Basic Information | |
---|---|
Family ID | F036693 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 169 |
Average Sequence Length | 45 residues |
Representative Sequence | MYNKTMKPRNPIAKDLRTPKYRMRVVESKVQYIRQPKHRKATDEL |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 169 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 54.44 % |
% of genes near scaffold ends (potentially truncated) | 26.04 % |
% of genes from short scaffolds (< 2000 bps) | 50.89 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (56.213 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (20.118 % of family members) |
Environment Ontology (ENVO) | Unclassified (62.130 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (79.882 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.11% β-sheet: 0.00% Coil/Unstructured: 95.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 169 Family Scaffolds |
---|---|---|
PF03819 | MazG | 28.99 |
PF10902 | WYL_2 | 24.85 |
PF09293 | RNaseH_C | 3.55 |
PF00782 | DSPc | 2.37 |
PF00565 | SNase | 2.37 |
PF00383 | dCMP_cyt_deam_1 | 1.78 |
PF02675 | AdoMet_dc | 1.18 |
PF00004 | AAA | 1.18 |
PF09414 | RNA_ligase | 1.18 |
PF00535 | Glycos_transf_2 | 1.18 |
PF00149 | Metallophos | 1.18 |
PF10614 | CsgF | 0.59 |
PF02739 | 5_3_exonuc_N | 0.59 |
PF02867 | Ribonuc_red_lgC | 0.59 |
PF04308 | RNaseH_like | 0.59 |
PF12850 | Metallophos_2 | 0.59 |
PF08722 | Tn7_TnsA-like_N | 0.59 |
PF13640 | 2OG-FeII_Oxy_3 | 0.59 |
PF13506 | Glyco_transf_21 | 0.59 |
PF00268 | Ribonuc_red_sm | 0.59 |
PF13671 | AAA_33 | 0.59 |
PF11351 | GTA_holin_3TM | 0.59 |
PF09825 | BPL_N | 0.59 |
PF01223 | Endonuclease_NS | 0.59 |
PF13759 | 2OG-FeII_Oxy_5 | 0.59 |
PF13439 | Glyco_transf_4 | 0.59 |
PF05226 | CHASE2 | 0.59 |
PF01063 | Aminotran_4 | 0.59 |
PF02511 | Thy1 | 0.59 |
PF06941 | NT5C | 0.59 |
PF02627 | CMD | 0.59 |
COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
---|---|---|---|
COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.18 |
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 1.18 |
COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.59 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.59 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.59 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.59 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.59 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.59 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.59 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.59 |
COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.86 % |
Unclassified | root | N/A | 4.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352004|2199786173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31218 | Open in IMG/M |
2236876004|none_p0207237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300000162|TB03JUN2009H_c000009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 81225 | Open in IMG/M |
3300000269|M3P_1010348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300000929|NpDRAFT_10167267 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
3300001605|Draft_10110734 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
3300001849|RCM26_1132671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300001849|RCM26_1186579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
3300001850|RCM37_1271725 | Not Available | 537 | Open in IMG/M |
3300002198|metazooDRAFT_1235993 | Not Available | 648 | Open in IMG/M |
3300002835|B570J40625_100027383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9181 | Open in IMG/M |
3300002835|B570J40625_100705573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300002835|B570J40625_101339597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300003277|JGI25908J49247_10004042 | All Organisms → Viruses → Predicted Viral | 4693 | Open in IMG/M |
3300003277|JGI25908J49247_10004119 | All Organisms → Viruses → Predicted Viral | 4646 | Open in IMG/M |
3300003277|JGI25908J49247_10016592 | All Organisms → Viruses → Predicted Viral | 2235 | Open in IMG/M |
3300003277|JGI25908J49247_10027409 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
3300003277|JGI25908J49247_10049768 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
3300003388|JGI25910J50241_10069977 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
3300003388|JGI25910J50241_10172022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
3300003393|JGI25909J50240_1109372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300003412|JGI25912J50252_10124923 | Not Available | 604 | Open in IMG/M |
3300003430|JGI25921J50272_10026701 | All Organisms → Viruses → Predicted Viral | 1479 | Open in IMG/M |
3300003499|JGI25930J51415_1002795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3896 | Open in IMG/M |
