NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035938

Metagenome / Metatranscriptome Family F035938

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035938
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 39 residues
Representative Sequence FTVNGPLSTTRESEAAPSKRVKEMVEASAKIERVGATD
Number of Associated Samples 149
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.25 %
% of genes near scaffold ends (potentially truncated) 92.40 %
% of genes from short scaffolds (< 2000 bps) 78.95 %
Associated GOLD sequencing projects 143
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.327 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.637 % of family members)
Environment Ontology (ENVO) Unclassified
(28.655 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.895 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.21%    β-sheet: 0.00%    Coil/Unstructured: 78.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF02817E3_binding 64.33
PF00364Biotin_lipoyl 18.13
PF00375SDF 4.09
PF01593Amino_oxidase 1.17
PF07883Cupin_2 1.17
PF04542Sigma70_r2 0.58
PF10343Q_salvage 0.58
PF00589Phage_integrase 0.58
PF03466LysR_substrate 0.58
PF08327AHSA1 0.58
PF14310Fn3-like 0.58
PF08447PAS_3 0.58
PF00557Peptidase_M24 0.58
PF135632_5_RNA_ligase2 0.58
PF01070FMN_dh 0.58
PF08240ADH_N 0.58
PF13624SurA_N_3 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 64.33
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.58
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.58
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.58
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.58
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.58
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.33 %
UnclassifiedrootN/A35.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001141|JGI12638J13249_103599All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300001178|JGI12646J13576_105863All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300001471|JGI12712J15308_10198166All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300004009|Ga0055437_10154990Not Available713Open in IMG/M
3300004152|Ga0062386_100619260Not Available885Open in IMG/M
3300005176|Ga0066679_10040622All Organisms → cellular organisms → Bacteria2625Open in IMG/M
3300005332|Ga0066388_102418407All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300005541|Ga0070733_10400209All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300005542|Ga0070732_10352348All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300005557|Ga0066704_10143421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1598Open in IMG/M
3300005598|Ga0066706_11422578All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005764|Ga0066903_103808296Not Available811Open in IMG/M
3300005921|Ga0070766_10756367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium660Open in IMG/M
3300005950|Ga0066787_10031441Not Available960Open in IMG/M
3300006050|Ga0075028_100578345All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300006052|Ga0075029_100877704All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300006086|Ga0075019_10737141All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300006162|Ga0075030_100332944All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300006172|Ga0075018_10407827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium692Open in IMG/M
