Basic Information | |
---|---|
Family ID | F036161 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 170 |
Average Sequence Length | 45 residues |
Representative Sequence | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWHQAGYPLQKWTDGA |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 170 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.29 % |
% of genes near scaffold ends (potentially truncated) | 26.47 % |
% of genes from short scaffolds (< 2000 bps) | 62.35 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.824 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.647 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.588 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.67% β-sheet: 0.00% Coil/Unstructured: 61.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 170 Family Scaffolds |
---|---|---|
PF00069 | Pkinase | 53.53 |
PF06727 | DUF1207 | 6.47 |
PF13505 | OMP_b-brl | 4.12 |
PF00581 | Rhodanese | 3.53 |
PF12802 | MarR_2 | 3.53 |
PF13533 | Biotin_lipoyl_2 | 3.53 |
PF00529 | CusB_dom_1 | 1.76 |
PF02077 | SURF4 | 1.18 |
PF02518 | HATPase_c | 1.18 |
PF00296 | Bac_luciferase | 1.18 |
PF00873 | ACR_tran | 1.18 |
PF02774 | Semialdhyde_dhC | 0.59 |
PF13188 | PAS_8 | 0.59 |
PF12681 | Glyoxalase_2 | 0.59 |
PF04978 | DUF664 | 0.59 |
PF14559 | TPR_19 | 0.59 |
PF13360 | PQQ_2 | 0.59 |
PF13090 | PP_kinase_C | 0.59 |
PF07681 | DoxX | 0.59 |
PF01019 | G_glu_transpept | 0.59 |
PF00682 | HMGL-like | 0.59 |
PF00196 | GerE | 0.59 |
PF00756 | Esterase | 0.59 |
PF00072 | Response_reg | 0.59 |
COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 214.12 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.76 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.18 |
COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.59 |
COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.59 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.59 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.82 % |
Unclassified | root | N/A | 1.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001661|JGI12053J15887_10058840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2139 | Open in IMG/M |
3300002557|JGI25381J37097_1049781 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300002558|JGI25385J37094_10015553 | All Organisms → cellular organisms → Bacteria | 2725 | Open in IMG/M |
3300002558|JGI25385J37094_10165040 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300002560|JGI25383J37093_10045222 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
3300002560|JGI25383J37093_10080605 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300002561|JGI25384J37096_10003051 | All Organisms → cellular organisms → Bacteria | 5883 | Open in IMG/M |
3300002561|JGI25384J37096_10077388 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300002908|JGI25382J43887_10002001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 8712 | Open in IMG/M |
3300002908|JGI25382J43887_10139062 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300002911|JGI25390J43892_10006416 | All Organisms → cellular organisms → Bacteria | 2655 | Open in IMG/M |
3300002911|JGI25390J43892_10016331 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
3300002911|JGI25390J43892_10069995 | Not Available | 809 | Open in IMG/M |
3300005166|Ga0066674_10010428 | All Organisms → cellular organisms → Bacteria | 3826 | Open in IMG/M |
3300005166|Ga0066674_10093986 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
3300005167|Ga0066672_10035220 | All Organisms → cellular organisms → Bacteria | 2774 | Open in IMG/M |
3300005172|Ga0066683_10052072 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
3300005172|Ga0066683_10066668 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
3300005172|Ga0066683_10178028 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300005172|Ga0066683_10580706 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300005174|Ga0066680_10084725 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
3300005174|Ga0066680_10197580 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300005177|Ga0066690_11045488 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005180|Ga0066685_10524387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
3300005181|Ga0066678_10819803 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005186|Ga0066676_10004209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6516 | Open in IMG/M |
3300005406|Ga0070703_10005602 | All Organisms → cellular organisms → Bacteria | 3515 | Open in IMG/M |
3300005406|Ga0070703_10008764 | All Organisms → cellular organisms → Bacteria | 2849 | Open in IMG/M |
3300005440|Ga0070705_100007990 | All Organisms → cellular organisms → Bacteria | 5228 | Open in IMG/M |
