Metagenome Family F036571

Overview

Basic Information

• Family ID: F036571
• Family Type: Metagenome
• Number of Sequences: 169
• Average Sequence Length: 40 residues
• Representative Sequence: MKLNKVQFDSMAFQERNGTCGMKPERSGRNLAEKSGTDRDLK
• Number of Associated Samples: 23
• Number of Associated Scaffolds: 168

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 29.52 %
• % of genes near scaffold ends (potentially truncated): 53.25 %
• % of genes from short scaffolds (< 2000 bps): 56.80 %
• Associated GOLD sequencing projects: 23
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (65.680 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (84.024 % of family members)
• Environment Ontology (ENVO): Unclassified (99.408 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (75.148 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 18.57%
  β-sheet: 0.00%
  Coil/Unstructured: 81.43%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 168 Family Scaffolds
PF07727	RVT_2	1.79
PF00067	p450	1.19
PF01490	Aa_trans	0.60
PF00515	TPR_1	0.60
PF01814	Hemerythrin	0.60
PF00112	Peptidase_C1	0.60
PF01425	Amidase	0.60
PF11995	DUF3490	0.60
PF08240	ADH_N	0.60
PF00462	Glutaredoxin	0.60
PF00679	EFG_C	0.60
PF03732	Retrotrans_gag	0.60
PF11834	KHA	0.60
PF14368	LTP_2	0.60
PF13460	NAD_binding_10	0.60
PF01494	FAD_binding_3	0.60
PF01546	Peptidase_M20	0.60
PF03552	Cellulose_synt	0.60
PF00078	RVT_1	0.60
PF01734	Patatin	0.60
PF01754	zf-A20	0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 168 Family Scaffolds
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.19
COG2124	Cytochrome P450	Defense mechanisms [V]	1.19
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.60
COG0531	Serine transporter YbeC, amino acid:H+ symporter family	Amino acid transport and metabolism [E]	0.60
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.60
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.60
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.60
COG0814	Amino acid permease	Amino acid transport and metabolism [E]	0.60
COG1215	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase	Cell motility [N]	0.60
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.60
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.60
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.60

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
All Organisms	root	All Organisms	34.32 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
cellular organisms	root	All Organisms → cellular organisms	34.32 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	34.32 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	34.32 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	34.32 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	34.32 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	34.32 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	21.89 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	21.89 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	21.89 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	21.89 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	18.34 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	17.75 %
Trochodendrales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales	0.59 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	17.75 %
Trochodendraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae	0.59 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	17.75 %
Tetracentron	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron	0.59 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	17.16 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.59 %
Tetracentron sinense	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron → Tetracentron sinense	0.59 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	17.16 %
lamiids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids	0.59 %
Tetracentron sinense	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron → Tetracentron sinense	0.59 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	16.57 %
Solanales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales	0.59 %
Fagales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales	0.59 %