3300006173|Ga0070716_101105457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300006173|Ga0070716_101236927All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300006176|Ga0070765_100037542All Organisms → cellular organisms → Bacteria → Proteobacteria3843Open in IMG/M
3300006176|Ga0070765_100555105Not Available1081Open in IMG/M
3300006755|Ga0079222_10083053Not Available1623Open in IMG/M
3300006800|Ga0066660_10729379All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300006800|Ga0066660_11294721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300007788|Ga0099795_10119492Not Available1052Open in IMG/M
3300007982|Ga0102924_1105478Not Available1409Open in IMG/M
3300009088|Ga0099830_10068595All Organisms → cellular organisms → Bacteria2564Open in IMG/M
3300009088|Ga0099830_10892874All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300009636|Ga0116112_1006822All Organisms → cellular organisms → Bacteria5100Open in IMG/M
3300009637|Ga0116118_1177226Not Available677Open in IMG/M
3300009638|Ga0116113_1073166All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300009683|Ga0116224_10219910Not Available908Open in IMG/M
3300010048|Ga0126373_11474591All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300010339|Ga0074046_10799463Not Available551Open in IMG/M
3300010360|Ga0126372_10127455Not Available1982Open in IMG/M
3300010361|Ga0126378_10801977Not Available1051Open in IMG/M
3300010366|Ga0126379_10333278All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300010366|Ga0126379_13257803Not Available544Open in IMG/M
3300010376|Ga0126381_101554568Not Available956Open in IMG/M
3300010379|Ga0136449_101985919All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300010401|Ga0134121_13104135All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. 12-65-5512Open in IMG/M
3300011120|Ga0150983_10113765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300011270|Ga0137391_10045448All Organisms → cellular organisms → Bacteria3733Open in IMG/M
3300012189|Ga0137388_11362240All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300012201|Ga0137365_11102118All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300012203|Ga0137399_10885436All Organisms → cellular organisms → Bacteria → Acidobacteria752Open in IMG/M
3300012359|Ga0137385_11152760All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300012685|Ga0137397_10101514All Organisms → cellular organisms → Bacteria → Proteobacteria2109Open in IMG/M
3300012685|Ga0137397_10727651All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300012918|Ga0137396_10190775All Organisms → cellular organisms → Bacteria → Proteobacteria1505Open in IMG/M
3300014164|Ga0181532_10310166Not Available892Open in IMG/M
3300014201|Ga0181537_10072017All Organisms → cellular organisms → Bacteria2345Open in IMG/M
3300014495|Ga0182015_11042466Not Available505Open in IMG/M
3300014501|Ga0182024_12474400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300015054|Ga0137420_1347815Not Available4296Open in IMG/M
3300015168|Ga0167631_1036693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria798Open in IMG/M
3300016270|Ga0182036_11032088All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300016319|Ga0182033_11248424All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300016341|Ga0182035_10632811Not Available927Open in IMG/M
3300017925|Ga0187856_1291132All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300017926|Ga0187807_1204393Not Available640Open in IMG/M
3300017933|Ga0187801_10269453All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300017995|Ga0187816_10174375All Organisms → cellular organisms → Bacteria → Acidobacteria933Open in IMG/M