3300005446|Ga0066686_10029177 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
3300005467|Ga0070706_100762959 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300005536|Ga0070697_100007921 | All Organisms → cellular organisms → Bacteria | 8279 | Open in IMG/M |
3300005552|Ga0066701_10053887 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
3300005559|Ga0066700_10610683 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300005559|Ga0066700_11089566 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005598|Ga0066706_10437111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1042 | Open in IMG/M |
3300006032|Ga0066696_10000489 | All Organisms → cellular organisms → Bacteria | 15855 | Open in IMG/M |
3300006796|Ga0066665_10623971 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300006796|Ga0066665_10768178 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 762 | Open in IMG/M |
3300006797|Ga0066659_10277774 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300007076|Ga0075435_100011022 | All Organisms → cellular organisms → Bacteria | 6630 | Open in IMG/M |
3300007255|Ga0099791_10162949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1045 | Open in IMG/M |
3300007258|Ga0099793_10057245 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1735 | Open in IMG/M |
3300007258|Ga0099793_10061639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1678 | Open in IMG/M |
3300007258|Ga0099793_10194298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 972 | Open in IMG/M |
3300007265|Ga0099794_10216490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 983 | Open in IMG/M |
3300007265|Ga0099794_10655974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
3300009012|Ga0066710_100226222 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2687 | Open in IMG/M |
3300009012|Ga0066710_100262564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2505 | Open in IMG/M |
3300009012|Ga0066710_100281123 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2426 | Open in IMG/M |
3300009012|Ga0066710_100373401 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2117 | Open in IMG/M |
3300009012|Ga0066710_101658078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 976 | Open in IMG/M |
3300009012|Ga0066710_102926164 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 669 | Open in IMG/M |
3300009038|Ga0099829_10020976 | All Organisms → cellular organisms → Bacteria | 4485 | Open in IMG/M |
3300009088|Ga0099830_11030443 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 682 | Open in IMG/M |
3300009090|Ga0099827_10544582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 999 | Open in IMG/M |
3300009137|Ga0066709_100113490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3362 | Open in IMG/M |
3300009137|Ga0066709_100268627 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2296 | Open in IMG/M |
3300009137|Ga0066709_101344339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1044 | Open in IMG/M |
3300009143|Ga0099792_10001613 | All Organisms → cellular organisms → Bacteria | 8402 | Open in IMG/M |
3300009812|Ga0105067_1114360 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 503 | Open in IMG/M |
3300010081|Ga0127457_1033431 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 507 | Open in IMG/M |
3300010136|Ga0127447_1022851 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 719 | Open in IMG/M |
3300010301|Ga0134070_10197521 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 737 | Open in IMG/M |
3300010303|Ga0134082_10138972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 977 | Open in IMG/M |
3300010304|Ga0134088_10004998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5488 | Open in IMG/M |
3300010304|Ga0134088_10150772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1106 | Open in IMG/M |
3300010320|Ga0134109_10199414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 738 | Open in IMG/M |
3300010321|Ga0134067_10002857 | All Organisms → cellular organisms → Bacteria | 4331 | Open in IMG/M |
3300010323|Ga0134086_10206996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 735 | Open in IMG/M |
3300010326|Ga0134065_10303147 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 613 | Open in IMG/M |
3300010329|Ga0134111_10296241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 673 | Open in IMG/M |
3300010333|Ga0134080_10529497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 564 | Open in IMG/M |
3300010335|Ga0134063_10590865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 564 | Open in IMG/M |
3300010401|Ga0134121_12143656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 595 | Open in IMG/M |