Tetracentron sinense	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron → Tetracentron sinense	0.59 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	15.98 %
Solanaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae	0.59 %
Fagaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae	0.59 %
Tetracentron sinense	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron → Tetracentron sinense	0.59 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	15.98 %
Solanoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae	0.59 %
Fagus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Fagus	0.59 %
Tetracentron sinense	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron → Tetracentron sinense	0.59 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	13.61 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	1.18 %
Capsiceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Capsiceae	0.59 %
Fagus sylvatica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Fagus → Fagus sylvatica	0.59 %
Tetracentron sinense	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron → Tetracentron sinense	0.59 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8.88 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	1.18 %
Populus tomentosa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	0.59 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.59 %
Capsicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Capsiceae → Capsicum	0.59 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.59 %
Fagus sylvatica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Fagus → Fagus sylvatica	0.59 %
Tetracentron sinense	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron → Tetracentron sinense	0.59 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	65.68 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8.88 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	1.18 %
Capsicum baccatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Capsiceae → Capsicum → Capsicum baccatum	0.59 %
Populus tomentosa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	0.59 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.59 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.59 %
Fagus sylvatica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Fagus → Fagus sylvatica	0.59 %
Tetracentron sinense	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron → Tetracentron sinense	0.59 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300006904|Ga0075424_102356835	Not Available	559
3300028786|Ga0307517_10000831	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	53092
3300028786|Ga0307517_10015232	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10237
3300028786|Ga0307517_10015625	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	10068
3300028786|Ga0307517_10019545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8683
3300028786|Ga0307517_10021851	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8053
3300028786|Ga0307517_10023611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	7632
3300028786|Ga0307517_10026257	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7067
3300028786|Ga0307517_10037258	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5437
3300028786|Ga0307517_10053274	Not Available	4032
3300028786|Ga0307517_10059269	Not Available	3669
3300028786|Ga0307517_10060253	Not Available	3616
3300028786|Ga0307517_10083517	Not Available	2699
3300028786|Ga0307517_10098733	Not Available	2321
3300028786|Ga0307517_10142523	Not Available	1676
3300028786|Ga0307517_10225537	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1132
3300028786|Ga0307517_10286929	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	933
3300028786|Ga0307517_10331372	Not Available	836
3300028786|Ga0307517_10382776	Not Available	751
3300028786|Ga0307517_10421729	Not Available	699
3300028786|Ga0307517_10552255	Not Available	575
3300028794|Ga0307515_10004090	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	30413
3300028794|Ga0307515_10023261	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	10868
3300028794|Ga0307515_10037766	Not Available	7750
