAEEAKGMLERAV |
Ga0105245_129992302 | 3300009098 | Miscanthus Rhizosphere | MLRNLAFVVGYAVILVSSTVTLVEAADFGTPEEAKAMLERAVTAVKEDKA* |
Ga0075418_130815901 | 3300009100 | Populus Rhizosphere | LEEVMIRKLAFVVGYAVFQLLSTTASVWAAEFGTAEEAKS |
Ga0114129_110041552 | 3300009147 | Populus Rhizosphere | MLRNLALVVGYAVILVLSTVASVAAADFGTPEEAKANA* |
Ga0114129_122354061 | 3300009147 | Populus Rhizosphere | MPRNPASVIGHALILVLSTAASAWAAEFGTAEEAKAMLERA |
Ga0075423_112446901 | 3300009162 | Populus Rhizosphere | MEEAMIRNLAFIVSFALIMVLSTTVLLWASEFGTAEEAKAMLERAVAAVKEDK |
Ga0105237_101928434 | 3300009545 | Corn Rhizosphere | MLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERA |
Ga0105237_115758632 | 3300009545 | Corn Rhizosphere | MLRNLAFAVGCAVSLIVLCTAASWAAADFGTPEEAKAMLEKAAAAVKQDK |
Ga0105252_103661422 | 3300009678 | Soil | MLRSFAFVVGFAAFLVLSTTASVWAAEYGTADEAKAMLERAVAAVKEDK |
Ga0126384_100277931 | 3300010046 | Tropical Forest Soil | MMRKLAFVVGYAVIQVLSSPALFAAAEFGTAEEAKAMLER |
Ga0126384_107121911 | 3300010046 | Tropical Forest Soil | MLRTLSFVVGYAVILVLSTAASVAAVNFGTPEEAKAML |
Ga0126384_119157592 | 3300010046 | Tropical Forest Soil | MSRNLAFVISYAVIQVLFTTASIWAGNFGTPEEAKAMLE |
Ga0126382_102541722 | 3300010047 | Tropical Forest Soil | MLRNLAFVIAYAVIQVLSTTASVCAADFGTAQEAKAMLERAVATVKEDK |
Ga0126382_110466092 | 3300010047 | Tropical Forest Soil | MLRNLAFLIGRALILVLSTTASVWAAEYGTADEAKAMLERAVA |
Ga0126373_112876882 | 3300010048 | Tropical Forest Soil | MEEVMIRKLAFVVGYAVIQVLSNPTSVAAAEFGTAEEAKAMLERAVAAVKE |
Ga0126370_103667351 | 3300010358 | Tropical Forest Soil | MEEMMTRKLAIVVGYAVILVSSSVTLVAAADFGTPEEAK |
Ga0126370_124264292 | 3300010358 | Tropical Forest Soil | MLRNLAFVVVYALFSLLATAVWAAEFGTAEEAKAMLERAVAAV |
Ga0126376_104740402 | 3300010359 | Tropical Forest Soil | MEEIMTRKLAFVVGYAVILVFSTVALVAAADFGTPEEAKAMLERAVAAVKEDKA |
Ga0126377_131399461 | 3300010362 | Tropical Forest Soil | MLRNLAFVVGYAVIYVLSTIAFVWAADFGTPEEAKAMLERAVTA |
Ga0126379_112737301 | 3300010366 | Tropical Forest Soil | MMRKFAFVVGYAVIQILSSLALVAAAEFGTAEEAKAMLERAV |
Ga0134125_117699952 | 3300010371 | Terrestrial Soil | MLRNLAFAVGCAVSLIVLCTAASLAAADFGTPEEAKAMLEKAV |
Ga0134128_100940051 | 3300010373 | Terrestrial Soil | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEA |
Ga0134128_105786971 | 3300010373 | Terrestrial Soil | MLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAMLERAVAA |
Ga0134128_112890683 | 3300010373 | Terrestrial Soil | MFRNFGFVVGFALILVLSTTASVWAAEFGTAEEAKAMLERAVA |
Ga0134128_123839362 | 3300010373 | Terrestrial Soil | MLRNLAFVAGYAVILVLSTSAPVWAAEFGTAEEAKTMLERAVAAVKEDK |
Ga0126383_115818392 | 3300010398 | Tropical Forest Soil | MIRNLAFVVGYAAVLVLSTTSSVWAADFGTAEEAKAMLERAVAAVKEDK |
Ga0134123_100862662 | 3300010403 | Terrestrial Soil | MLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAVAR* |