3300011270|Ga0137391_11239802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 593 | Open in IMG/M |
3300012189|Ga0137388_10313345 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1441 | Open in IMG/M |
3300012189|Ga0137388_10360096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1343 | Open in IMG/M |
3300012198|Ga0137364_10002643 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 9047 | Open in IMG/M |
3300012198|Ga0137364_10072064 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2367 | Open in IMG/M |
3300012198|Ga0137364_10634830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 805 | Open in IMG/M |
3300012199|Ga0137383_10014153 | All Organisms → cellular organisms → Bacteria | 5417 | Open in IMG/M |
3300012200|Ga0137382_10021197 | All Organisms → cellular organisms → Bacteria | 3733 | Open in IMG/M |
3300012202|Ga0137363_10833669 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 782 | Open in IMG/M |
3300012202|Ga0137363_11624475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
3300012204|Ga0137374_10003172 | All Organisms → cellular organisms → Bacteria | 19374 | Open in IMG/M |
3300012205|Ga0137362_10266896 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1480 | Open in IMG/M |
3300012206|Ga0137380_10020992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6000 | Open in IMG/M |
3300012206|Ga0137380_10883216 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 768 | Open in IMG/M |
3300012207|Ga0137381_10040111 | All Organisms → cellular organisms → Bacteria | 3825 | Open in IMG/M |
3300012208|Ga0137376_10025402 | All Organisms → cellular organisms → Bacteria | 4621 | Open in IMG/M |
3300012211|Ga0137377_10056989 | All Organisms → cellular organisms → Bacteria | 3625 | Open in IMG/M |
3300012285|Ga0137370_10008593 | All Organisms → cellular organisms → Bacteria | 4787 | Open in IMG/M |
3300012285|Ga0137370_10091395 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1702 | Open in IMG/M |
3300012351|Ga0137386_10024205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4117 | Open in IMG/M |
3300012351|Ga0137386_11294400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 506 | Open in IMG/M |
3300012354|Ga0137366_10004331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 11092 | Open in IMG/M |
3300012356|Ga0137371_11348630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 525 | Open in IMG/M |
3300012363|Ga0137390_10657100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1013 | Open in IMG/M |
3300012389|Ga0134040_1082421 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 763 | Open in IMG/M |
3300012396|Ga0134057_1112679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 636 | Open in IMG/M |
3300012398|Ga0134051_1243467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 663 | Open in IMG/M |
3300012410|Ga0134060_1236718 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 583 | Open in IMG/M |
3300012685|Ga0137397_10410082 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1009 | Open in IMG/M |
3300012918|Ga0137396_10057579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2683 | Open in IMG/M |
3300012922|Ga0137394_11445922 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 547 | Open in IMG/M |
3300012925|Ga0137419_10130518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1788 | Open in IMG/M |
3300012929|Ga0137404_10036590 | All Organisms → cellular organisms → Bacteria | 3675 | Open in IMG/M |
3300012929|Ga0137404_10047248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3281 | Open in IMG/M |
3300012944|Ga0137410_11642822 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 564 | Open in IMG/M |
3300012972|Ga0134077_10131761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 987 | Open in IMG/M |
3300012976|Ga0134076_10122852 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1046 | Open in IMG/M |
3300014157|Ga0134078_10223559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 778 | Open in IMG/M |
3300015241|Ga0137418_10009418 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 8982 | Open in IMG/M |
3300015241|Ga0137418_10972606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 617 | Open in IMG/M |
3300015245|Ga0137409_10000167 | All Organisms → cellular organisms → Bacteria | 65685 | Open in IMG/M |
3300015357|Ga0134072_10004183 | All Organisms → cellular organisms → Bacteria | 3052 | Open in IMG/M |
3300015358|Ga0134089_10078465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1241 | Open in IMG/M |
3300017654|Ga0134069_1290258 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 577 | Open in IMG/M |
3300017654|Ga0134069_1303985 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
3300017659|Ga0134083_10550968 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