3300028794|Ga0307515_10042007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7170
3300028794|Ga0307515_10066450	Not Available	4995
3300028794|Ga0307515_10078857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4323
3300028794|Ga0307515_10085515	Not Available	4034
3300028794|Ga0307515_10088024	Not Available	3931
3300028794|Ga0307515_10110417	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	3218
3300028794|Ga0307515_10133012	Not Available	2724
3300028794|Ga0307515_10133233	Not Available	2720
3300028794|Ga0307515_10135667	Not Available	2678
3300028794|Ga0307515_10137042	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2653
3300028794|Ga0307515_10406362	Not Available	985
3300028794|Ga0307515_10510861	Not Available	811
3300028794|Ga0307515_10529023	Not Available	788
3300028794|Ga0307515_10595916	Not Available	715
3300028794|Ga0307515_10780541	Not Available	576
3300028794|Ga0307515_10915176	Not Available	509
3300028794|Ga0307515_10920515	Not Available	507
3300030521|Ga0307511_10013422	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	8006
3300030521|Ga0307511_10046760	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3553
3300030521|Ga0307511_10050986	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3325
3300030521|Ga0307511_10056635	Not Available	3061
3300030521|Ga0307511_10080099	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2303
3300030521|Ga0307511_10134512	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1476
3300030521|Ga0307511_10157200	Not Available	1287
3300030521|Ga0307511_10255466	Not Available	837
3300030521|Ga0307511_10267138	Not Available	804
3300030521|Ga0307511_10268816	Not Available	800
3300030521|Ga0307511_10319557	Not Available	687
3300030521|Ga0307511_10412820	Not Available	549
3300030522|Ga0307512_10027418	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Fagus → Fagus sylvatica	5011
3300030522|Ga0307512_10042232	Not Available	3778
3300030522|Ga0307512_10042533	Not Available	3760
3300030522|Ga0307512_10058443	Not Available	3004
3300030522|Ga0307512_10059031	Not Available	2981
3300030522|Ga0307512_10060747	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2918
3300030522|Ga0307512_10137301	Not Available	1509
3300030522|Ga0307512_10141830	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1468
3300030522|Ga0307512_10147026	Not Available	1422
3300030522|Ga0307512_10204608	Not Available	1061
3300030522|Ga0307512_10237242	Not Available	928
3300030522|Ga0307512_10246242	Not Available	897
3300030522|Ga0307512_10326153	Not Available	694
3300030522|Ga0307512_10432871	Not Available	538
3300030522|Ga0307512_10468429	Not Available	502
3300031456|Ga0307513_10045917	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	4770
3300031456|Ga0307513_10128105	Not Available	2489
3300031456|Ga0307513_10301620	Not Available	1368
3300031456|Ga0307513_10776732	Not Available	663
3300031507|Ga0307509_10067448	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3748
3300031507|Ga0307509_10067448	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3748
3300031507|Ga0307509_10075712	Not Available	3495
3300031507|Ga0307509_10115832	Not Available	2671
3300031507|Ga0307509_10126394	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2521
3300031507|Ga0307509_10181125	Not Available	1971
3300031507|Ga0307509_10333229	Not Available	1248
3300031507|Ga0307509_10455982	Not Available	971
3300031507|Ga0307509_10587571	Not Available	787
3300031507|Ga0307509_10681095	Not Available	695
3300031507|Ga0307509_10781859	Not Available	619
3300031507|Ga0307509_10904503	Not Available	547
3300031616|Ga0307508_10120638	Not Available	2224
3300031616|Ga0307508_10166374	Not Available	1808
3300031616|Ga0307508_10172471	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1766
3300031616|Ga0307508_10212127	Not Available	1536
3300031616|Ga0307508_10242101	Not Available	1401
3300031616|Ga0307508_10368456	Not Available	1027
3300031616|Ga0307508_10383019	Not Available	997
3300031616|Ga0307508_10389111	Not Available	985
3300031616|Ga0307508_10459449	Not Available	866
3300031616|Ga0307508_10474460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	844
3300031616|Ga0307508_10566484	Not Available	735