3300004126|Ga0066179_10253646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300004240|Ga0007787_10022758 | All Organisms → Viruses → Predicted Viral | 2647 | Open in IMG/M |
3300004692|Ga0065171_1060038 | Not Available | 604 | Open in IMG/M |
3300004766|Ga0007747_1089145 | Not Available | 518 | Open in IMG/M |
3300004772|Ga0007791_10188264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300004797|Ga0007764_11156937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300005417|Ga0068884_1191273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300005517|Ga0070374_10072732 | All Organisms → Viruses → Predicted Viral | 1792 | Open in IMG/M |
3300005527|Ga0068876_10024532 | All Organisms → Viruses → Predicted Viral | 3786 | Open in IMG/M |
3300005580|Ga0049083_10126091 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300005581|Ga0049081_10003872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5643 | Open in IMG/M |
3300005581|Ga0049081_10009398 | All Organisms → Viruses → Predicted Viral | 3710 | Open in IMG/M |
3300005581|Ga0049081_10019629 | All Organisms → Viruses → Predicted Viral | 2564 | Open in IMG/M |
3300005581|Ga0049081_10023367 | All Organisms → Viruses → Predicted Viral | 2346 | Open in IMG/M |
3300005582|Ga0049080_10044963 | All Organisms → Viruses → Predicted Viral | 1530 | Open in IMG/M |
3300005582|Ga0049080_10049089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
3300005582|Ga0049080_10049313 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
3300005582|Ga0049080_10061209 | All Organisms → Viruses → Predicted Viral | 1295 | Open in IMG/M |
3300005582|Ga0049080_10082084 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
3300005582|Ga0049080_10112718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
3300005584|Ga0049082_10003678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5012 | Open in IMG/M |
3300005662|Ga0078894_10551541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
3300005941|Ga0070743_10006887 | All Organisms → Viruses → Predicted Viral | 4061 | Open in IMG/M |
3300006484|Ga0070744_10156436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300006641|Ga0075471_10070876 | All Organisms → Viruses → Predicted Viral | 1907 | Open in IMG/M |
3300006641|Ga0075471_10072699 | All Organisms → Viruses → Predicted Viral | 1878 | Open in IMG/M |
3300006805|Ga0075464_10502943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
3300007603|Ga0102921_1337875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300007860|Ga0105735_1105847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300008055|Ga0108970_11419856 | Not Available | 1271 | Open in IMG/M |
3300008108|Ga0114341_10090874 | All Organisms → Viruses → Predicted Viral | 2783 | Open in IMG/M |
3300008113|Ga0114346_1001634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29604 | Open in IMG/M |
3300008116|Ga0114350_1157269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300009059|Ga0102830_1228099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300009068|Ga0114973_10000893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22469 | Open in IMG/M |
3300009151|Ga0114962_10004555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11018 | Open in IMG/M |
3300009151|Ga0114962_10057141 | All Organisms → Viruses → Predicted Viral | 2546 | Open in IMG/M |
3300009151|Ga0114962_10365351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300009154|Ga0114963_10161607 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
3300009155|Ga0114968_10022995 | All Organisms → Viruses → Predicted Viral | 4268 | Open in IMG/M |
3300009158|Ga0114977_10604784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300009158|Ga0114977_10699972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300009159|Ga0114978_10739733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300009164|Ga0114975_10005091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8557 | Open in IMG/M |
3300009164|Ga0114975_10007520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6927 | Open in IMG/M |
3300009182|Ga0114959_10003252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12846 | Open in IMG/M |
3300009218|Ga0103848_1000111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8928 | Open in IMG/M |
3300009419|Ga0114982_1000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 134387 | Open in IMG/M |
3300009684|Ga0114958_10079746 | All Organisms → Viruses → Predicted Viral | 1708 | Open in IMG/M |
3300010354|Ga0129333_11217047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300010885|Ga0133913_10073234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9191 | Open in IMG/M |
3300010885|Ga0133913_10614041 | All Organisms → Viruses → Predicted Viral | 2853 | Open in IMG/M |
3300010885|Ga0133913_10700653 | All Organisms → Viruses → Predicted Viral | 2649 | Open in IMG/M |