3300018047|Ga0187859_10142870All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300018062|Ga0187784_10950666All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300018090|Ga0187770_10312020All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300018468|Ga0066662_12346209All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300020579|Ga0210407_11162958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300020581|Ga0210399_10130657All Organisms → cellular organisms → Bacteria2067Open in IMG/M
3300020581|Ga0210399_10904669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium715Open in IMG/M
3300020581|Ga0210399_11219219All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300020582|Ga0210395_10864149Not Available673Open in IMG/M
3300021170|Ga0210400_10702646All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300021171|Ga0210405_10067172Not Available2829Open in IMG/M
3300021171|Ga0210405_10596729All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300021171|Ga0210405_10927341Not Available660Open in IMG/M
3300021178|Ga0210408_10027066All Organisms → cellular organisms → Bacteria4546Open in IMG/M
3300021180|Ga0210396_10047596All Organisms → cellular organisms → Bacteria → Proteobacteria3935Open in IMG/M
3300021180|Ga0210396_10800691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300021384|Ga0213876_10037163All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2569Open in IMG/M
3300021401|Ga0210393_10086637All Organisms → cellular organisms → Bacteria2485Open in IMG/M
3300021401|Ga0210393_10452680Not Available1048Open in IMG/M
3300021402|Ga0210385_11330005All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300021403|Ga0210397_10571202Not Available862Open in IMG/M
3300021405|Ga0210387_11098641Not Available694Open in IMG/M
3300021406|Ga0210386_11088022Not Available679Open in IMG/M
3300021406|Ga0210386_11100103Not Available675Open in IMG/M
3300021407|Ga0210383_10116991All Organisms → cellular organisms → Bacteria2250Open in IMG/M
3300021420|Ga0210394_10220946All Organisms → cellular organisms → Bacteria1654Open in IMG/M
3300021432|Ga0210384_11379443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300021433|Ga0210391_10122424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2047Open in IMG/M
3300021433|Ga0210391_11115070Not Available612Open in IMG/M
3300021474|Ga0210390_10440990All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300021477|Ga0210398_10102625All Organisms → cellular organisms → Bacteria2322Open in IMG/M
3300021478|Ga0210402_10310176All Organisms → cellular organisms → Bacteria1461Open in IMG/M
3300021559|Ga0210409_10993880All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300021560|Ga0126371_13419247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300022557|Ga0212123_10361088All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300025862|Ga0209483_1215818All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300025910|Ga0207684_10117574Not Available2278Open in IMG/M
3300025922|Ga0207646_10320550All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300025998|Ga0208651_1025663All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300026285|Ga0209438_1083155All Organisms → cellular organisms → Bacteria → Acidobacteria1020Open in IMG/M
3300026310|Ga0209239_1190344All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300026547|Ga0209156_10134563Not Available1205Open in IMG/M
3300026550|Ga0209474_10294170Not Available963Open in IMG/M