3300031616|Ga0307508_10674039	Not Available	641
3300031616|Ga0307508_10728326	Not Available	603
3300031616|Ga0307508_10800628	Not Available	559
3300031616|Ga0307508_10870013	Not Available	524
3300031616|Ga0307508_10908694	Not Available	507
3300031649|Ga0307514_10026892	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4650
3300031649|Ga0307514_10070222	Not Available	2631
3300031649|Ga0307514_10144144	Not Available	1612
3300031649|Ga0307514_10174126	Not Available	1399
3300031649|Ga0307514_10190877	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1304
3300031649|Ga0307514_10196939	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1273
3300031649|Ga0307514_10209536	Not Available	1212
3300031649|Ga0307514_10237422	Not Available	1096
3300031649|Ga0307514_10328384	Not Available	833
3300031649|Ga0307514_10384553	Not Available	726
3300031649|Ga0307514_10394501	Not Available	710
3300031649|Ga0307514_10555018	Not Available	528
3300031730|Ga0307516_10106885	Not Available	2608
3300031730|Ga0307516_10403778	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Capsiceae → Capsicum → Capsicum baccatum	1025
3300031730|Ga0307516_10531787	Not Available	829
3300031730|Ga0307516_10689545	Not Available	678
3300031730|Ga0307516_10703570	Not Available	667
3300031730|Ga0307516_10977900	Not Available	517
3300031730|Ga0307516_10992578	Not Available	511
3300031838|Ga0307518_10027903	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4073
3300031838|Ga0307518_10028429	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4035
3300031838|Ga0307518_10073758	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2469
3300031838|Ga0307518_10117785	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1884
3300031838|Ga0307518_10325507	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	914
3300031838|Ga0307518_10417127	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	738
3300032354|Ga0325403_1017539	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	6604
3300032354|Ga0325403_1033013	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4252
3300032354|Ga0325403_1044646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3275
3300032354|Ga0325403_1048520	Not Available	3019
3300032354|Ga0325403_1058409	Not Available	2478
3300032354|Ga0325403_1065635	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2163
3300032354|Ga0325403_1079735	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1673
3300032354|Ga0325403_1083355	Not Available	1569
3300032354|Ga0325403_1101099	Not Available	1165
3300032354|Ga0325403_1155612	Not Available	592
3300032354|Ga0325403_1172218	Not Available	503
3300032355|Ga0325401_1073658	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2217
3300032355|Ga0325401_1115887	Not Available	1303
3300032374|Ga0325400_1001147	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	21586
3300032389|Ga0325405_1022722	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5329
3300032389|Ga0325405_1030172	Not Available	4216
3300032389|Ga0325405_1040432	Not Available	3190
3300032389|Ga0325405_1076929	Not Available	1344
3300032390|Ga0325404_1034460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Trochodendrales → Trochodendraceae → Tetracentron → Tetracentron sinense	3751
3300032735|Ga0325410_1062904	Not Available	1728
3300032741|Ga0325414_1013517	Not Available	8291
3300033179|Ga0307507_10097681	Not Available	2476
3300033179|Ga0307507_10113864	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2196
3300033179|Ga0307507_10131182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	1960
3300033179|Ga0307507_10169960	Not Available	1586
3300033179|Ga0307507_10175220	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1547
3300033179|Ga0307507_10230854	Not Available	1227
3300033179|Ga0307507_10246361	Not Available	1161
3300033179|Ga0307507_10248105	Not Available	1154
3300033179|Ga0307507_10294404	Not Available	1001
3300033179|Ga0307507_10298027	Not Available	991
3300033179|Ga0307507_10443749	Not Available	719
3300033179|Ga0307507_10466015	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	692
3300033179|Ga0307507_10689278	Not Available	512
3300033180|Ga0307510_10022723	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	7276