3300018071|Ga0184618_10047085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1553 | Open in IMG/M |
3300018431|Ga0066655_10007913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4468 | Open in IMG/M |
3300018431|Ga0066655_10039944 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2354 | Open in IMG/M |
3300018431|Ga0066655_10075868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1817 | Open in IMG/M |
3300018431|Ga0066655_10366790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 947 | Open in IMG/M |
3300018433|Ga0066667_10020363 | All Organisms → cellular organisms → Bacteria | 3512 | Open in IMG/M |
3300018433|Ga0066667_10458467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1042 | Open in IMG/M |
3300018468|Ga0066662_10177560 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1652 | Open in IMG/M |
3300018482|Ga0066669_10076088 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2240 | Open in IMG/M |
3300018482|Ga0066669_10291186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1319 | Open in IMG/M |
3300019882|Ga0193713_1066798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1021 | Open in IMG/M |
3300020170|Ga0179594_10062378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1283 | Open in IMG/M |
3300021086|Ga0179596_10046228 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1780 | Open in IMG/M |
3300021086|Ga0179596_10141299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1137 | Open in IMG/M |
3300021086|Ga0179596_10655104 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
3300021559|Ga0210409_10370576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1285 | Open in IMG/M |
3300025885|Ga0207653_10002084 | All Organisms → cellular organisms → Bacteria | 6371 | Open in IMG/M |
3300026277|Ga0209350_1062841 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1057 | Open in IMG/M |
3300026295|Ga0209234_1025704 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
3300026296|Ga0209235_1006336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6627 | Open in IMG/M |
3300026296|Ga0209235_1006340 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6624 | Open in IMG/M |
3300026297|Ga0209237_1000412 | All Organisms → cellular organisms → Bacteria | 24139 | Open in IMG/M |
3300026301|Ga0209238_1089710 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1057 | Open in IMG/M |
3300026307|Ga0209469_1000128 | All Organisms → cellular organisms → Bacteria | 44904 | Open in IMG/M |
3300026307|Ga0209469_1089776 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300026310|Ga0209239_1182557 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 788 | Open in IMG/M |
3300026314|Ga0209268_1135315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
3300026314|Ga0209268_1177831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 525 | Open in IMG/M |
3300026318|Ga0209471_1002215 | All Organisms → cellular organisms → Bacteria | 11303 | Open in IMG/M |
3300026328|Ga0209802_1011026 | All Organisms → cellular organisms → Bacteria | 5330 | Open in IMG/M |
3300026343|Ga0209159_1019362 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3865 | Open in IMG/M |
3300026524|Ga0209690_1015118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4010 | Open in IMG/M |
3300026537|Ga0209157_1021319 | All Organisms → cellular organisms → Bacteria | 3971 | Open in IMG/M |
3300026537|Ga0209157_1051241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2189 | Open in IMG/M |
3300026537|Ga0209157_1352509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 530 | Open in IMG/M |
3300026542|Ga0209805_1189296 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 899 | Open in IMG/M |
3300026547|Ga0209156_10349519 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 640 | Open in IMG/M |
3300027383|Ga0209213_1023942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1147 | Open in IMG/M |
3300027643|Ga0209076_1060378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1076 | Open in IMG/M |
3300027671|Ga0209588_1002602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4913 | Open in IMG/M |
3300027748|Ga0209689_1081214 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1716 | Open in IMG/M |
3300027821|Ga0209811_10411551 | Not Available | 524 | Open in IMG/M |
3300027862|Ga0209701_10040426 | All Organisms → cellular organisms → Bacteria | 3014 | Open in IMG/M |
3300027961|Ga0209853_1027548 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1685 | Open in IMG/M |
3300031720|Ga0307469_10127947 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_20CM_69_52 | 1853 | Open in IMG/M |
3300031720|Ga0307469_11693189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