3300026557|Ga0179587_10734754All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300027045|Ga0207726_1012205Not Available1438Open in IMG/M
3300027047|Ga0208730_1045984All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300027063|Ga0207762_1006765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2224Open in IMG/M
3300027527|Ga0209684_1078128All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300027605|Ga0209329_1021663All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300027605|Ga0209329_1148289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300027667|Ga0209009_1016981All Organisms → cellular organisms → Bacteria1753Open in IMG/M
3300027725|Ga0209178_1157401All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300027768|Ga0209772_10293044Not Available516Open in IMG/M
3300027882|Ga0209590_10189769All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300027903|Ga0209488_10024207All Organisms → cellular organisms → Bacteria4412Open in IMG/M
3300027905|Ga0209415_10271403Not Available1498Open in IMG/M
3300027908|Ga0209006_10413758Not Available1134Open in IMG/M
3300028047|Ga0209526_10825827All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300028906|Ga0308309_10041646All Organisms → cellular organisms → Bacteria3246Open in IMG/M
3300029883|Ga0311327_10501429Not Available744Open in IMG/M
3300029914|Ga0311359_11110239Not Available524Open in IMG/M
3300029939|Ga0311328_10489004All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300029943|Ga0311340_11139598All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300029999|Ga0311339_11093609Not Available739Open in IMG/M
3300030520|Ga0311372_12355782All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300030862|Ga0265753_1113057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300030878|Ga0265770_1056177Not Available723Open in IMG/M
3300030940|Ga0265740_1012616All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300030940|Ga0265740_1044666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300031239|Ga0265328_10259055All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300031474|Ga0170818_102402768Not Available543Open in IMG/M
3300031546|Ga0318538_10509777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300031679|Ga0318561_10612301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300031708|Ga0310686_112690834All Organisms → cellular organisms → Bacteria → Acidobacteria2004Open in IMG/M
3300031719|Ga0306917_10191895All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300031796|Ga0318576_10287755Not Available776Open in IMG/M
3300031798|Ga0318523_10208859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium976Open in IMG/M
3300031823|Ga0307478_10778504Not Available801Open in IMG/M
3300031846|Ga0318512_10113661All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300031910|Ga0306923_11818897All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300031942|Ga0310916_11483837All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300031946|Ga0310910_10076136All Organisms → cellular organisms → Bacteria2434Open in IMG/M
3300031962|Ga0307479_10228324All Organisms → cellular organisms → Bacteria1836Open in IMG/M
3300031962|Ga0307479_10988171Not Available811Open in IMG/M
3300032001|Ga0306922_10004811All Organisms → cellular organisms → Bacteria12835Open in IMG/M
3300032160|Ga0311301_11405283All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300032180|Ga0307471_100026565All Organisms → cellular organisms → Bacteria4372Open in IMG/M