Ga0134123_110957261 | 3300010403 | Terrestrial Soil | MLRNIAFVVGFAVIQVLSTAASVAAADFGTAEEAKAMLEKAV |
Ga0134123_123937612 | 3300010403 | Terrestrial Soil | LWRLVMLRNLVFVVGYAVVLVLSTATLVAAAEFGTA* |
Ga0137454_10300313 | 3300011406 | Soil | MLRNLAFVVSFALILVLSTPASVSAAEFGTAEEAKAMLERAVAAVK |
Ga0157341_10206132 | 3300012494 | Arabidopsis Rhizosphere | MLRNIAFVVGFAVIQVLSTAASVAAADFGTAEEAKAMLEKAVAAV |
Ga0157339_10527392 | 3300012505 | Arabidopsis Rhizosphere | MIRNLGFVVGYAVILVLSTTASVWAADFGTAEEAKAMLERAVAAV |
Ga0157342_10150892 | 3300012507 | Arabidopsis Rhizosphere | MSRNLAFVVSFALMLLLSTTASVWAAEFGTAEEAKAMLERAVAAVKEDKA |
Ga0157342_10850901 | 3300012507 | Arabidopsis Rhizosphere | MEEAMIRNLAFIVSFALIMVLSTTVLLWASEFGTAEEAKAMLERAVA |
Ga0157352_10598521 | 3300012519 | Unplanted Soil | MLRNLAFAVGCAVSVIVLCTAASFAAADFGTPEEAKAMLEKA |
Ga0157303_102053932 | 3300012896 | Soil | VLLAEGHAEPLEEVMMRKLAFVVGYAVIQVLSSPALFAAAEFGTAEEAKAMLERAVAAVKEDK |
Ga0157285_100088951 | 3300012897 | Soil | MLRNLAFVVGYAVIQMLSTAAPLPAAQFGTAEEAKAMLERA |
Ga0157285_100233804 | 3300012897 | Soil | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVA |
Ga0157293_101504192 | 3300012898 | Soil | MLRNLAFVVGYAVIQMLSTTASVWAADFGTAEEAKAMLERAVAAVKENKAKA |
Ga0157288_102669462 | 3300012901 | Soil | LEEVMIRKLAFVVGYAVFQLLSTTASVWAAEFGTAEEAKSMLERAVAA |
Ga0157301_100200101 | 3300012911 | Soil | MLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAMLE |
Ga0164300_100675963 | 3300012951 | Soil | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTTEEAAAMLERAVPAGKEDKATGL |
Ga0164298_106670481 | 3300012955 | Soil | MLRNIAFVIGFVVFPVLSTAASVWAADFGTAEEAKARLERAVAR* |
Ga0164298_107336571 | 3300012955 | Soil | MLRNLASVIGHALILVLSTTASVWAADFGTAEEAKAMLERAVA |
Ga0164303_108174441 | 3300012957 | Soil | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAA |
Ga0164303_108460851 | 3300012957 | Soil | MLRNIAFVVGLVVFPVLSTAASVWAADFGTAEEAKAMLERAVA |
Ga0164301_100205994 | 3300012960 | Soil | MLRNIAFVVGLVVFPVLSTAASVWAADFGTAEEAKAMLERAVAR* |
Ga0164302_100020182 | 3300012961 | Soil | MLRNIAFVVCFALIQVFSTAAFAADFGTAEEAKSHA* |
Ga0164302_103153712 | 3300012961 | Soil | MLRNLASVIGHALILVLSTTASVWAADFGTAEEAKAMLERAVAAVK |
Ga0126369_108393484 | 3300012971 | Tropical Forest Soil | MEEVMIRKLAFVVGYAVIQVLSNPTSVAAAEFGTAEEAKAMLERA |
Ga0164304_118257981 | 3300012986 | Soil | MEEVMLRNLAFVVGCAAVLAFFTAAPVPAAQYGTDEGAKAMLSRAIAA |
Ga0157372_112721931 | 3300013307 | Corn Rhizosphere | MLRNLALVVGYAVILVLSTVASVAAADFGTPEEAKAMLE |
Ga0132258_124381091 | 3300015371 | Arabidopsis Rhizosphere | MLRNLTFVVGYAVIQLLFTTAPVWASNWGTAEEAKAMLEKAVAA |
Ga0132256_1018332221 | 3300015372 | Arabidopsis Rhizosphere | MLRPLAFVDSYAAVLILFAATPVPAAQFGTQEEARAMLEKAVAAVKEDK |
Ga0132256_1026362962 | 3300015372 | Arabidopsis Rhizosphere | MLRNLAFVVGYAVFQLLAPTAWAAEFGTAEEAKAMLGRAVAAVK |
Ga0182033_119664611 | 3300016319 | Soil | MSRNLAFVASYVTVLVLLTAAVSAAQYGTPEEAKAMLERAVA |