3300010965|Ga0138308_101876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20102 | Open in IMG/M |
3300011011|Ga0139556_1058903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300012000|Ga0119951_1057065 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300012345|Ga0157139_1004585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300012347|Ga0157142_1000651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10347 | Open in IMG/M |
3300012352|Ga0157138_1001365 | All Organisms → Viruses → Predicted Viral | 4371 | Open in IMG/M |
3300012663|Ga0157203_1005106 | All Organisms → Viruses → Predicted Viral | 2535 | Open in IMG/M |
3300012665|Ga0157210_1003657 | All Organisms → Viruses → Predicted Viral | 3473 | Open in IMG/M |
3300012779|Ga0138284_1280956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300012779|Ga0138284_1331998 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
3300013005|Ga0164292_10941900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300013014|Ga0164295_10013641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6290 | Open in IMG/M |
3300013285|Ga0136642_1000687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16297 | Open in IMG/M |
3300013295|Ga0170791_10974687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
3300013295|Ga0170791_13710401 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
3300017722|Ga0181347_1056664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1175 | Open in IMG/M |
3300017766|Ga0181343_1083202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
3300017766|Ga0181343_1145760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300017784|Ga0181348_1104441 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
3300019784|Ga0181359_1007931 | All Organisms → Viruses → Predicted Viral | 3640 | Open in IMG/M |
3300020141|Ga0211732_1237141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9057 | Open in IMG/M |
3300020151|Ga0211736_10401536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300020160|Ga0211733_10483124 | All Organisms → Viruses → Predicted Viral | 3365 | Open in IMG/M |
3300020205|Ga0211731_10841969 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
3300020205|Ga0211731_11495705 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
3300020715|Ga0214254_1000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 168765 | Open in IMG/M |
3300020720|Ga0214252_1000041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 74070 | Open in IMG/M |
3300021961|Ga0222714_10031786 | All Organisms → Viruses → Predicted Viral | 3912 | Open in IMG/M |
3300021961|Ga0222714_10080133 | All Organisms → Viruses → Predicted Viral | 2132 | Open in IMG/M |
3300021961|Ga0222714_10094220 | All Organisms → Viruses → Predicted Viral | 1913 | Open in IMG/M |
3300021962|Ga0222713_10000314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 54245 | Open in IMG/M |
3300021962|Ga0222713_10009619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8780 | Open in IMG/M |
3300021963|Ga0222712_10005347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13050 | Open in IMG/M |
3300022213|Ga0224500_10003226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8434 | Open in IMG/M |
3300022407|Ga0181351_1014695 | All Organisms → Viruses → Predicted Viral | 3247 | Open in IMG/M |
3300022591|Ga0236341_1009132 | All Organisms → Viruses → Predicted Viral | 3658 | Open in IMG/M |
3300022591|Ga0236341_1052944 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
3300022746|Ga0228701_1000041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 166547 | Open in IMG/M |
3300022747|Ga0228703_1134804 | Not Available | 543 | Open in IMG/M |
3300023174|Ga0214921_10001461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40257 | Open in IMG/M |
3300023174|Ga0214921_10002817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27519 | Open in IMG/M |
3300023174|Ga0214921_10002910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27029 | Open in IMG/M |
3300023708|Ga0228709_1065000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300024289|Ga0255147_1000221 | All Organisms → Viruses | 21364 | Open in IMG/M |
3300024568|Ga0255238_1122811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300024857|Ga0256339_1091893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300026570|Ga0255274_1031711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
3300026571|Ga0255289_1041820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
3300026573|Ga0255269_1000474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8640 | Open in IMG/M |
3300026573|Ga0255269_1149253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300027248|Ga0208176_1031909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300027256|Ga0208932_1042776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300027396|Ga0255146_1000585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9139 | Open in IMG/M |