3300031740|Ga0307468_101365093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 649 | Open in IMG/M |
3300031820|Ga0307473_10845664 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 656 | Open in IMG/M |
3300032144|Ga0315910_10553404 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 890 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 21.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.18% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.53% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.18% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.18% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.18% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.59% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.59% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.59% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12053J15887_100588402 | 3300001661 | Forest Soil | VDERTSARAARLLIAAGYDERKVAALQGGIRAWYQAGYPLQKWTDRA* |
JGI25381J37097_10497812 | 3300002557 | Grasslands Soil | VDERTSARAARLLIAAGQDTSRIAVLLGGIRAWHQAGFPLQKWRDGA* |
JGI25385J37094_100155533 | 3300002558 | Grasslands Soil | VDERTSARAARRLIAAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGA* |
JGI25385J37094_101650401 | 3300002558 | Grasslands Soil | VDERTSARAARLLIAAGYEERKVAVLLGGIRAWHQAGYPLQKWTDGA* |
JGI25383J37093_100452223 | 3300002560 | Grasslands Soil | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWHQAGYPLQKWTDGA* |
JGI25383J37093_100806052 | 3300002560 | Grasslands Soil | VDERTSARAARLLMAAGHDTSRIAVLLGGIRAWHQAGFPLQKWRDGA* |
JGI25384J37096_100030515 | 3300002561 | Grasslands Soil | VDERTSARAARLLMAAGYDEHKVAALQGGIRAWHQAGYPLERWTDGA* |
JGI25384J37096_100773882 | 3300002561 | Grasslands Soil | VDERTSARAARLLIAAGHDTSRIAVLLGGIRAWHQAGFPLQKWRDGA* |
JGI25382J43887_100020013 | 3300002908 | Grasslands Soil | VDERTSARAARLLMAAGYDERKVAALLGGIRAWYRAGYRLERWTDRA* |
JGI25382J43887_101390621 | 3300002908 | Grasslands Soil | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWHQAGYPLQ |
JGI25390J43892_100064163 | 3300002911 | Grasslands Soil | VDERTSARAARLLXAAGQDTSRIAVLLGGIRAWHQAGFPLQKWRDGA* |
JGI25390J43892_100163313 | 3300002911 | Grasslands Soil | VDERTSARAARLLIAAGYDARXVAVLLGGIRAWHQAGYPLEKWTDGA* |
JGI25390J43892_100699951 | 3300002911 | Grasslands Soil | GSSAGAARTLIAGGYDEGRVAVLLGGIGAWVEAGYPLERGTDRASEAMS* |
Ga0066674_100104284 | 3300005166 | Soil | VDERTSARAARLLIAAGYDERKVAALLGGIRAWYQAGYPLEKWTDRA* |
Ga0066674_100939863 | 3300005166 | Soil | VDERTSARAARRLIAAGYDESNVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0066672_100352203 | 3300005167 | Soil | VDERTSARAARLLIAAGYDERKVAALLGGIRAWYQAGYALEKWTDRT* |
Ga0066683_100520723 | 3300005172 | Soil | VDEATSARAARTLIAAGYDSRQVTVLLGGLRAWHQAGYRLDKWSDPG* |
Ga0066683_100666683 | 3300005172 | Soil | VDERTSARAARLLIAAGYDARKVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0066683_101780283 | 3300005172 | Soil | VDEATSARAARKLIAGGTDRDRVAVLLGGIRAWHEAGYPIERW |
Ga0066683_105807062 | 3300005172 | Soil | VDERTSARAARLLIAAGHDTSRVAVLLGGIRAWHQAGFPLQKWRDGA* |
Ga0066680_100847253 | 3300005174 | Soil | VDERTSARAARLLMAAGYDERKVAALLGGIRAWYQAGYRLEQWTDRA* |
Ga0066680_101975802 | 3300005174 | Soil | VDERTSARAARLLIAAGYDERKVAALLGGIRAWHQAGYPLEKWTDRA* |
Ga0066690_110454882 | 3300005177 | Soil | TSARAARLLIAAGHDTSRVAVLLGGIRAWHQAGFPLQKWRDGA* |
Ga0066685_105243872 | 3300005180 | Soil | VDERTSARAARLLIAAGYDAHKVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0066678_108198032 | 3300005181 | Soil | AARTLIAGGYDEGRVAVLLGGIGAWVQAGYPLERGTDRASEAMS* |
Ga0066676_100042098 | 3300005186 | Soil | VDEATSARAARKLIAGGTDRDRVAVLLGGIRAWHEAGYPIERWTERA* |
Ga0070703_100056022 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VDERTSARAARLLIAAGQDASRVAVLLGGIRAWHQAGFQLQRWSDRV* |
Ga0070703_100087642 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VDERSSARAARLLIAAGYDERKVAVLLGGIRAWYQAGYPLQKWTDRA* |
Ga0070705_1000079903 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEHTSARAARLLIAAGEDASRVAVLLGGIRAWHQAGFPLQKWSDRA* |
Ga0066686_100291773 | 3300005446 | Soil | VDERTSARAARLLIAAGQDEGKVAVLLGGIRAWHQAGYPLEKWTDGA* |
Ga0070706_1007629592 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEHTSARAARLLIGAGYDERNVAALLGGIRAWYEAGYPLEKWTDRA* |
Ga0070697_1000079217 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEHTSARAARLLIGAGHDERNVAALLGGIRAWYEAGYPLEKWTDRA* |
Ga0066701_100538873 | 3300005552 | Soil | VDERTSARAARLLMAAGYDERKVAALLGGIRAWYQAGYRLERWTDRA* |
Ga0066700_106106832 | 3300005559 | Soil | MAAGHDTSRIAVLLGGIRAWHQAGFPLQKWRDGA* |
Ga0066700_110895662 | 3300005559 | Soil | GSSARAARTLIAGGYDEGRVSVLLGGIRAWHEAGYPLEKWNDRPS* |
Ga0066706_104371111 | 3300005598 | Soil | LIAAGQDTSRIAVLLGGIRAWHQAGFPLQKWRDGA* |
Ga0066696_100004891 | 3300006032 | Soil | VDERTSARAARLLIAAGHDTSRVAVLLGGIRAWHQA |