3300033180|Ga0307510_10222154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1399
3300033180|Ga0307510_10303103	Not Available	1059
3300034389|Ga0325419_021185	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5848
3300034389|Ga0325419_062919	Not Available	1747
3300034688|Ga0325420_020909	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5405
3300034778|Ga0325423_008951	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10058

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	84.02%
Wood	Host-Associated → Plants → Wood	12.43%
Phylloplane	Host-Associated → Plants → Phylloplane	2.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.59%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	84.02%
Unclassified	Host-Associated → Plants → Wood → Unclassified	12.43%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	2.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.59%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	84.02%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	12.43%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	2.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.59%

Habitat

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	84.02%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	12.43%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	2.96%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.59%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated
3300032741	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3	Host-Associated
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated
3300034688	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1	Host-Associated
3300034778	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0075424_1023568351	3300006904	Populus Rhizosphere	MTFQERNGTCGMKPERSERNLAEKSGTDRDLK*DEI
Ga0307517_100008311	3300028786	Ectomycorrhiza	LIKLNKVQFDSMAFQERNGTCGMKPERSGWNLAEKSGTDRDLK
Ga0307517_100152325	3300028786	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGRNLAEKCRTDQDLK
Ga0307517_100156251	3300028786	Ectomycorrhiza	KVQFDSMAFQERNGTCGMKQERSGWNLAEKSGTNRDLK
Ga0307517_1001954512	3300028786	Ectomycorrhiza	MWNETGTQERNGTCEMKHERSGWNLAEKSGTDRDLK
Ga0307517_100218515	3300028786	Ectomycorrhiza	MKLNKVQFDSMTFQERNETCGMKSKRSGWNLAEKSGTDRDLK
Ga0307517_100236112	3300028786	Ectomycorrhiza	MKLNKVQFDSMAFQEQNRTCGMKPERSGRNLAEKIGTDRDLK
Ga0307517_100262572	3300028786	Ectomycorrhiza	LIQFNSMAFQERNETCGMEPERSGWNLAEKSGTDRDLK
Ga0307517_100372581	3300028786	Ectomycorrhiza	MKLNKVQFDSMTFQERNEIFGMKPERSGQNLAEKSGTDRDLK
Ga0307517_100532746	3300028786	Ectomycorrhiza	MKLNKVQFDLMAFQEWNGTCGMKPERSGRNLAKKFRTDRDLK
Ga0307517_100548422	3300028786	Ectomycorrhiza	MILLIKLNQVQFDSMVFQDQNGTCGMKLEHSSRNLAEKSGMDRDLK
Ga0307517_100592695	3300028786	Ectomycorrhiza	MAFQERNGTCGMKLERSGRNLAEKSGTDRDLKLDEICSVF
Ga0307517_100602531	3300028786	Ectomycorrhiza	KVQFDSMAFQERNGTCGMKPERSGRNLAEKSRTDQDLK
Ga0307517_100835173	3300028786	Ectomycorrhiza	MKLNKVQFDSMAFQERNRTCGMKPERSGRNLAEKSGTDRDLK
Ga0307517_100987332	3300028786	Ectomycorrhiza	MKLNQVQFHSMAFQDWNETCGMKPKHSGRNLAEKYKTDRDLK
Ga0307517_101425231	3300028786	Ectomycorrhiza	LIKLNKVQFDSMAFQERNGTCGMKPERSGRNLAEKSGTDRDLK
Ga0307517_102255372	3300028786	Ectomycorrhiza	MKFNKVQFNSMTFQERNGTYGMKPERSGRNLAEKSGMDRDLK
Ga0307517_102869291	3300028786	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGRNLAEKSGTDRDLK
Ga0307517_103313722	3300028786	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGWNLAEKSGTDRDLK
Ga0307517_103827761	3300028786	Ectomycorrhiza	FDSMAFQERNGTCGMKPERSGRNLAEKSGTDQDLK
Ga0307517_104217291	3300028786	Ectomycorrhiza	NKVQFDSMTFQERNGICGMKPKRFRRNLAEKYGTDRDLK
Ga0307517_105522551	3300028786	Ectomycorrhiza	LIKLNKVQFDSMTFQERNGTCGMKQERSGWNLAEKSGTD
Ga0307515_1000409015	3300028794	Ectomycorrhiza	MKLNKVQFHSMTFQERNGTCGMKQERSGWNLAEKFGTDRDLK
Ga0307515_100232618	3300028794	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGWNLTEKSETDRDLK
Ga0307515_100377661	3300028794	Ectomycorrhiza	VQFDSMTFQERNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307515_100420078	3300028794	Ectomycorrhiza	QFDSMVFQERNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307515_100664501	3300028794	Ectomycorrhiza	KLNKVQFDSMTFQERNGTCGMKPERSGRNLAEKSRTNRDLK