3300027586|Ga0208966_1012934 | All Organisms → Viruses → Predicted Viral | 2480 | Open in IMG/M |
3300027608|Ga0208974_1005291 | All Organisms → Viruses → Predicted Viral | 4445 | Open in IMG/M |
3300027659|Ga0208975_1000217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30814 | Open in IMG/M |
3300027659|Ga0208975_1009257 | All Organisms → Viruses → Predicted Viral | 3443 | Open in IMG/M |
3300027659|Ga0208975_1026386 | All Organisms → Viruses → Predicted Viral | 1877 | Open in IMG/M |
3300027697|Ga0209033_1032488 | All Organisms → Viruses → Predicted Viral | 1996 | Open in IMG/M |
3300027708|Ga0209188_1000076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 116441 | Open in IMG/M |
3300027708|Ga0209188_1000749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29576 | Open in IMG/M |
3300027708|Ga0209188_1003687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10416 | Open in IMG/M |
3300027708|Ga0209188_1026926 | All Organisms → Viruses → Predicted Viral | 2814 | Open in IMG/M |
3300027710|Ga0209599_10000035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 99354 | Open in IMG/M |
3300027712|Ga0209499_1164798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300027732|Ga0209442_1008525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5060 | Open in IMG/M |
3300027732|Ga0209442_1028704 | All Organisms → Viruses → Predicted Viral | 2523 | Open in IMG/M |
3300027733|Ga0209297_1331361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300027734|Ga0209087_1012394 | All Organisms → Viruses → Predicted Viral | 4323 | Open in IMG/M |
3300027734|Ga0209087_1237289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300027741|Ga0209085_1027927 | All Organisms → Viruses → Predicted Viral | 2686 | Open in IMG/M |
3300027744|Ga0209355_1003715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8306 | Open in IMG/M |
3300027756|Ga0209444_10023902 | All Organisms → Viruses → Predicted Viral | 2994 | Open in IMG/M |
3300027782|Ga0209500_10019846 | All Organisms → Viruses → Predicted Viral | 3933 | Open in IMG/M |
3300027782|Ga0209500_10091953 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
3300027782|Ga0209500_10195556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300027785|Ga0209246_10125995 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
3300027793|Ga0209972_10001804 | All Organisms → Viruses | 18116 | Open in IMG/M |
3300027969|Ga0209191_1012113 | All Organisms → Viruses → Predicted Viral | 4533 | Open in IMG/M |
3300027969|Ga0209191_1022242 | All Organisms → Viruses → Predicted Viral | 3127 | Open in IMG/M |
3300027971|Ga0209401_1277123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300028025|Ga0247723_1000324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32732 | Open in IMG/M |
3300028025|Ga0247723_1003763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7424 | Open in IMG/M |
3300028112|Ga0256335_1009505 | All Organisms → Viruses → Predicted Viral | 2378 | Open in IMG/M |
3300028393|Ga0304728_1001159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19308 | Open in IMG/M |
3300031787|Ga0315900_10005529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17322 | Open in IMG/M |
3300031857|Ga0315909_10026615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5697 | Open in IMG/M |
3300031857|Ga0315909_10534764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300032092|Ga0315905_10003258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16796 | Open in IMG/M |
3300032092|Ga0315905_10004746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13893 | Open in IMG/M |
3300033994|Ga0334996_0217106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
3300034082|Ga0335020_0177465 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.12% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.93% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 10.06% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.10% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.33% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.14% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.96% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.37% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.37% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.78% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.78% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.78% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.78% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.18% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.18% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.18% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.18% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.59% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.59% |
Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.59% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.59% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.59% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.59% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.59% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.59% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.59% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.59% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
2236876004 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15m | Environmental | Open in IMG/M |
3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300000269 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 7, Mississippi Headwaters | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300002198 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUL 2013 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
3300004766 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012345 | Freshwater microbial communities from Burnt River, Ontario, Canada - S22 | Environmental | Open in IMG/M |
3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020715 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUL2009 hypolimnion | Environmental | Open in IMG/M |
3300020720 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 hypolimnion | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027248 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027256 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2199944151 | 2199352004 | Freshwater | MKTQYNKPKNLVAKDLRTPKYRMRVVDSKIAFTRKPKHKKDLYE |
none_02072373 | 2236876004 | Marine Estuarine | MKVVYNSIKPRNPIAKDLRTPKYRMRKVESKVQYTRQPKAQER |
TB03JUN2009H_000009137 | 3300000162 | Freshwater | VYNKPMRPRNPVAKDLRTPKYRMRTVESKVKYIRNPKHRKADHGLGV* |
M3P_10103485 | 3300000269 | Lotic | MKTQYNKPKNLVAKDLRTPKYRMRVVDSKIAFTRKPKHKKDLYEQP* |
NpDRAFT_101672674 | 3300000929 | Freshwater And Marine | VYNKPLKPRNLVAKDLRTPKYRMRVVGSKVQYIRQPKHRKADHGLGV* |
Draft_101107343 | 3300001605 | Hydrocarbon Resource Environments | MYNKTLKPRNPVAKDLRTPKYRMRKVESKVKYSRNPKHKKESYGQYL* |
RCM26_11326712 | 3300001849 | Marine Plankton | MYNKPMRPRNPIAKDLRTPKYRMRTVESKVKYVRQPKHRKADHGLGV* |
RCM26_11865793 | 3300001849 | Marine Plankton | MKKKYTYSKPRDLIAKDLRTPKYRMRVVESKVAFTRKVKHKDTTYERH* |
RCM37_12717252 | 3300001850 | Marine Plankton | MKPKYTSLKPRDLIAKDLRTPKYRMRVVESKVSFTRKVKHKDALYGQDL* |
metazooDRAFT_12359932 | 3300002198 | Lake | VYNKQLKPRDLVAKDLRTPKYRMRVVESKVKHTRKVKHKGKHDE* |
B570J40625_10002738317 | 3300002835 | Freshwater | MKTQYNKPKNLVAKDLRTPKYRMRVVDSKIAFTRKPKHKKDLYE* |
B570J40625_1007055734 | 3300002835 | Freshwater | MYNRTLKPRNPIAKDLRTPKYRMRKVESKVQYIRKPKHKKDTYES* |
B570J40625_1013395973 | 3300002835 | Freshwater | MKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKATDEL* |
JGI25908J49247_1000404210 | 3300003277 | Freshwater Lake | VYNRQMKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKAKDEL* |
JGI25908J49247_100041199 | 3300003277 | Freshwater Lake | VYNKTMKPRNLIAKDLRTPKYRMRKVESKVQYIRQPKHRKADHGLGV* |
JGI25908J49247_100165922 | 3300003277 | Freshwater Lake | VYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHRKATDEL* |
JGI25908J49247_100274093 | 3300003277 | Freshwater Lake | MYNRTMKPRNPIAKDLHTPKYRMRKVESKVQYIRQPKHRKATDEL* |
JGI25908J49247_100497683 | 3300003277 | Freshwater Lake | VYNKRMKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKADHGLGV* |
JGI25910J50241_100699772 | 3300003388 | Freshwater Lake | MYNNKTLKRRNPIAKDLRTPKYRQRVXESKVQYIRNPKHKKDMYESQL* |
JGI25910J50241_101720221 | 3300003388 | Freshwater Lake | VYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHRK |
JGI25909J50240_11093722 | 3300003393 | Freshwater Lake | MYNNKTLKRRNPIAKDLRTPKYRQRVVESKVQYIRNPKHKKDMYESQL* |
JGI25912J50252_101249231 | 3300003412 | Freshwater Lake | MYNRTMKPRNPVAKDLRTPKYRMRKVESKVQYIRQPKHRKA |
JGI25921J50272_100267015 | 3300003430 | Freshwater Lake | MYNKTMKPRNPIAKDLRTPKYRMRKVESKVQYIRQPKHRKVNNEFE* |
JGI25930J51415_10027951 | 3300003499 | Freshwater Lake | VYNISSKPKNLVAKDLRTPKYRMRVVESKVRYTRKTKHKKGAYESRV |
Ga0066179_102536461 | 3300004126 | Freshwater Lake | VYNRQMKPRDPIAKDLRTPKYRMRVVGSKVQYIRQPKHRKAKDEL* |
Ga0007787_100227587 | 3300004240 | Freshwater Lake | MYNKTLKPRNPVAKDLRTPKYRMRTVESKVKYIRNPKHKKESYAEQV* |
Ga0065171_10600382 | 3300004692 | Freshwater | MYNKPMRPRNLVAKDLRTPKYRMRTVESKVKYIRQPKHRKAEHGSAMGIE* |
Ga0007747_10891453 | 3300004766 | Freshwater Lake | MKYNKCMKPKNLIAKDLRTPKYRMRVVESKVKYIRKDKHK |
Ga0007791_101882643 | 3300004772 | Freshwater | VYNKPMRPRNLVAKDLRTPKYRMRTVESKVKYIRQPKHKKELYES* |
Ga0007764_111569373 | 3300004797 | Freshwater Lake | VYNISSKPKNLVAKDLRTPKYRMRVVESKVLYTRKTKHKKGAYESKISE* |