Ga0066665_106239713 | 3300006796 | Soil | VDERTSARAARLLIAAGHDTSRVAVLLGGIRAWHQAGFPLQKWRDGA |
Ga0066665_107681781 | 3300006796 | Soil | VDERTSARAARLLIVAGHDTSRVAVLLGGIRAWHQAGFPLQKWRDGA* |
Ga0066659_102777742 | 3300006797 | Soil | VDERTSARAARLLIAAGYDARKVAVLLGGIRAWHQAGYPLEKWTDGA* |
Ga0075435_1000110221 | 3300007076 | Populus Rhizosphere | VDERTSARAARLLMAAGQDASRVAVLLGGIRAWHQAGFPLQRWSDRV |
Ga0099791_101629491 | 3300007255 | Vadose Zone Soil | RTSARAARRLIAAGYDERNVGVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0099793_100572452 | 3300007258 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERKVAALQGGIRAWYQAGYPLEKWTDRA* |
Ga0099793_100616392 | 3300007258 | Vadose Zone Soil | VDERTSARAARRLIAAGYDERNVAVLLGGIRAWHQAGYQLQKWTDGA* |
Ga0099793_101942982 | 3300007258 | Vadose Zone Soil | VDERSSARAARLLIAAGYDERNVAVLLGGIRAWYQAGYPLQKWTDRA* |
Ga0099794_102164902 | 3300007265 | Vadose Zone Soil | VDERTSARAARRLIAAGYDERNVAVLLGGIRAWHQAGYALQKWTDGA* |
Ga0099794_106559742 | 3300007265 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWYQAGYPLQKWTDRA* |
Ga0066710_1002262222 | 3300009012 | Grasslands Soil | VDERTSARAARLLIAAGHDARNVAALLGGIRAWHQAGYPLEKWTDRA |
Ga0066710_1002625643 | 3300009012 | Grasslands Soil | MLIAAGYDTRKVAVLLGGIHAWHQAGYPLEKWTDGA |
Ga0066710_1002811232 | 3300009012 | Grasslands Soil | VDERTSARAARLLSAAGYDARKVAVLLGGIRAWHQAGYPLEKWTDGA |
Ga0066710_1003734014 | 3300009012 | Grasslands Soil | MLIAAGYDARKVAVLLGGIRAWHQAGYPLEKWTDGA |
Ga0066710_1016580784 | 3300009012 | Grasslands Soil | VDERTSARAARLLIAAGYEERKVAVLLGGIRAWHQAGYP |
Ga0066710_1029261642 | 3300009012 | Grasslands Soil | VDERTSARAARLLMAAGYDEHKVAALQGGIRAWHQAAYPLERWTDGA |
Ga0099829_100209764 | 3300009038 | Vadose Zone Soil | LIAAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0099830_110304432 | 3300009088 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERNVAVLLGGIRVWHQAGYPLQRWTDGA* |
Ga0099827_105445822 | 3300009090 | Vadose Zone Soil | VDERSSARAARLLIAAGYDERKVAVLLGGIRAWYQAGYPLQKWTDGA* |
Ga0066709_1001134904 | 3300009137 | Grasslands Soil | VDERTSARAARLLIAAGYDERKVAALLGGIRGWYQAGYALEKWTDRT* |
Ga0066709_1002686274 | 3300009137 | Grasslands Soil | VDERTSARAARLLIAAGHDARNVAALLGGIRAWHQAGYPLEKWTDRA* |
Ga0066709_1013443392 | 3300009137 | Grasslands Soil | MLIAAGYDARKVAVLLGGIRAWHQAGYPLEKWTDGA* |
Ga0099792_100016138 | 3300009143 | Vadose Zone Soil | RAARRLIAAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0105067_11143602 | 3300009812 | Groundwater Sand | VDERTSARAARLLIAAGYDGRKVAVLLGGIRALHEAGYPLQKWTDGA* |
Ga0127457_10334312 | 3300010081 | Grasslands Soil | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWHQAGYLLQKWTDGV* |
Ga0127447_10228511 | 3300010136 | Grasslands Soil | RTSARAARLLIAAGYEERKVAVLLGGIRAWHQAGFPLQKWRDGA* |
Ga0134070_101975212 | 3300010301 | Grasslands Soil | EATSARAARALIAGGYDANRVAVLVGGIRAWHEAGYGLVQWSDPR* |
Ga0134082_101389722 | 3300010303 | Grasslands Soil | VDERTSARAARLLMAVGYDEHTVAALQGGIRAWHQAGYALEKWTDRT* |
Ga0134088_100049987 | 3300010304 | Grasslands Soil | VDERTSAGAARLLIAAGYDARKVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0134088_101507722 | 3300010304 | Grasslands Soil | EGSSARAARTLIAGGYDEGRVTVLLGGIRAWHEAGYPLEKWNDRAS* |
Ga0134109_101994141 | 3300010320 | Grasslands Soil | RTSARAARLLIAAGYDAHKVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0134067_100028573 | 3300010321 | Grasslands Soil | VDERTSARAARLLIAAGHDTSRVAVLLGGIRAWHQAGFPFQKWRDGA* |
Ga0134086_102069962 | 3300010323 | Grasslands Soil | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWHQAGYPLQKWTDGV* |
Ga0134065_103031473 | 3300010326 | Grasslands Soil | VDEGTSARAARTLIAGGYDSRLVTVLLGGLRAWHQAGYRLDKWSGPR* |
Ga0134111_102962411 | 3300010329 | Grasslands Soil | VDERTNARAARLLIAAGHDTSRVAVLLGGIRAWHQA |
Ga0134080_105294972 | 3300010333 | Grasslands Soil | VDERTSARAARLLIAAGYDARKVAVLLGGIRAWHQAGYPLQKWTDG |
Ga0134063_105908651 | 3300010335 | Grasslands Soil | MLIAAGYDTRKVAVLLGGIHAWHQAGYPLEKWTDGA* |
Ga0134121_121436561 | 3300010401 | Terrestrial Soil | RAARLLIAAGQDASRVAVLLGGIRAWHQAGFPLQRWSDRV* |
Ga0137391_112398022 | 3300011270 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0137388_103133451 | 3300012189 | Vadose Zone Soil | VDERTSARAARRLIAAGYDERNVAVLLGGIRAWHQ |
Ga0137388_103600963 | 3300012189 | Vadose Zone Soil | VDERSSARAARLLIAAGYDERKVAVLLGGIRAWYQA |
Ga0137364_100026438 | 3300012198 | Vadose Zone Soil | VDERTSARAARLLMAAGYDEHKVAALRGGIRAWHQAGYLLERWTDGT* |
Ga0137364_100720644 | 3300012198 | Vadose Zone Soil | VDEGTSARAARTLIAGGYDSRLVTVLLGGLRAWHQAGYRLDKWSDPRSSATSP* |
Ga0137364_106348302 | 3300012198 | Vadose Zone Soil | VDERTSARAARLLIAAGYDEGKVAALLGGIRAWYQAGYALEKWTDRT* |
Ga0137383_100141534 | 3300012199 | Vadose Zone Soil | VDERTSARAARLLIAAGYDARKVAVLLGGIRAWHQAGYALRKWTDGA* |