3300032180|Ga0307471_101751092Not Available774Open in IMG/M
3300032782|Ga0335082_11218648All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium620Open in IMG/M
3300032783|Ga0335079_10633220Not Available1125Open in IMG/M
3300032892|Ga0335081_10362692Not Available1882Open in IMG/M
3300032892|Ga0335081_11996116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium619Open in IMG/M
3300032955|Ga0335076_10667234Not Available921Open in IMG/M
3300033158|Ga0335077_11641311Not Available610Open in IMG/M
3300034199|Ga0370514_085830Not Available800Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.09%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.51%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.51%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.34%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.92%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.75%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.75%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.17%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.17%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.17%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.17%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.17%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.58%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.58%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.58%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.58%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.58%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.58%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.58%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.58%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.58%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.58%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001141Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2EnvironmentalOpen in IMG/M
3300001178Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025998Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026890Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes)EnvironmentalOpen in IMG/M
3300026941Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes)EnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12638J13249_10359923300001141Forest SoilNGPLPTTRESESEPSRDVKEMIEASARMERVTVGD*
JGI12646J13576_10586313300001178Forest SoilGAHYFTVNGQLPTIRETEARPSEHVLDMIEASAKTERVGVSD*
JGI12712J15308_1019816623300001471Forest SoilTVNGPLPTTRESEAPPSARVLEMIEASAKTERLEVSG*
Ga0055437_1015499013300004009Natural And Restored WetlandsAGTPYVTVNGPLPTQREHDPPPSRRVVEMVEASAKTERVGVTK*
Ga0062386_10061926023300004152Bog Forest SoilVAGAHYFTVNGPLSTTRETEAAPSKHVKEMVAASAKVERVGVTD*
Ga0066679_1004062233300005176SoilYVTVDGPLETTREHEAAPSQRVVQMVEASAKTERVVVSK*
Ga0066388_10241840723300005332Tropical Forest SoilYFTVNGPLPTTRESESQPTQHIKEMIEASARNERVGVGD*
Ga0070733_1040020913300005541Surface SoilHYHTVHGPLPTTRESEAAPSARVLDMIEASAKTERVGVTD*
Ga0070732_1035234813300005542Surface SoilVNGPLPTVRENDPGPSRHVVEMVEASARTEKVGATD*
Ga0066704_1014342153300005557SoilTVDGPLPTTRETESAPSRRVMEMIEASAKGERVEVGD*
Ga0068857_10093836313300005577Corn RhizosphereITVDGPLATTREHDPTPSRRVVEMVEASARVEKAGVSS*
Ga0066706_1142257823300005598SoilYFTVNGPLPTTRESESEPSRDVKEMIEASARMERVTVGD*
Ga0066903_10380829613300005764Tropical Forest SoilAGQRYYTVNGPLPTTRESETASNARVRELVEAGARSEGEGA*
Ga0070766_1075636723300005921SoilHYFTVDGPLETTREHDGPPSQRVVEMVEASARVEQVVSR*
Ga0066787_1003144113300005950SoilAGAHYVTVNGPLAATRETEAPPSEHVLEIIAASKKKEKGVVP*