Ga0307515_100788572	3300028794	Ectomycorrhiza	LNKVQFDSMAFQERNETCGMKPEYFGRNLVEKSETDRDLKXDKNYYVF
Ga0307515_100855154	3300028794	Ectomycorrhiza	MKLNKVQFDSMAFQERNRTCGMKPERSGRNLAEKSRTDRDLK
Ga0307515_100880247	3300028794	Ectomycorrhiza	MKLNKVQFDLMAFQERNGTCGMKPERSGRNLAKKFRTDRDLK
Ga0307515_101104171	3300028794	Ectomycorrhiza	KLNKVQFDSMAFQERNGTCGMKQERSGWNLAEKSRTNLDLK
Ga0307515_101330121	3300028794	Ectomycorrhiza	KVQFDSIAFQERNETCGMKQERSGWNLAEKSGTDRDLK
Ga0307515_101332333	3300028794	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGRNLAEKCRTDQDLKXDKICSVF
Ga0307515_101356672	3300028794	Ectomycorrhiza	MKLNKVQFDSMAFQERNRTCGMESECSGRNLTEKFRTDRDLK
Ga0307515_101370421	3300028794	Ectomycorrhiza	QFDSMTFQERNGTCGMKPERSGWNLAEKSGTDRDLK
Ga0307515_104063621	3300028794	Ectomycorrhiza	MKLYKVQFDSMAFQERNGTCGMKPERSGQNLAEKSGTDRDLK
Ga0307515_105108612	3300028794	Ectomycorrhiza	KVQFDSMAFQERNGTCGMEPERSGRNLAEKSGTDRDLK
Ga0307515_105290232	3300028794	Ectomycorrhiza	LNKVQFDQKAFQEWNGICGMKAERSGRDLAEKSGTDRDLK
Ga0307515_105959161	3300028794	Ectomycorrhiza	FDSMTFQERNGTCGMKQERSRWNLAEKSGTDRDLK
Ga0307515_107805411	3300028794	Ectomycorrhiza	KLNNVQFDSMAFQERNGTCGMKPERSGRNLAEKSGTDRDLKLDEICSVF
Ga0307515_109151761	3300028794	Ectomycorrhiza	LIKLNKVQFDSMTFQERNGTCGMKQKRSGWNLAEKSGTDRDLK
Ga0307515_109205151	3300028794	Ectomycorrhiza	KLNKVQFDSMTFQERNGTCGMKTERSGQNLAEKSGTDRDLK
Ga0307511_1001342213	3300030521	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGQNLAKKSGTNQDLK
Ga0307511_100467601	3300030521	Ectomycorrhiza	KLNKVQFDSMAFQEQNGTCGMKPERSGRNLAEKSRTDRDLK
Ga0307511_100509864	3300030521	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGRNLAEKSRTDQDLK
Ga0307511_100566352	3300030521	Ectomycorrhiza	QFDSMAFQERNGTCGMKPEHSWWNLAEKSRTDQDLK
Ga0307511_100800993	3300030521	Ectomycorrhiza	VQFDSIAFQERNGTCGMKPERSGRNLAEISETDQDLK
Ga0307511_101345121	3300030521	Ectomycorrhiza	IQFNSLAFQERNRTCGMEPERSGRNLAEKSGTDRDLK
Ga0307511_101572001	3300030521	Ectomycorrhiza	VQFDSMTFQERNGTYGMKPERSGWNLAEKSGTDRDLK
Ga0307511_102554661	3300030521	Ectomycorrhiza	VQFDSMAFQEQNETCEMKPERSGWNLAEKSGTDRDLK
Ga0307511_102671382	3300030521	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGIKPENFRQNLAEKSETDQDLK
Ga0307511_102688161	3300030521	Ectomycorrhiza	LIKLNQIQFDSMVFQNRNRTCGMKPKHSSQNLANKSGTDRDLK
Ga0307511_103195571	3300030521	Ectomycorrhiza	VQFDSMTFQERNGTCGMKQERSRWNLAEKSGTDRDLK
Ga0307511_104128201	3300030521	Ectomycorrhiza	VQFDSMAFQERNGTCGMKQERSEWNLAEKSGMDRDLK
Ga0307512_100274183	3300030522	Ectomycorrhiza	LNKVQFDSNAFQEQNGTCGMKPERSGRNLAEKSGTDRDLK
Ga0307512_100422322	3300030522	Ectomycorrhiza	LNKVQFDSMAFQERNGTCGMKQKRSGWNLAEKSGTDRDLK
Ga0307512_100425334	3300030522	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGRNLAEKCRTDQDLKXDKICFVF
Ga0307512_100584431	3300030522	Ectomycorrhiza	QFDSMAFQERNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307512_100590315	3300030522	Ectomycorrhiza	FDSIAFQERNGTCGMKPERSGRNLAEKSGTNQDLK
Ga0307512_100607474	3300030522	Ectomycorrhiza	FDSMTFQERNGTCGMKPERSGRNLAKKSGTDRDLK
Ga0307512_101373011	3300030522	Ectomycorrhiza	LIKLNKVQFDSMTFQERNGTCGMKPKRSGRNLAEKSGTDRDLK
Ga0307512_101418301	3300030522	Ectomycorrhiza	QFDSMTFQERNGTCGMKPERSERNLAEKSGTDQDLK
Ga0307512_101470262	3300030522	Ectomycorrhiza	MKLNQVQFHSMAFQDWNETCGMKPKHSGRNLAEKYKTDRD
Ga0307512_102046081	3300030522	Ectomycorrhiza	LNKIQFDSMIFQERNGTCGMKPERSGRNLAEKSGTD
Ga0307512_102372421	3300030522	Ectomycorrhiza	QGPMAFQERNEICGMKPERSGRNLAKKSGTDRDLK
Ga0307512_102462421	3300030522	Ectomycorrhiza	LIKLNKIQFDSMTFQERNGTCGMKPERSGRNLAEKSGTDRDLK
Ga0307512_103261531	3300030522	Ectomycorrhiza	IKLNKIQFDSMAFQERNGTCGMKPERSGRNLAEKSGTDRDLK
Ga0307512_104328711	3300030522	Ectomycorrhiza	FDSMAFQERNGTCGMEPERSGRNLAEKSGMDRDLK
Ga0307512_104684291	3300030522	Ectomycorrhiza	LNKVQFDSMIFQERNGTCGMKPECFGXNLAKKSKIDRDLK
Ga0307513_100459175	3300031456	Ectomycorrhiza	MKLSKVQFDSMAFQKWNGTCGMKPERFGRNLAEKSGTDRDLK
Ga0307513_101281052	3300031456	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERPGWNLAEKSETDRDLK
Ga0307513_103016201	3300031456	Ectomycorrhiza	LIKLNKVQFDSMAFQERNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307513_107767321	3300031456	Ectomycorrhiza	MAFQERNGTCGMKPERSGRNLAEKSGTDRDLKLDEICSVF