Ga0137382_100211974 | 3300012200 | Vadose Zone Soil | VDEGTSARAARTLIAGGYDSRLVTVLLGGLRAWHQAGYRLDKWSDPR* |
Ga0137363_108336691 | 3300012202 | Vadose Zone Soil | ARRLIAAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0137363_116244752 | 3300012202 | Vadose Zone Soil | VDERSSARAARLLMAAGYDERKVAVLLGGIRAWYQAGYPLQKWTDRA* |
Ga0137374_1000317215 | 3300012204 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERTIAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0137362_102668962 | 3300012205 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWHQAGYPLQNWTDGV* |
Ga0137380_100209924 | 3300012206 | Vadose Zone Soil | VDERTSARAARLLIAAGYDTRKVAVLLGGIRAWHQAGYALQKWTDGA* |
Ga0137380_108832162 | 3300012206 | Vadose Zone Soil | VDERTSARAARLLIAAGHDPSRVAVLLGGIRAWHQAGFPLQKWRDGA* |
Ga0137381_100401114 | 3300012207 | Vadose Zone Soil | VDERTSARAARLLIAAGYDARKVAVLLGGIRAWHQAGYALQKWTDGA* |
Ga0137376_100254025 | 3300012208 | Vadose Zone Soil | VDERTSARVARLLITAGYDERKVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0137377_100569894 | 3300012211 | Vadose Zone Soil | VDERTSARAARLLMAAGYDEHKVAALQGGIRAWHQAGYLLERWTDGT* |
Ga0137370_100085934 | 3300012285 | Vadose Zone Soil | VDERTSARAARLLIAGGYDERKVAALLGGIRAWHQAGYPLEQWTDRA* |
Ga0137370_100913952 | 3300012285 | Vadose Zone Soil | LLIAAGYDARKVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0137386_100242053 | 3300012351 | Vadose Zone Soil | VDERTSARAARLLIAAGYDEGKVAALLGGIRAWYQAGYPLEKWTDRA* |
Ga0137386_112944001 | 3300012351 | Vadose Zone Soil | RAARLLIAAGQDEGKVAVLLGGIRAWHQAGYPLEKWTDGA* |
Ga0137366_100043315 | 3300012354 | Vadose Zone Soil | VDERTSARAARLLIAAGYEARKVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0137371_113486301 | 3300012356 | Vadose Zone Soil | SARAARMLMAAGYDARKVAVLLGGIRAWHQAGYPLRQWTDGA* |
Ga0137390_106571002 | 3300012363 | Vadose Zone Soil | VDERTSARAARLLIEAGQDASRVAVLLGGIRAWHQAGFRLQKWSDRA* |
Ga0134040_10824211 | 3300012389 | Grasslands Soil | DEATSARAARKLIAGGTDRDRVAVLLGGIRAWHEAGYPIERWAERA* |
Ga0134057_11126791 | 3300012396 | Grasslands Soil | DERTSARAARRLIAAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0134051_12434672 | 3300012398 | Grasslands Soil | VDERTSARAARLLIAAGHDTSMVAVLLGGIRAWHQAGFPLQKWRDGA* |
Ga0134060_12367182 | 3300012410 | Grasslands Soil | DERTSARAARRLIAAGYDESNVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0137397_104100822 | 3300012685 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWHRAGYPLQQWTDGT* |
Ga0137396_100575792 | 3300012918 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERKVAALLGGIRAWYQAGYALEKWTDRA* |
Ga0137394_114459222 | 3300012922 | Vadose Zone Soil | VDEHTSARAARLLMAGGYDERKVAVLLGGIRAWHQAGYPLQKWTDGT* |
Ga0137419_101305181 | 3300012925 | Vadose Zone Soil | TSARAARRLIAAGYDERNVAVLLGGIRAWHQAGYQLQKWTDGA* |
Ga0137404_100365904 | 3300012929 | Vadose Zone Soil | VDERSSARAARLLTAAGYDERKVAVLLGGIRAWYQAGYPLQKWTDRA* |
Ga0137404_100472482 | 3300012929 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWHQAGYPLQKWTDGT* |
Ga0137410_116428222 | 3300012944 | Vadose Zone Soil | MAGGYDERKVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0134077_101317613 | 3300012972 | Grasslands Soil | VDERTSARAARRLIAAGYDESNVAVLLGGIRAWHQAGYPLQKWTDG |
Ga0134076_101228522 | 3300012976 | Grasslands Soil | VDERTSARAARLLIAAGQDEGKVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0134078_102235591 | 3300014157 | Grasslands Soil | MLIAGGYDSRLVTVLLGGLRAWHQAGYRLDKWSDPR* |
Ga0137418_100094187 | 3300015241 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERKVAALQGGIRAWYQAGYPLEKWTDRV* |
Ga0137418_109726062 | 3300015241 | Vadose Zone Soil | VDERSSARAARLLLAAGYDERKVAVLLGGIRAWHQAGYPLQKWNDGV* |
Ga0137409_1000016743 | 3300015245 | Vadose Zone Soil | VDERTSARAARRLIAAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGT* |
Ga0134072_100041831 | 3300015357 | Grasslands Soil | VDERTSARAARLLMAAGYDEHTVAALQGGIRVWHQAGYPLERWTDGA* |
Ga0134089_100784652 | 3300015358 | Grasslands Soil | VDERTSARAARRLIEAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGA* |
Ga0134069_12902581 | 3300017654 | Grasslands Soil | ARLLIAAGYDARKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0134069_13039852 | 3300017654 | Grasslands Soil | VDERTSARAARLLIAAGHDTSRVAVLLGGIRAWHQAGF |
Ga0134083_105509681 | 3300017659 | Grasslands Soil | VDERTSARAARLLIAAGQDEGKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0184618_100470853 | 3300018071 | Groundwater Sediment | VDERSSARAARLLIAAGYDERKVAVLLGGIRAWYQAGYPLQKWTDRA |
Ga0066655_100079135 | 3300018431 | Grasslands Soil | VDERTSARAARRLIAAGYDESNVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0066655_100399442 | 3300018431 | Grasslands Soil | VDEATSARAARTLIAAGYDSRQVTVLLGGLRAWHQAGYRLDKWSDPG |