Ga0070717_1138105213300006028Corn, Switchgrass And Miscanthus RhizosphereVEGPLPTEREHDPPPSRRVVEMVEASAQLEKAGVSS*
Ga0075028_10057834523300006050WatershedsPLPTTREHEAAPSAHVVEMVEASAQVERVEVAVK*
Ga0075029_10087770413300006052WatershedsGPLSTTRENEAAPSKHVREMVAASAKKEGVAVTD*
Ga0075019_1073714123300006086WatershedsVNGPLATTREQEAAPSQRVVEMIEESAKTERVGVES*
Ga0075030_10033294413300006162WatershedsAHYYTVNGPLPTTRESEAEPSQHVKEMIEASARTERVVVGD*
Ga0075018_1040782713300006172WatershedsYFTVNGPLPTVRETEAAPSRNVVEMVEASARTEQVGVSR*
Ga0070716_10110545713300006173Corn, Switchgrass And Miscanthus RhizosphereAHYVTVDGPLAADRENETTPSRRVKEMVEASAKTERVGAD*
Ga0070716_10123692733300006173Corn, Switchgrass And Miscanthus RhizosphereDGPLPTTREHEAPPSQRIIEMVEASAKIEGVAAKD*
Ga0070765_10003754213300006176SoilVAGAHYFTVNGPMSMTRESEAAPSKRVKEMVEASAKIERVGATD*
Ga0070765_10055510523300006176SoilTVNGPLSTTRETEAPPSKRVKEMVAESAKKEQVGATD*
Ga0079222_1008305313300006755Agricultural SoilNGPLPTTREHESAPSKRVLEMIEASAKTEQVPELTSTD*
Ga0066660_1072937913300006800SoilGPLPTTRESESEPSRDVKEMIEASARMERVTVGD*
Ga0066660_1129472113300006800SoilAGAHYFTVNGPLSTTRENEAPPSRRVKEMVAASAKVEGVAATD*
Ga0099795_1011949223300007788Vadose Zone SoilVNGPLPTTRETEAEPSRRVLEMIETSAKTERLGVSG*
Ga0102924_110547823300007982Iron-Sulfur Acid SpringFTVNGPLATARETEAAPSQRVVDMVEASAKTERVGVTD*
Ga0099830_1006859533300009088Vadose Zone SoilNGPLSTTREHEAPPSKKVKEMVAASAKAEGVAATD*
Ga0099830_1089287423300009088Vadose Zone SoilTVDGPLETTREHEAAPSQRVVEMVEASAKTERVTVSK*
Ga0116112_100682213300009636PeatlandGAHYFTVNGPLPTIRETEAPPSARVLDMIEASAKTERVGVSG*
Ga0116118_117722623300009637PeatlandGGPLPTTREHEAPPSRHVVDMVEASAIIEPIGVGD*
Ga0116113_107316623300009638PeatlandQRYYTVNGPLPTTRETEAAPSRHVREMVEESAKSEGIGVAD*
Ga0116224_1021991013300009683Peatlands SoilGPLSTTRENEAAPNDHVVKMVKASAKKEGVAASD*
Ga0126373_1147459113300010048Tropical Forest SoilAGAHYFTVNGPLPTARESEAAPSQRVIDMVETSAKTERVGVTE*
Ga0074046_1079946313300010339Bog Forest SoilGALPTTRESEAPPSERVLEMIEASAKTERVGVSS*
Ga0126372_1012745543300010360Tropical Forest SoilVDGPLPMTRETESAPSRRVMDMIEASARGERVEVGD*
Ga0126378_1080197723300010361Tropical Forest SoilGPLSTTRENEQPPSRRVKEMVEASAKAEGVAATD*
Ga0126379_1033327813300010366Tropical Forest SoilVNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD*
Ga0126379_1325780323300010366Tropical Forest SoilMNGPLPTTRESEAPASSRVLEMIEASAKTERVGVSD*
Ga0126381_10155456823300010376Tropical Forest SoilYFTVNGALSTTREHETPPSERVVEMVEASAKKEGVAATD*
Ga0136449_10198591913300010379Peatlands SoilNGPLPTTRESESAPSRHVLDMIEASAKTERVGVAD*
Ga0134121_1310413513300010401Terrestrial SoilGPLPTVRENDPGPSRHVVEMVEASARTEKVGATD*
Ga0150983_1011376513300011120Forest SoilHTVDGPLATTRENEAAPSKHVVRMVEASAKREGVAATD*
Ga0137391_1004544813300011270Vadose Zone SoilAHYFTVNGPLSTTRENEAPPSKRVKEMVAASAKAEGVAATD*
Ga0137388_1136224013300012189Vadose Zone SoilYHTVNGPLPTTRESESAPSERVLEMIEASAKTERVGVSG*
Ga0137365_1110211813300012201Vadose Zone SoilHYFTLKGSLPTTREHEAPPSERIVEMIEAGAKTERVGVAE*
Ga0137399_1088543623300012203Vadose Zone SoilTVDGPLETTREHEATPSQRVVQMVEASAKTERVVVSK*
Ga0137385_1115276013300012359Vadose Zone SoilVDGPLPTTRETEAAPSRRVMEMIEASAKGERVEVGD*
Ga0137397_1010151413300012685Vadose Zone SoilTVDGPLSTTREHEAAPNSQVKEMVAGAKREGVAATD*
Ga0137397_1072765123300012685Vadose Zone SoilVNGPLSTTRENEAPPSRRVKEMVAASAKVEGVAATD*
Ga0137396_1019077533300012918Vadose Zone SoilAGAHYFTVNGPLSTTRENEALPSRRVKEMVAASAKAEGVAATD*
Ga0181532_1031016613300014164BogGPLSTSRENEQAPSRRVVEMVEASAKIEGVEATD*
Ga0181537_1007201733300014201BogFTVNGPLPTTRETEAPASEKVLDMIEASAKTERVGVSD*