Ga0307509_100674483	3300031507	Ectomycorrhiza	MKLNQVQFDSIAFQDRNGTCGMKPKHSGRNLAEKYKTGRDLK
Ga0307509_100674484	3300031507	Ectomycorrhiza	MKLNQVQFHSMAFQDWNETCGMKPKHSGRNLAEKYKTGRDLK
Ga0307509_100757121	3300031507	Ectomycorrhiza	LIKLNKVQFDSMAFQERNGTCGMKLERSGRNLAKKSGTDRDLK
Ga0307509_101158323	3300031507	Ectomycorrhiza	KVQFDSMAFQERNGTCGMKPERSGRNLAEKSGTDRDLK
Ga0307509_101263941	3300031507	Ectomycorrhiza	IKLNKVQFDSTAFQERNGTCGMKLERSGRNLAEKSGTDRDLK
Ga0307509_101811251	3300031507	Ectomycorrhiza	QFDSMAFQERNGTCGMKPERSGRNLAEKSGTDRDLK
Ga0307509_103332291	3300031507	Ectomycorrhiza	QFDSMAFQERNGTCGMEPERFGRNLAEKSRTDRDLK
Ga0307509_104559821	3300031507	Ectomycorrhiza	VQFDSMAFQERNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307509_105875711	3300031507	Ectomycorrhiza	LNKVQFDSMTFQERNGTCGMKPERSGWNLAEKSRTDRNLK
Ga0307509_106810951	3300031507	Ectomycorrhiza	MKLNKIQFDSMTFQERNEIFGMKPERSGQNLAEKSGTDRDLK
Ga0307509_107818591	3300031507	Ectomycorrhiza	MKFNKVQFDSMAFQERNGTYGMKPERSGRNLAEKSGIDRDLK
Ga0307509_109045031	3300031507	Ectomycorrhiza	MKLNKVQFDSMAFQEWNRTCGMKPERSERNLAEKSGTD
Ga0307508_101206381	3300031616	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGWNLAEKSETDRDLK
Ga0307508_101663741	3300031616	Ectomycorrhiza	MKLNKVQFDSMTFQEWNGTCGMKPERSGRNLAEKCRTDQDLK
Ga0307508_101724711	3300031616	Ectomycorrhiza	MKFNKVQFNSMAFQERNGTYGMKPERSGRNLAEKSGMDRDLK
Ga0307508_102121271	3300031616	Ectomycorrhiza	MKLNKVQFDSMTFQERNGTCGMKPERSGQNLAEKSGTDRDL
Ga0307508_102421011	3300031616	Ectomycorrhiza	LNKVQFDLMAFQERNGTCGTKQERSGWNLAEKSGTDRD
Ga0307508_103684561	3300031616	Ectomycorrhiza	MKLNKVQFDSMAFQERNGTCGMKPERSGRNLAEKSRTDRDLK
Ga0307508_103830191	3300031616	Ectomycorrhiza	LNKVQFDSMTFQERNGTCGMKPERSGWNLAEKFRTDRNLK
Ga0307508_103891111	3300031616	Ectomycorrhiza	LNKVQFNSMAFQERNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307508_104594491	3300031616	Ectomycorrhiza	FDSMVFQERNGTCGMKPEHSGRNLAEKSGTARNLK
Ga0307508_104744601	3300031616	Ectomycorrhiza	VQFDSMAFQERNETCGMKQERSGWNLAEKSGTDRDLK
Ga0307508_105664841	3300031616	Ectomycorrhiza	MKLNKVQFDLMAFQERNGTCGMKLERSGRNLAEKSRTDRDLK
Ga0307508_106740391	3300031616	Ectomycorrhiza	IKLNKVQFDSMAFQERNGTCEMKPERSGWNLAEKSRTDRDLK
Ga0307508_107283261	3300031616	Ectomycorrhiza	LNKVQFDSMAFQERNRTCGMKPERSGQNLAEKSGTDRDLK
Ga0307508_108006281	3300031616	Ectomycorrhiza	KLNKVQFDSMTFQERNGTCGMKPERSERNLAEKSGTDRDLK
Ga0307508_108700131	3300031616	Ectomycorrhiza	NKVQFDSIAFQERNGTCGMKPERSGWNLAEKSGTDRDLK
Ga0307508_109086941	3300031616	Ectomycorrhiza	LNKVQFHSMAFQERNGTCGMKQERSGWNLAEKSRTDRDLK
Ga0307514_100268924	3300031649	Ectomycorrhiza	LNKVQFDSMTFQERNGTCGMKQERSGWNLAEKSRTGRDLK
Ga0307514_100702223	3300031649	Ectomycorrhiza	IKLNKVQFDSMAFQERNRTCGMKPERSGRNLAEKSGTDRNLK
Ga0307514_101441441	3300031649	Ectomycorrhiza	IQFDSMAFQERNGTYGMEPERSRRNLAKKSGTDRDLK
Ga0307514_101741261	3300031649	Ectomycorrhiza	LIKLNKVQFNSTAFQERNGTCGMKQERSGWNLAEKSRTDRDLK
Ga0307514_101908772	3300031649	Ectomycorrhiza	MILLIKLNQVQFDSMAFQDQNGTCGMKLEHSSRNLAEKSGMDRDLK
Ga0307514_101969391	3300031649	Ectomycorrhiza	KVQFDSMAFQERNGTCGMKPERSRWNLAEKSGTDRDLK
Ga0307514_102095361	3300031649	Ectomycorrhiza	MKLNKVQFDSMTFQEWNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307514_102374223	3300031649	Ectomycorrhiza	QFDSMAFQERNGTCGMEPERSGRNLAEKSGTFRDLK
Ga0307514_103283842	3300031649	Ectomycorrhiza	QFDLIAFQDWNGICGMKPEHSDRNLAEKSRTDRDLK
Ga0307514_103845532	3300031649	Ectomycorrhiza	KLNNVQFDSMAFQEQNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307514_103945011	3300031649	Ectomycorrhiza	MKLNKVQFDLTAFQERNETCGMKPERSGRNLAEKSRMDRDLK
Ga0307514_105550181	3300031649	Ectomycorrhiza	VQFDSIAFQERNGTCGMKPERSGWNLAEKSGTDRDLK
Ga0307516_101068853	3300031730	Ectomycorrhiza	QVQFDSMAFQDRNGTCGMKPKHSGRNLAEKYKTGRDLK
Ga0307516_104037781	3300031730	Ectomycorrhiza	LNKVQFDSMAFQERNGTCGMKQERSGWNLAEKSRTDRDLK
Ga0307516_105317871	3300031730	Ectomycorrhiza	MKLNKVQFDSMAFQEWNGTCGMKPERSERNLAEKSGTDXDLKXDEICSIF
Ga0307516_106895451	3300031730	Ectomycorrhiza	LIKLNKVQFDSMAFQERNETCGMKPERSMRNLAEKSGTDRDLK
Ga0307516_107035701	3300031730	Ectomycorrhiza	QFNSMAFQERNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307516_109779001	3300031730	Ectomycorrhiza	LNKVQFDSMAFQERNGTCGMKSERSGRNLAEKSGTDRDLK