Ga0066655_100758683 | 3300018431 | Grasslands Soil | VDERTSARAARLLIAAGYDAHKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0066655_103667902 | 3300018431 | Grasslands Soil | VDERTSARAARLLIAAGHDTSRIAVLLGGIRAWHQAGFPLQKWRDGA |
Ga0066667_100203631 | 3300018433 | Grasslands Soil | VDERTSARAARLLIAAGYEERKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0066667_104584672 | 3300018433 | Grasslands Soil | VDERTSARAARLLIVAGHDTSRVAVLLGGIRAWHQAGFPLQKWRDGA |
Ga0066662_101775602 | 3300018468 | Grasslands Soil | VDERTSARAARLLIAAGYDERKVAALLGGIRAWYQAGYALEKWTDRT |
Ga0066669_100760883 | 3300018482 | Grasslands Soil | VDERTSARAARLLIAAGYDERKVAALLGGIRAWYQAGYPLEKWTDRA |
Ga0066669_102911862 | 3300018482 | Grasslands Soil | VDERTSARVARLLITAGYDERKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0193713_10667982 | 3300019882 | Soil | VDERSSARAARLLIAAGYDERKVAVLLGGIRAWYQAGYPLQKWTDGA |
Ga0179594_100623782 | 3300020170 | Vadose Zone Soil | VDERTSARAARLLITAGYDERKVAVLLGGIRAWHQAGYPLEKWTDGA |
Ga0179596_100462284 | 3300021086 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERNVAVLLGGIRVWHQAGYPLQRWTDGA |
Ga0179596_101412992 | 3300021086 | Vadose Zone Soil | VDERTSARAARRLIAAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0179596_106551041 | 3300021086 | Vadose Zone Soil | VDERSSARAARLLMAAGYDERKVAVLLGGIRAWYQAGYPLQKWTDRA |
Ga0210409_103705763 | 3300021559 | Soil | VDERTSARAARRLIAAGYDERNLAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0207653_100020847 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VDERTSARAARLLIAAGQDASRVAVLLGGIRAWHQAGFQLQRWSDRV |
Ga0209350_10628413 | 3300026277 | Grasslands Soil | VDERTSARAARLLIAAGYDARKVAVLLGGIRAWHQAGYPLEKWTDGA |
Ga0209234_10257041 | 3300026295 | Grasslands Soil | LLIAAGYDERKVAALLGGIRAWYQAGYALEKWTDRT |
Ga0209235_10063366 | 3300026296 | Grasslands Soil | VDERTSARAARLLIAAGQDTSRIAVLLGGIRAWHQAGFPLQKWRDGA |
Ga0209235_10063404 | 3300026296 | Grasslands Soil | VDERTSARAARLLIAAGYDERKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0209237_100041226 | 3300026297 | Grasslands Soil | VDERTSARAARLLMAAGYDEHKVAALQGGIRAWHQAGYPLERWTDGA |
Ga0209238_10897103 | 3300026301 | Grasslands Soil | VDERTSARAARLLIAGGYDERKVAALLGGIRAWHQAGYPLEQWTDRA |
Ga0209469_100012843 | 3300026307 | Soil | VDEATSARAARKLIAGGTDRDRVAVLLGGIRAWHEAGYPIERWTERA |
Ga0209469_10897763 | 3300026307 | Soil | VDEATSARAARTLIAAGYDSRQVTVLLGGLRAWHQAGYRLDKWSD |
Ga0209239_11825572 | 3300026310 | Grasslands Soil | MLIAAGYDTRKVAVLLGGIRAWHQAGYPLEKWTDGA |
Ga0209268_11353152 | 3300026314 | Soil | VDERTSARAARLLMAAGHDTSRIAVLLGGIRAWHQAGFPLQKWRDGA |
Ga0209268_11778311 | 3300026314 | Soil | VDERTSARAARLLIAAGYDARKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0209471_10022151 | 3300026318 | Soil | VDEHTSARAARLLIAAGYDERKVAALLGGIRAWHQAGYPLEKWSDRT |
Ga0209802_10110264 | 3300026328 | Soil | VDERTSARAARLLIAAGYDERKVAALLGGIRAWHQAGYPLEKWTDRA |
Ga0209159_10193623 | 3300026343 | Soil | VDERTSARAARLLIAAGYDERKVAALLGGIRAWYQAGRAASLT |
Ga0209690_10151186 | 3300026524 | Soil | VDERTSARAARLLIAAGYEERKVAVLLGGIRAWHQAGYPL |
Ga0209157_10213194 | 3300026537 | Soil | VDERTSARAARLLIAAGQDEGKVAVLLGGIRAWHQAGYPLEKWTDGA |
Ga0209157_10512412 | 3300026537 | Soil | VDERTSAGAARLLIAAGYDARKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0209157_13525091 | 3300026537 | Soil | AARLLMAAGYDEHTVAALQGGIRAWHQAGYPLERWTDGA |
Ga0209805_11892962 | 3300026542 | Soil | LIAAGYDERKVAALLGGIRAWYQAGYALEKWTDRT |
Ga0209156_103495193 | 3300026547 | Soil | VDERTSARAARLLIAGGYDERKVAALLGGIRAWHQAGYP |
Ga0209213_10239422 | 3300027383 | Forest Soil | VDERTSARAARLLIAAGYDERKVAALQGGIRAWYQAGYPLEKWTDRA |
Ga0209076_10603782 | 3300027643 | Vadose Zone Soil | VDERSSARAARLLIAAGYDERNVAVLLGGIRAWYQAGYPLQKWTDRA |
Ga0209588_10026022 | 3300027671 | Vadose Zone Soil | VDERTSARAARRLIAAGYDERNVAVLLGGIRAWHQAGYALQKWTDGA |
Ga0209689_10812141 | 3300027748 | Soil | GSSARAARTLIAGGYDEGRVSVLLGGIRAWHEAGYPLEKWNDRPS |
Ga0209811_104115512 | 3300027821 | Surface Soil | VAEHTSARAARLLIAAGEDASRVAVLLGGIRAWHQAGFPLQKWNDRA |
Ga0209701_100404267 | 3300027862 | Vadose Zone Soil | VDERTSARAARLLIAAGYDERNVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0209853_10275482 | 3300027961 | Groundwater Sand | MDEATSARAARALIAGGYDKDRLAVLVGGIRAWHQAGYPIDKWSDRV |
Ga0307469_101279473 | 3300031720 | Hardwood Forest Soil | VDEHTSARAARLLIAAGEDASRVAVLLGGIRAWHQAGFPLQKWSDRA |
Ga0307469_116931891 | 3300031720 | Hardwood Forest Soil | LLMAAGYDERKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0307468_1013650932 | 3300031740 | Hardwood Forest Soil | VDERTSARAARLLMAAGHDERKVAVLLGGIRAWHQAGYPLQKWTDGA |
Ga0307473_108456642 | 3300031820 | Hardwood Forest Soil | VDERTSARAARLLIAAGQDASRVAVLLGGIRAWHQAGFALQRWSDRV |
Ga0315910_105534042 | 3300032144 | Soil | LSARAARSLIEAGYPEPQVAVLAGGIKAWHQAGYPIIMWTDPSTQTPADG |
⦗Top⦘ |