Ga0182015_1104246613300014495PalsaVNGPLPTTRETEAEPSRRVREMVEASAKIERLGVTD*
Ga0182024_1247440013300014501PermafrostGPLPTTRESEAPPSERVIDMIEASAKTEQVGVSD*
Ga0181525_1001363973300014654BogHYFTVDGPLPTTREHDPAPSDRVVEMVEASARIEQAVSR*
Ga0137420_1347815113300015054Vadose Zone SoilVAGAPYVSVDGPLETTREHEAAPSQRVVQMVEASAKRSASSFQK*
Ga0167631_103669333300015168Glacier Forefield SoilAHYFTVDGQLPTTREHEAEPSRRVVEMVEARAKIEGVAATD*
Ga0182036_1103208813300016270SoilHYFTVSGPLSTTREHEAPPSERVLEMVEASAKREGVAATD
Ga0182033_1124842413300016319SoilVNGPLPTTREIEGGPSQSVRELIESSAQTERVGADD
Ga0182035_1063281113300016341SoilAHYFTVNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD
Ga0187856_129113223300017925PeatlandVNGPLATTRETEAAPSKRVVEMVEASAKTERVGVTD
Ga0187807_120439313300017926Freshwater SedimentTVNGPLPTTRESEASPSERVLEMIETSAKTERVGVSD
Ga0187801_1026945323300017933Freshwater SedimentFTVNGPLPTTRETEAAPSQRVIDMIESSAKSERVGVSD
Ga0187782_1169184823300017975Tropical PeatlandAGTQYFTVKGPLPTVRETEPTPNLNVVEMVEASARTEQVGVSR
Ga0187816_1017437513300017995Freshwater SedimentAHYFTVNGPLPTARESEAAPSQRVVEMVEASAKTERVGVTD
Ga0187859_1014287013300018047PeatlandVNGPLPTTRETEAPASEKVLDMIEASAKTERVGVSD
Ga0187784_1095066623300018062Tropical PeatlandGAHYFTVHGPLPTARETEAPPSQRIIERVEASARTERVVVPDV
Ga0187770_1031202023300018090Tropical PeatlandVNGPLPTTRESEAPASTRVLEMIEASAKTERVGVTR
Ga0066662_1234620913300018468Grasslands SoilGAHYCPVNGPLPSTRESEAAPSRDVKELIEASAKSERVTVGD
Ga0210407_1116295813300020579SoilYFTVNGPLSTTRENEAAPSAHVKEMVAGAKREGVAASD
Ga0210399_1013065713300020581SoilHYFTVNGPLSTTRENEAAPTKKVKEMVAASAKAEGVAATD
Ga0210399_1090466923300020581SoilHTVNGPLPTTRDSEAPPSAHVLEMIEASAKTERVEV
Ga0210399_1121921923300020581SoilFTVNGPLPTTRESESAPSQHVREMIEASAKTERVGVGD
Ga0210395_1086414913300020582SoilMVAGAHYFTVNGPMSATRESEAAPSKRVKEMVEASAKIERVGAAD
Ga0210400_1070264613300021170SoilYVTVDGPLATTREHEAAPSQRVVEMVETSAKTERVVVSK
Ga0210405_1006717213300021171SoilHYFTVNGPLSTTREHEAAPSRRVKEMVEASAKIEGVAATD
Ga0210405_1059672923300021171SoilYFTVNGPLSTTRENEAPPSSRVVKMVEASAKAEGVAATD
Ga0210405_1092734123300021171SoilGAHYFTVNGPMSATRESEAAPSKRIKEMVEASAKIERVGATD
Ga0210408_1002706613300021178SoilEGPLPTTREHEAPPNKRIVQMVEDSAKIEGVAATD
Ga0210396_1004759643300021180SoilHTVSGPLPMLRENEQAPSKRVKEMVEASAKHEGVAATD
Ga0210396_1080069113300021180SoilHYFTVDGPLSTTRELEAAPNTHVKEMVAGAKREGVAATD
Ga0213876_1003716333300021384Plant RootsLTVEGPLPTARENEAPPSQRIVEMVEASSKSEGVAARS
Ga0210393_1008663733300021401SoilAHYFTVNGPLSTTRESEAAPSKRVVEMVEASAKKEGVGATD
Ga0210393_1045268013300021401SoilHYFTVNGPLSTTRETEAPPSKRVKEMVAESAKKEQVGATD
Ga0210385_1133000523300021402SoilYYTVNGPLPTIRESEAPASDRVLDMIEASAKTERVGVSS
Ga0210397_1057120223300021403SoilVNGPLSTTRENEALPSRRVVEMVEACAKKEGVGTTD
Ga0210387_1109864123300021405SoilMVAGAHYFTVNGPLSTTRENQAQPSKRVKEMVAGAKREGVAATD
Ga0210386_1108802223300021406SoilVAGAHYFTVNGPLSATRESEAAPSKRVKEMVEASAKIERVGATD
Ga0210386_1110010313300021406SoilFTVNGPLSTTRESEAAPSKRVKEMVEASAKIERVGATD
Ga0210383_1011699133300021407SoilFTVNGPLPTTRENESAPSRRVVEMIEESSRTERVGVSD
Ga0210394_1022094633300021420SoilHYHTVNGPLPATRETEAPPSARVLDMIEASAKTERVGVSD
Ga0210384_1137944323300021432SoilGAHYFTVNGPLSTTRENEAAPSKHVKEMVAGAKREGVAASD
Ga0210384_1142663413300021432SoilYHTVNGPLPTLREHDPAPSQRIVEMVEASARAEQVGVSD
Ga0210391_1012242443300021433SoilYTVNGPLPTTRETEASASDRVREMIEAGAKTERVGVPG
Ga0210391_1111507013300021433SoilAGAHYFTVNGPLSTTRESEAAPSKRVKEMVEASAKIERVGATD
Ga0210390_1044099023300021474SoilYYTVNGPLPTTRESESAPSERVLEMIETSAKTERVGV
Ga0210398_1010262533300021477SoilGAHYFTVNGPLSTTRENEAAPSAHVKEMVAGAKREGVAASD