Ga0068884_11912731 | 3300005417 | Freshwater Lake | MYNKTSKPRNPVAKDLRTPKYRMRKVESKVKYTRNPKHKKESYGQYL* |
Ga0070374_100727321 | 3300005517 | Freshwater Lake | VYNKRMKPRDPIAKDLRTPKYRMRKVESKVQYIRQPKH |
Ga0068876_100245321 | 3300005527 | Freshwater Lake | MYNKTSKPRNPVAKDLRTPKYRMRTVESKVKYIRNPKHKKESYGQYL* |
Ga0049083_101260915 | 3300005580 | Freshwater Lentic | VYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQ |
Ga0049081_100038723 | 3300005581 | Freshwater Lentic | MYNNKTLKRRNPIAKDLRTPKYRQRVVESKVQYIRNPKHKKDTYESQL* |
Ga0049081_100093987 | 3300005581 | Freshwater Lentic | MYNRTLKPRNPIAKDLRTPKYRMRTVESKVQYIRKPKHKKDTYES* |
Ga0049081_100196293 | 3300005581 | Freshwater Lentic | MKTKYNLPKPRNPIARDLRTPKYRMRTVDSKVQYIRQPKHKKDIYEQRV* |
Ga0049081_100233676 | 3300005581 | Freshwater Lentic | MYNRTMKPRNPIAKDLRTPKYRMRKVESKVQYIRQPKHRKATDEL* |
Ga0049080_100449636 | 3300005582 | Freshwater Lentic | MKTKYNLPKPRNPIARDLRTPKYRMRTVDSKVQYIRQPKHKKGIYEQRV* |
Ga0049080_100490891 | 3300005582 | Freshwater Lentic | NKTMRPRNLIAKDLRTPKYRMRTVESKVKYIRQPKHRKVMQDGL* |
Ga0049080_100493133 | 3300005582 | Freshwater Lentic | VYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHRKADHGLGV* |
Ga0049080_100612093 | 3300005582 | Freshwater Lentic | VYNRQMKPRDPIAKDLRTPKYHMRVVESKVQYIRQPKHRKATDEL* |
Ga0049080_100820841 | 3300005582 | Freshwater Lentic | VYNKTMRPRNLIAKDLRTPKYRMRTVESKVKYIRQPKHRKV |
Ga0049080_101127181 | 3300005582 | Freshwater Lentic | VYNKTMRPRNLIAKDLRTPKYRMRTVESKVKYIRQPKHRK |
Ga0049082_100036782 | 3300005584 | Freshwater Lentic | MKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHRKATDEL* |
Ga0078894_105515413 | 3300005662 | Freshwater Lake | MQECLKYNNPLKRRNPIARDLRTPKYRMRVVESKLSFSRKVKHKKDCYDII* |
Ga0070743_1000688710 | 3300005941 | Estuarine | VYNKPLKPRNLVAKDLRTPKYRMRVVESKVQYIRQPKHRKADHGLGV* |
Ga0070744_101564363 | 3300006484 | Estuarine | MYNKTSKPRDPIAKDLRTPKYRMRVVESKVKYIRNPKHKKESYGQYL* |
Ga0075471_100708762 | 3300006641 | Aqueous | MYNKVMKPRNPIAKDVRTPKYRMRVVESKVHYTRKEKHKHALSTQT* |
Ga0075471_100726994 | 3300006641 | Aqueous | MKIKYNLPRPRNLVAKDLRTPKYRQRTEESKVRYTRQPKHRKDSYANEGI* |
Ga0075464_105029433 | 3300006805 | Aqueous | MYNRPMKRRDLIAKDLRTPKYRMRVVESKIHRKPKHKKEIYES* |
Ga0102921_13378752 | 3300007603 | Estuarine | MYNKTMKPRNPIAKDLRTPKYRMRKVESKVQYIRQSKHRKVNNEFE* |
Ga0105735_11058471 | 3300007860 | Estuary Water | VDIKMKIEYNLPKPRNFVAKDLRTPKYRMRAVESKVKYTRQPKHRKLNEY* |
Ga0108970_114198566 | 3300008055 | Estuary | MKVVYNSIKPRNPIAKDLRTPKYRMRKVESKVQYTRQPKHKKGSYEY |
Ga0114341_100908746 | 3300008108 | Freshwater, Plankton | VYNISSKPKNLVAKDLRTPKYRMRVVESKVRYTRKTKHKKGAYESRVSE* |
Ga0114346_100163427 | 3300008113 | Freshwater, Plankton | MYNKTMKPRNPIAKDLRTPKYRMRVVESKVQYIRQPKHRKVNNEFQ* |
Ga0114350_11572693 | 3300008116 | Freshwater, Plankton | VYNISSKPKNLVAKDLRTPKYRMRVVESKVRYTRKTKHKKGAYES |
Ga0102830_12280991 | 3300009059 | Estuarine | AKDLRTPKYRMRTVESKVKYIRQPKHRKVMQDGL* |
Ga0114973_1000089368 | 3300009068 | Freshwater Lake | MKPRDPVAKDLRTPKYRMRVVESKVQYIRQPKHRKADHGLGI* |
Ga0114962_100045558 | 3300009151 | Freshwater Lake | MYNKRMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHKKDIYES* |
Ga0114962_100571417 | 3300009151 | Freshwater Lake | MYNKPLKPKNLVAKDLRTPKYRMRVVESKIQYIRQPKHKKGNYDQL* |
Ga0114962_103653512 | 3300009151 | Freshwater Lake | MYNKTMKPRNPIAKDLRTPKYRMRVVESKVQYIRQPKHRKATDEL* |
Ga0114963_101616071 | 3300009154 | Freshwater Lake | MYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHKKDIYES* |
Ga0114968_100229959 | 3300009155 | Freshwater Lake | MYNKTMKPRNPIAKDLRTPKYRMRKVESKVQYIRQPKHRKATDEL* |
Ga0114977_106047842 | 3300009158 | Freshwater Lake | MYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHRKATDEL* |
Ga0114977_106999723 | 3300009158 | Freshwater Lake | MKPRNPIAKDLRTPKYRMRKVESKVQYIRQPKHRKATDE |
Ga0114978_107397331 | 3300009159 | Freshwater Lake | MKPRNPIAKDLRTPKYRMRKVESRVQYIRQPKHRKADYGLGV* |
Ga0114975_100050917 | 3300009164 | Freshwater Lake | LQNFKVALQMKTKYNLPKPRNPVAKDLRTPKYKMRVVESKVSYIRQPKHKKDTYESE* |
Ga0114975_100075208 | 3300009164 | Freshwater Lake | MKTKYNLPKPRNPVARDLRTPKYKMRVVDSKVQYIRQPKHKKDIYEQRV* |
Ga0114959_1000325227 | 3300009182 | Freshwater Lake | MKIKYNLPKPRNLVARDLRTPKYKMRVVDSKVKYTRQPKHKKETYEHAL* |
Ga0103848_100011110 | 3300009218 | River Water | MKIKYNIPKPRNLVAKDLRTPKYRMRAEESKVKYIRQPKHRKDTYEDERV* |
Ga0114982_1000005174 | 3300009419 | Deep Subsurface | MYNKLKPRDPIAKDLRTPKYRMRVVESKVKYTRKSKHTKDNYGQYL* |
Ga0114958_100797464 | 3300009684 | Freshwater Lake | LQNFKVALQMKLKYNLPKPRNLVAKDLRTPKYKMRVVDSKVIYIRQPKHRKINNEFE* |
Ga0129333_112170472 | 3300010354 | Freshwater To Marine Saline Gradient | MKVVYNSIKPRNPVAKDLRTPKYRMRKVESKVQYTRQPKHKKGSYEY* |
Ga0133913_100732343 | 3300010885 | Freshwater Lake | MQMKIKYNLPKPRNPVAKDLRTPKYRMRTVDSKVQYIRQPKHRKENYAFE* |