Ga0182035_111115492 | 3300016341 | Soil | MLRNLAFVVVYAVILVSSRLTLVAAADFGTPEEAKAMLERAVTAVKED |
Ga0184638_12169301 | 3300018052 | Groundwater Sediment | MLRNLAFVVGYAVIQVLSTTASVWAADFGTEEEAK |
Ga0184626_104411161 | 3300018053 | Groundwater Sediment | MLRSLAYVVGHMIVLVLLTAPSASAAQFGTAEEAKAMLERAV |
Ga0184619_103312891 | 3300018061 | Groundwater Sediment | MLRNLAFVVSFAVIQGLSTAALVAAAEFGTAEEAKAMLERAVAAVKE |
Ga0187773_110525351 | 3300018064 | Tropical Peatland | MLRNLAFVVGYAVILVLSTTASVVAADFGTSQEAKAMLERAVAAV |
Ga0190271_101077826 | 3300018481 | Soil | MLRSFAFVVGFAAFLVLSTTASVWAAEYGTADEAKAMLERAVA |
Ga0190271_117439693 | 3300018481 | Soil | MLRSFAFVVGFAAFLVLSTTASVWAAEYGTADEAKAMLERA |
Ga0210402_108992851 | 3300021478 | Soil | MLRNIAFVVGFAVIQVLSTAASVWAADFGTAEEAK |
Ga0210402_109593511 | 3300021478 | Soil | MLRNLAFVVGYAVIQVLSTTASVWAADFGTAEEAK |
Ga0210402_119808312 | 3300021478 | Soil | MLRNLASVISHALILVLSTTASVWAADFGTAEEAKAILERAV |
Ga0126371_127788152 | 3300021560 | Tropical Forest Soil | MIRNRAFVVSFAVIQVLSSATLVAAAEFGTAEEAKAMLERAVAA |
Ga0126371_135352831 | 3300021560 | Tropical Forest Soil | MLRNLAFVVGYAVILVSSTVTFVAAADFGTPEEAKAMLERA |
Ga0222623_103815832 | 3300022694 | Groundwater Sediment | MLRNLAFVISYAVIQVLFITASVWAADFGSAEEAEAFSREQWPQ |
Ga0207713_11391072 | 3300025735 | Switchgrass Rhizosphere | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEE |
Ga0207710_100278671 | 3300025900 | Switchgrass Rhizosphere | MLRNLAFAVGCAVSLIVVCTAASFAAADFGTPEEAKAMLEKAV |
Ga0207685_100840103 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAM |
Ga0207707_104542642 | 3300025912 | Corn Rhizosphere | MLRKIAFAVSFAVIQVLTASVWAADFGTAEEAKAMLE |
Ga0207663_102618743 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAM |
Ga0207663_103190131 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRNLVLVVSYAAALVLSTAASVAETQFGTPEEAKAMLERAVAA |
Ga0207660_105434402 | 3300025917 | Corn Rhizosphere | MLRNLAFVISYAVIQVLFTTSSVWAADFGTPEEAKA |
Ga0207649_114511111 | 3300025920 | Corn Rhizosphere | MLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAVAR |
Ga0207694_109930502 | 3300025924 | Corn Rhizosphere | MLRNLAFAVGCAVSLIVLSTAASLAAADFGTPEEAKAMLEKAI |
Ga0207659_103946963 | 3300025926 | Miscanthus Rhizosphere | MLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERAVAAVKEDKA |
Ga0207687_105465842 | 3300025927 | Miscanthus Rhizosphere | MSRNLGFVVSFALILVLSTTASVWGADFGTAEEAKAMLERAVAAVKEDKARRRLICS |
Ga0207665_103873111 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRNLVLVVSYAAALVLSTAASVAETQFGTPEEAKAMLERAVAAVKE |
Ga0207689_113427141 | 3300025942 | Miscanthus Rhizosphere | MLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAMLERAVAAV |
Ga0207679_120487541 | 3300025945 | Corn Rhizosphere | MLRNRAFAFGCAVSLIIFCTAASFAAADFGTPEEAKAMLEKAVAAVKQDKAKA |
Ga0210089_10113922 | 3300025957 | Natural And Restored Wetlands | MIRNLVFVVSFGVIQILSTVTSVPAAEFGTAEEAK |