Ga0307516_109925781	3300031730	Ectomycorrhiza	IKLNKIQFDSMVFQERNKTCGMKPERSGQNLAEKYRTDRDLK
Ga0307518_100279032	3300031838	Ectomycorrhiza	LIKLNKVQFDSIAFQERNGTCGMKPERSGWNLAEKSGTDRDLK
Ga0307518_100284293	3300031838	Ectomycorrhiza	MKLNQVQFDSMAFQDRNGTCGMKPKHSGRNLAEKYKTGRDLK
Ga0307518_100737582	3300031838	Ectomycorrhiza	KVQFDSMAFQERNGTCGMKPERSGRNLAEKSGMDRDLK
Ga0307518_101177851	3300031838	Ectomycorrhiza	MKLNKVQFDSMTFQERNEIFEMKPKRSGRNLAEKSGTDRDLK
Ga0307518_103255071	3300031838	Ectomycorrhiza	NRVQFDSITFQDRNETCEMKPEHSGRNLAEKSGTNRDLK
Ga0307518_104171271	3300031838	Ectomycorrhiza	KVQFDSMTFQERNETCGMKQERSGWNLAEKSGTGRNLK
Ga0325403_10175392	3300032354	Xylem	VILLIKLNKIQFDSIVFQEWNETYGMKPERSSRTLAEKSGTDQDLK
Ga0325403_10330131	3300032354	Xylem	MVQFDSMTFQERNGTCEMKSKHSRQNLAKKSRTDQDLK
Ga0325403_10446461	3300032354	Xylem	LNNVQFDSMAFQERNGKCGMKPERIGRNLAEKSGM
Ga0325403_10485201	3300032354	Xylem	MKLNKVQFNSMTFQERNGTCXIKLECSGWNLAVKSEMNQNLK
Ga0325403_10584093	3300032354	Xylem	MKLNKIQFDSMAFQEQNKTCGMKPERSGRYLAKKSGTDRDLK
Ga0325403_10656351	3300032354	Xylem	MVQFDSMAFQERNGTCGMKQERSGWNLAEKSRTDRDLK
Ga0325403_10797352	3300032354	Xylem	MKLNKVQFDLMTFQERNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0325403_10833551	3300032354	Xylem	MVQFDSMTFQKQNRTCRMKSENSGRNLAKKSGTDQDLK
Ga0325403_11010991	3300032354	Xylem	LNKVQFDSMAFQEQNRTCGMKPECSGWNLAEKSGMDKDLK
Ga0325403_11556122	3300032354	Xylem	MAFQERNGTCGMKSKRSGRNLAEKSRTDRDLKSDEI
Ga0325403_11722181	3300032354	Xylem	MVQFDSITFPEQNETCGMKPERSGRNLVEKSGTDQDLK
Ga0325401_10736582	3300032355	Xylem	MVQFDSMTFQERNGTCGMKQERSGWNLAEKSRTDRDLK
Ga0325401_11158871	3300032355	Xylem	MKLNKIQFDSMAFQEQNKTCGMKPERSGRYLAKKSGTDRDLKXDENCSVL
Ga0325400_10011479	3300032374	Xylem	MKLNKVQFDSMAFQERNGTCGMKPERSGRNLAEKSGTDRNLK
Ga0325405_10227221	3300032389	Xylem	MKLNKVQFDSKAFQERNGTCGMKPECSGWNLAEKSGTDRDLK
Ga0325405_10301721	3300032389	Xylem	MAFQKQNGTCGMKPERSNRNLAEKSGTDRDLKLDENCSVLFRFLN
Ga0325405_10404322	3300032389	Xylem	MAFQERNGTCGMKPKRFGWNLAEKSGTDRDLKRDEICSVF
Ga0325405_10656411	3300032389	Xylem	MKLNKIQFDSMAFQEQNKTCRMKTERFGRNLAKKSETDXDLKXDENCSVF
Ga0325405_10769291	3300032389	Xylem	MVQFDSMAFQERNGTCGMKQERFGWNLAEKSRTDRDLK
Ga0325404_10344601	3300032390	Xylem	VILLIKLNKIQFDSMVFQEWNETYGMKPERSSRTLAEKSGTDQDLK
Ga0325410_10629042	3300032735	Xylem	MKLNKVQFDLMTFPERNKTCRMKLERFERNLAEKSGMDRNLK
Ga0325414_10135172	3300032741	Leaf	MKLNNVQFDSMTFQEWNGTCGMKLERSRRNLAKKSRTNRNLK
Ga0307507_100659641	3300033179	Ectomycorrhiza	MVFQERNRTCGMKSERSGRNLVEKSRTDRDLKXDEN
Ga0307507_100976814	3300033179	Ectomycorrhiza	KLNKVQFDSMAFQERNGICGMKPERSWWNLAEKSGTDRDLK
Ga0307507_101138642	3300033179	Ectomycorrhiza	MILLIKLNQVQFDSMAFQDQNGTCGMKLEHSSRNLAEKSRMDRDLK
Ga0307507_101311825	3300033179	Ectomycorrhiza	FDSMAFQERNKTCGMEPERSGRNLAEKSGTDRDLK
Ga0307507_101699602	3300033179	Ectomycorrhiza	MAFQERNETCGMKPERSGRNLAEKSGTDRDLKSDEICSVL
Ga0307507_101752201	3300033179	Ectomycorrhiza	LNKVQFDSMAFQERNKTCGMKPERFGQNFAEKSGTDRDLK
Ga0307507_102308541	3300033179	Ectomycorrhiza	MVFQDQNRTCEMKLEYFGRNLAEKSGTDRDLKXDENC
Ga0307507_102463611	3300033179	Ectomycorrhiza	KLNKVQFDLMAFQEWNGTCGMKSECSSRNLAEKSGTNRDLK
Ga0307507_102481051	3300033179	Ectomycorrhiza	KIQFDSMTFQDRNGTCGMKQERSGWNLAEKSGTDRDLK
Ga0307507_102944041	3300033179	Ectomycorrhiza	LIKLNKVQFDSMAFQERNGTCEMKQERSGWNLAEKSGTDRDLK
Ga0307507_102980272	3300033179	Ectomycorrhiza	MKLNKVQFDSMTFQERNGTCGIKPENFRQNLAEKSETDQDLKXDEIYFILFYFLN
Ga0307507_104437491	3300033179	Ectomycorrhiza	LNKVQFDSTAFQERNGTCGMKPERSGRNLAEKSGTDRDLK
Ga0307507_104660151	3300033179	Ectomycorrhiza	MKLNKVQFDSMTFQERNGTCGMKPERSGRNLAEKSGTDRDLK
Ga0307507_106892782	3300033179	Ectomycorrhiza	KVQFDSMAFKERNGTCGMKPEYSGRNLVEKSETNRDLK
Ga0307510_100227239	3300033180	Ectomycorrhiza	VQFDSMVFQERNGTCGMKPERFGRNLAEKSGMDQDLK
Ga0307510_102221541	3300033180	Ectomycorrhiza	QFDSMAFQERNGTCGMKPERSGRNLAEKSGTDRDLN
Ga0307510_103031032	3300033180	Ectomycorrhiza	MKLNKVQFDLMAFQERNGTCGMKPERSGWNLAEKSGTERDLK
Ga0325419_021185_3179_3295	3300034389	Leaf	MVQFDSMTFPEQNGTCGMKPERSGRNLVEKSGTDQDLK
Ga0325419_062919_356_508	3300034389	Leaf	MKLNKIQFDSMAFQEQNKTCRMKTERFGRNLAKKSETDWDLKWDENCSVF
Ga0325420_020909_302_436	3300034688	Leaf	MKLNKVQFDSNSMAFQERNGICGMKQELFGRNLAEKSGTNRDLK
Ga0325423_008951_2584_2706	3300034778	Leaf	LNKVQFDLMAFQERNGTCGMKPERSGWNLVEKSGTDRDLK