Ga0133913_106140413 | 3300010885 | Freshwater Lake | MRPRNLVAKDLRTPKYRMRTVGSKVKYIRQPKHRKVMQDGL* |
Ga0133913_107006537 | 3300010885 | Freshwater Lake | MVKDKVVLTVKIEYNKPRNLVAKDLRTPKYRMRVVDSKVSFERNPKHKKDIYEY* |
Ga0138308_10187622 | 3300010965 | Lake Chemocline | MYNRTMKPRNPIAKDLRTPKYRMRVVGSKVQYIRQPKHRKADHGLGI* |
Ga0139556_10589033 | 3300011011 | Freshwater | MQMKTKYNLPKPRDPVARDLRTPKYKMRVVESKVQYIRQPKHKKDIYEQRV* |
Ga0119951_10570652 | 3300012000 | Freshwater | MKVVYNSIKPRNPVAKDLRTPKYRMRKVESKVQYTRQPKHKKGGYEY* |
Ga0157139_10045854 | 3300012345 | Freshwater | MKLVYNNLKPRNLVAKDLRTPKYRMRTEDSKVKYIRQPK |
Ga0157142_10006517 | 3300012347 | Freshwater | MQECLKYNNPLKRRNPIARDLRTPKYRMRVVESKLSFSRKVKHKKDCYDVI* |
Ga0157138_10013658 | 3300012352 | Freshwater | MYNKRMKPRDPIAKDVRTPKYRMRVVESKVQYIRKPKHKKELYES* |
Ga0157203_10051064 | 3300012663 | Freshwater | MYNKRMKPRDPIAKDLRTPKYRMRVVESKVQYIRKPKHRKEDYES* |
Ga0157210_10036575 | 3300012665 | Freshwater | MYNKTMKPRNPIAKDLRTPKYRMRKVESRVQYIRQPKHRKATDEL* |
Ga0138284_12809564 | 3300012779 | Freshwater Lake | MKPRNPIAKDLRTPKYRMRKVESKVQYIRQPKHKKVNNE |
Ga0138284_13319981 | 3300012779 | Freshwater Lake | IAKDLRTPKYRQRRVESKVQYIRQPKHRKAQDGI* |
Ga0164292_109419003 | 3300013005 | Freshwater | VYNRQMKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHR |
Ga0164295_100136419 | 3300013014 | Freshwater | MKTDKFDLKVKVEYNKPRDLVAKDLRTPKYRMRVVDSKVSFQRNSKHKKDLYEY* |
Ga0136642_10006874 | 3300013285 | Freshwater | MKTEYNYLKPRDYVAKDLRTPKYRMRVVESKCTYSRKAKHKKGDYE* |
Ga0170791_109746874 | 3300013295 | Freshwater | YNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHKKDIYES* |
Ga0170791_137104011 | 3300013295 | Freshwater | NPIAKDLRTPKYRMRKVESRVQYIRQPKHRKADYGLGV* |
Ga0181347_10566644 | 3300017722 | Freshwater Lake | VYNRQMKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKAKDEL |
Ga0181343_10832023 | 3300017766 | Freshwater Lake | MYNKPMKPRNPIAKDLRTPKYRQRRVESKVQYIRQPKHKKVNNEFE |
Ga0181343_11457601 | 3300017766 | Freshwater Lake | NKTMKPRNPIAKDLRTPKYRMRKVESKVQYIRQPKHRKATDEL |
Ga0181348_11044411 | 3300017784 | Freshwater Lake | VYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHRNLSF |
Ga0181359_10079315 | 3300019784 | Freshwater Lake | MKTKYNLPKPRDPVARDLRTPKYKMRVVESKVQYIRQPKHKKDIYEQRV |
Ga0211732_12371414 | 3300020141 | Freshwater | VYNKPLKPKNLVAKDLRTPKYRMRVVESKVQYIRQPKHRKADHGLGV |
Ga0211736_104015361 | 3300020151 | Freshwater | KIVYNRQMKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKATDELRV |
Ga0211733_104831245 | 3300020160 | Freshwater | MRPRNLVAKDLRTPKYRMRTVESKVKYIRQPKHRKADHGLGV |
Ga0211731_108419691 | 3300020205 | Freshwater | VYNKPLKPKNLVAKDLRTPKYRMRVVESKVQYIRQPKHRKADH |
Ga0211731_114957054 | 3300020205 | Freshwater | MKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKADHGLGV |
Ga0214254_1000005209 | 3300020715 | Freshwater | MRPRNPVAKDLRTPKYRMRTVESKVKYIRNPKHRKADHGLGV |
Ga0214252_10000411 | 3300020720 | Freshwater | VYNKPMRPRNPVAKDLRTPKYRMRTVESKVKYIRNPK |
Ga0222714_100317867 | 3300021961 | Estuarine Water | VYNISSKPKNLVAKDLRTPKYRMRVVESKVRYTRKTKHRKGAYESRISE |
Ga0222714_100801336 | 3300021961 | Estuarine Water | MYNKQMKPRNPIAKDVRTPKYRMRVVESKVHYNRKEKHKHVLSTQD |
Ga0222714_100942208 | 3300021961 | Estuarine Water | MYNKTLKPRNPIAKDLRTPKYRMRTVESKVKYIRNPKHKKESYEQNV |
Ga0222713_1000031494 | 3300021962 | Estuarine Water | MKVVYNSIKPRNPIAKDLRTPKYRMRKVESKVQYTRQPKHKKGSYEYQY |
Ga0222713_1000961914 | 3300021962 | Estuarine Water | MKVVYNSIKPRNPVAKDLRTPKYRMRKVESKVQYTRQPKHKKGGYEY |
Ga0222712_100053478 | 3300021963 | Estuarine Water | MAYNKSMKPRDLVAKDLRTPKYRMRVVESKVKYNRKPKHKKESYEREQSSLQG |
Ga0224500_1000322610 | 3300022213 | Sediment | MYNKVMKPRNPIAKDVRTPKYRMRVVESKVHYTRKEKHKHALSTQT |
Ga0181351_10146957 | 3300022407 | Freshwater Lake | MRPRNLIAKDLRTPKYRMRTVESKVKYIRQPKHRKVMQDGL |
Ga0236341_10091325 | 3300022591 | Freshwater | MRPRNPIAKDLRTPKYRMRTVESKVKYVRQPKHRKVMQDGL |
Ga0236341_10529444 | 3300022591 | Freshwater | MYNSKLKPRDPIAKDLRTPKYRMRVVESRVQYIRKPKHKKELYESQL |
Ga0228701_1000041197 | 3300022746 | Freshwater | MAYNKSMKPRDLVAKDLRTPKYRMRVVESKVKYTRKAKHKKESYEREQSSLQG |
Ga0228703_11348042 | 3300022747 | Freshwater | MKPRDLVAKDLRTPKYRMRVVESKVKYTRKAKHKKESYEREQSSLQG |
Ga0214921_1000146147 | 3300023174 | Freshwater | MKVVYNSIKPRNLVAKDLRTPKYRMRTVESKVKYTRQPKHKKGGYEYQY |
Ga0214921_1000281741 | 3300023174 | Freshwater | MYNKRMKPRDPIAKDLRTPKYRQRREESKVQYIRQPKHRKADHGLGI |
Ga0214921_1000291018 | 3300023174 | Freshwater | MKVVYNSIKPRNPVAKDLRTPKYRMRKVESKVQYTRQPKHKKGSYEY |
Ga0228709_10650003 | 3300023708 | Freshwater | MYNKRMKPRDPIAKDLRTPKYRQRREESKVQYIRQPKHRKADHGLGV |
Ga0255147_100022118 | 3300024289 | Freshwater | MKVVYNSIKPRNLVAKDLRTPKYRMRTVESKIKYTRQPKHKKGGYEYQY |
Ga0255238_11228111 | 3300024568 | Freshwater | PIAKDLRTPKYRQRRVESKVQYIRQPKHRKANDGI |
Ga0256339_10918931 | 3300024857 | Freshwater | PRNPVAKDLRTPKYRMRKVESKVQYTRQPKHKKGGYEY |