Ga0207658_101882391 | 3300025986 | Switchgrass Rhizosphere | MLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAVA |
Ga0207677_113657241 | 3300026023 | Miscanthus Rhizosphere | MLRNLAFLVGYAVIQVLSTTASVWAADFGTAEEAKA |
Ga0207674_112537761 | 3300026116 | Corn Rhizosphere | MLRHLALVVGYAVALACVTAAPVPAAQFGTPEEAKAMLERAVAAV |
Ga0207675_1000142201 | 3300026118 | Switchgrass Rhizosphere | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDK |
Ga0207675_1018688981 | 3300026118 | Switchgrass Rhizosphere | MLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERAVA |
Ga0207675_1020727881 | 3300026118 | Switchgrass Rhizosphere | MLRNLAFAVGCAVSLIVLCTAASWAAADFGTPEEAKAM |
Ga0209969_10298981 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MKLVMLRNLAFVISFALILVLSTTVSVWAAKFGTAQE |
Ga0208637_10445961 | 3300027401 | Soil | PAAAPWRLVMLRNIAFVVGFAVIQVLSTAASVAAADFGTAEEAKAMLEGQWPR |
Ga0209698_102231854 | 3300027911 | Watersheds | MLRHLALVVSYAAVLVLFAATSVPAAQFGTAEEAKAMLE |
Ga0247819_101361491 | 3300028608 | Soil | MLRNLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERAVAAMKEDK |
Ga0311364_107927041 | 3300031521 | Fen | MLRNLTLAVGYAVILVLSTAALVSAADFGTPAEAKA |
Ga0310887_109743921 | 3300031547 | Soil | MLRNLAFVVGYAVIQVLSTTASVWATDFGTAEEAK |
Ga0310892_110054761 | 3300031858 | Soil | MIRNLAFIVSFALIMVLSTTVLLRASEFGTAEEAKAMLERAVAA |
Ga0310893_102854192 | 3300031892 | Soil | MLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAKA |
Ga0310900_111641231 | 3300031908 | Soil | MLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAKGL |
Ga0306921_113711502 | 3300031912 | Soil | MLRNLAFVVVYAVILVSSTLTLVAAADFGTPEEAKAMLERAVTAVKEDKAK |
Ga0310912_114796551 | 3300031941 | Soil | MLRNLAFVVGYAVILVSSTVTLVPAADFGTPEEAKAMLERA |
Ga0310916_115747072 | 3300031942 | Soil | MKLVMLRNLAFVVAYAVIQVLSTTASVWAADFGTAEEAKAMLEKAAAA |
Ga0310885_104138442 | 3300031943 | Soil | MLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAKAMLEKAVAA |
Ga0310884_107283431 | 3300031944 | Soil | MLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVK |
Ga0310890_107572353 | 3300032075 | Soil | MLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAK |
Ga0310895_100699023 | 3300032122 | Soil | MEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAKAL |
Ga0307470_101535211 | 3300032174 | Hardwood Forest Soil | MSRNLGFVVSFALILVLSTTASVWAAEFGTAEEAKAM |
Ga0307472_1012950361 | 3300032205 | Hardwood Forest Soil | MLRNIAFVVGFAVIQVLSTAASVWAADFGTAEPKLCLRE |
Ga0310896_102862632 | 3300032211 | Soil | MLRNLALVVGYAVILVLSTVASVAAADFGTPEEAKANA |
Ga0306920_1035909962 | 3300032261 | Soil | MTRKLGIVVGYAVILVSSAVTLVAAADFGTPEEAKAMLERAVTAVKEDKAK |
Ga0310914_101252502 | 3300033289 | Soil | MLRNLAFVVGTTVMVLFTAAPVPAADFGTAEQAKAMLERAVAAVK |
Ga0247830_114797051 | 3300033551 | Soil | MLRNIAFVVGFALIQVFSTAAFAADFGTAEEAKAMLERAV |
⦗Top⦘ |