Ga0255274_10317116 | 3300026570 | Freshwater | RNLVAKDLRTPKYRMRTVESKIKYTRQPKHKKGGYEYQY |
Ga0255289_10418201 | 3300026571 | Freshwater | SIKPRNLVAKDLRTPKYRMRTVESKVKYTRQPKHKKGGYEYQY |
Ga0255269_100047416 | 3300026573 | Freshwater | MKVGYNSIKPRNLVAKDLRTPKYRMRTVESKIKYTRQPKHKKGGYEYQY |
Ga0255269_11492531 | 3300026573 | Freshwater | MKVVYNSIKPRNPVAKDLRTPKYRMRKAESKVQYTRQPKHKKGGYEY |
Ga0208176_10319091 | 3300027248 | Estuarine | DIVYNKPLKPRNLVAKDLRTPKYRMRVVESKVQYIRQPKHRKADHGLGV |
Ga0208932_10427764 | 3300027256 | Estuarine | LKPRNLVAKDLRTPKYRMRVVESKVQYIRQPKHRKADHGLGV |
Ga0255146_100058517 | 3300027396 | Freshwater | IKMKVVYNSIKPRNLVAKDLRTPKYRMRTVESKIKYTRQPKHKKGGYEYQY |
Ga0208966_10129349 | 3300027586 | Freshwater Lentic | MKTKYNLPKPRNPIARDLRTPKYRMRTVDSKVQYIRQPKHKKDIYEQRV |
Ga0208974_10052912 | 3300027608 | Freshwater Lentic | MYNNKTLKRRNPIAKDLRTPKYRQRVVESKVQYIRNPKHKKDTYESQL |
Ga0208975_100021739 | 3300027659 | Freshwater Lentic | MYNRTMKPRNPIAKDLRTPKYRMRKVESKVQYIRQPKHRKATDEL |
Ga0208975_10092576 | 3300027659 | Freshwater Lentic | MKTKYNLPKPRNPIARDLRTPKYRMRTVDSKVQYIRQPKHKKGIYEQRV |
Ga0208975_10263866 | 3300027659 | Freshwater Lentic | MYNNKTLKRRNPIAKDLRTPKCRQRVVESKVQYIRNPKHKKDTYESQL |
Ga0209033_10324884 | 3300027697 | Freshwater Lake | VYNISSKPKNLVAKDLRTPKYRMRVVESKVRYTRKTKHKKGAYESRVSE |
Ga0209188_100007653 | 3300027708 | Freshwater Lake | MYNKRMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHKKDIYES |
Ga0209188_100074913 | 3300027708 | Freshwater Lake | MRPRNPVAKDLRTPKYRMRTVESKVKYIRKPKHRKVDHGLGV |
Ga0209188_100368724 | 3300027708 | Freshwater Lake | MKIKYNLPKPRNLVARDLRTPKYKMRVVDSKVKYTRQPKHKKETYEHAL |
Ga0209188_10269264 | 3300027708 | Freshwater Lake | MYNKPLKPKNLVAKDLRTPKYRMRVVESKIQYIRQPKHKKGNYDQL |
Ga0209599_10000035140 | 3300027710 | Deep Subsurface | MYNKLKPRDPIAKDLRTPKYRMRVVESKVKYTRKSKHTKDNYGQYL |
Ga0209499_11647984 | 3300027712 | Freshwater Lake | MKLKYNLPKPRNLVAKDLRTPKYKMRVVDSKVIYIRQPKHRKINNEFE |
Ga0209442_10085253 | 3300027732 | Freshwater Lake | MKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKAKDEL |
Ga0209442_10287043 | 3300027732 | Freshwater Lake | MYNRTMKPRNPIAKDLHTPKYRMRKVESKVQYIRQPKHRKATDEL |
Ga0209297_13313613 | 3300027733 | Freshwater Lake | MYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHRKATDEL |
Ga0209087_10123941 | 3300027734 | Freshwater Lake | MYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHKKDIYES |
Ga0209087_12372892 | 3300027734 | Freshwater Lake | MKTKYNLPKPRNPVAKDLRTPKYKMRVVESKVSYIRQPKHKKDTYESE |
Ga0209085_10279277 | 3300027741 | Freshwater Lake | MYNKTMKPRNPIAKDLRTPKYRMRVVESKVQYIRQPKHRKATDEL |
Ga0209355_100371512 | 3300027744 | Freshwater Lake | MKPRNLIAKDLRTPKYRMRKVESKVQYIRQPKHRKADHGLGV |
Ga0209444_100239028 | 3300027756 | Freshwater Lake | VYNRQMKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKADHGLGV |
Ga0209500_100198466 | 3300027782 | Freshwater Lake | MYNKPMKPRNLVAKDLRTPKYRMRVVESKVQYVRQPKHRKPNHVE |
Ga0209500_100919533 | 3300027782 | Freshwater Lake | LQNFKVALQMKTKYNLPKPRNPVAKDLRTPKYKMRVVESKVSYIRQPKHKKDTYESE |
Ga0209500_101955561 | 3300027782 | Freshwater Lake | MYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHKK |
Ga0209246_101259951 | 3300027785 | Freshwater Lake | VYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHRKATDE |
Ga0209972_100018046 | 3300027793 | Freshwater Lake | MYNKTSKPRNPVAKDLRTPKYRMRKVESKVKYTRNPKHKKESYGQYL |
Ga0209191_10121136 | 3300027969 | Freshwater Lake | MKTKYNLPKPRNPVARDLRTPKYKMRVVDSKVQYIRQPKHKKDIYEQRV |
Ga0209191_10222421 | 3300027969 | Freshwater Lake | MYNKTMKPRNPIAKDLRTPKYRMRKVESRVQYIRQPKHRKADYGLGV |
Ga0209401_12771231 | 3300027971 | Freshwater Lake | VYNKPMRPRNLVAKDLRTPKYRMRTVGSKVKYIRQPKHR |
Ga0247723_10003245 | 3300028025 | Deep Subsurface Sediment | MYNKTLKPRDPVAKDLRTPKYRMRVVESKVQYIRKPKHRKEDYES |
Ga0247723_100376316 | 3300028025 | Deep Subsurface Sediment | MRPRNLIAKDLRTPKYRMRTVESKVKYIRQPKHRKADHGLGV |
Ga0256335_10095057 | 3300028112 | Freshwater | NSIKPRNLVAKDLRTPKYRMRTVESKIKYTRQPKHKKGGYEYQY |
Ga0304728_100115969 | 3300028393 | Freshwater Lake | DMYNKTMKPRNPIAKDVRTPKYRMRVVESKVQYIRQPKHKKDIYES |
Ga0315900_100055292 | 3300031787 | Freshwater | MKTQYNKPKNLVAKDLRTPKYRMRVVDSKIAFTRKPKHKKDLYEQP |
Ga0315909_100266154 | 3300031857 | Freshwater | VYNISSKPKNLVAKDLRTPKYRMRVVESKVLYTRKTKHKKGAYESKISE |
Ga0315909_105347641 | 3300031857 | Freshwater | VYNIKLKPRDLVAKDLRTPKYRMRVVESKVQYTRKTKHKRT |
Ga0315905_1000325819 | 3300032092 | Freshwater | MYNKTMKPRNPIAKDLRTPKYRMRVVESKVQYIRQPKHRKVNNEFQ |
Ga0315905_1000474616 | 3300032092 | Freshwater | MKVYNKTLKPRDPIAKDLRTPKYRMRVVESRVQYIRKPKHRKEDYES |
Ga0334996_0217106_861_1007 | 3300033994 | Freshwater | GKKVYNKRMKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKAKDEL |
Ga0335020_0177465_395_517 | 3300034082 | Freshwater | MKPRDPIAKDLRTPKYRMRVVESKVQYIRQPKHRKATDEL |
⦗Top⦘ |