Ga0210398_1052451613300021477SoilHYFTVDGPLPTTREHDPEPSQRVVEMVEASARTEQVVSR
Ga0210402_1031017633300021478SoilTVEGPLPTVRENEATPSQRVVEMVEASAKIEGVAATD
Ga0210409_1099388013300021559SoilVDGPLDTTREHEAAPSQRVVEMVEASAKTERVVVSK
Ga0126371_1341924713300021560Tropical Forest SoilVNGPLSTTRENEQPPSRRVKEMVEASAKAEGVAATD
Ga0212123_1036108813300022557Iron-Sulfur Acid SpringVNGPLPTIRETEAPASERVIEMIESSAKTERVGVTD
Ga0209483_121581823300025862Arctic Peat SoilYMSVKGPLPTVRENEAPPSQHVVEMIEASAKTERVGVTD
Ga0207684_1011757433300025910Corn, Switchgrass And Miscanthus RhizosphereMSLSNNTVNGPLPTTRESEAPASKHVLDMIEASAKTEKIGV
Ga0207646_1032055023300025922Corn, Switchgrass And Miscanthus RhizosphereTVNGPLPTTREHEATPSQRVVEMIEASAKTERVGVSD
Ga0208651_102566323300025998Rice Paddy SoilFTVKGPLPTTREHESAPSQRVLEMIEASAKTEQVPELTSTD
Ga0209438_108315513300026285Grasslands SoilTVDGPLETTREHEATPSQRVVQMVEASAKTERVVVSK
Ga0209239_119034423300026310Grasslands SoilFTVNGPLPTTREHEPAPSPRVVEMIEASSKTERVGVAD
Ga0209156_1013456313300026547SoilHTVNGPLSTTRENEQPPSRRVKEMVEASAKAEGVAATD
Ga0209474_1029417023300026550SoilTVKGPLSTTRELEAAPNRDVVELIAAGAKTEKVGTP
Ga0179587_1073475423300026557Vadose Zone SoilSYVTVDGPLDTTREHEAAPSQRVVEMVEASAKPERVVVSK
Ga0207781_100342813300026890Tropical Forest SoilTVNGPLETTRENEPALNQEVKEMIATVARHEGVAATD
Ga0207741_102668623300026941Tropical Forest SoilAGAHYHTVNGPLETTRENEPALNQEVKEMIATVARHEGVAATD
Ga0207726_101220523300027045Tropical Forest SoilTVNGPLSTARENEAPPSRHVVEMVEASAKIERVGATD
Ga0208730_104598423300027047Forest SoilNGPLPTIRETEAAPSEKVLDMIEASAKTERVGVSD
Ga0207762_100676533300027063Tropical Forest SoilVNGPLPTTRESEASPSERVVEMIEASAKTERVGVSG
Ga0207762_107115523300027063Tropical Forest SoilDKLMVAGAHYHTVNGPLETTRENEPALNQEVKEMIATVARHEGVAATD
Ga0209684_107812813300027527Tropical Forest SoilGAHYFTVNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD
Ga0209329_102166323300027605Forest SoilYFTVNGPLATTRETEAAPSKRVKEMVAASARTERVGVTD
Ga0209329_114828913300027605Forest SoilLVAGAHYFTVNGQLPTIRETEARPSEHVLDMIEASAKTERVGVSD
Ga0209009_101698133300027667Forest SoilLMVAGAHYHTVSGPLPMLRENEQAPSKRVKEMVEASAKHEGVAATD
Ga0209178_115740113300027725Agricultural SoilHYFTVNGPLPTIRETEAAPSQRVLEMVEAGAKTEGVGVR
Ga0209772_1029304413300027768Bog Forest SoilFTVNGPMSATRESESAPSKRVKEMVEASAKIERVGVTD
Ga0209590_1018976913300027882Vadose Zone SoilTVNGPLSTTRENEAPPSRRVKEMVAASAKVEGVAATD
Ga0209488_1002420713300027903Vadose Zone SoilNGPMPTIRETEAPPSEKVLDMIEASAKTERVGVSG
Ga0209415_1027140323300027905Peatlands SoilVNGPLSTTRENEAAPSRRVVEMVEASAKKEGVGATD
Ga0209006_1041375823300027908Forest SoilHTVNGPLPTTRETEASPSERVLEMIETSAKTERVGVSG
Ga0209526_1082582723300028047Forest SoilHYHTVNGPLQTTREHEAPPTKRVRELIEASAKTERVGVTD
Ga0308309_1004164613300028906SoilHYHTVNGPLPTTRESEAEPSQHVKEMIEASAKTERVTVGD
Ga0311327_1050142913300029883BogAGSHYVTVNGPLPTVRETEAPPSEHVLDMIEASAKTERVGVSG
Ga0311359_1111023923300029914BogYFTVDGPLPTTRETESSPSVHVKEMIDASAKTERVVMAD
Ga0311328_1048900423300029939BogYFTVNGPLSTTRETEAAPSERVLDMIDASAKTERVGVSD
Ga0311340_1113959833300029943PalsaTVNGPLPTTRETEAAPSRHVREMVEESAKSEGIGVAD
Ga0311339_1109360923300029999PalsaRYYTVNGPLPTTRELEAPPSRHVREMVEASAKSEGVAVSSDD
Ga0311372_1235578223300030520PalsaAHYFTVNGPLPTVRETEATASERVIEMIESSAKTERVGVTD
Ga0265753_111305713300030862SoilGAHYHTVSGPLPMLRENEQAPSKRVKEMVEASAKHEGVAATD
Ga0265770_105617723300030878SoilAHYFTVNGPLATARETEAAPSQRVVDMVEASAKTERVGVTD
Ga0265740_101261613300030940SoilHYFTVNGPLPTIRETEAPASERVIEMIESSAKTERVGVTD
Ga0265740_104466623300030940SoilVAGAHYFTVNGPLSATRESETAPSKRVKEMIEASAKIERVGATD
Ga0265328_1025905523300031239RhizosphereGQRYYTVNGPLPTTRETEAAPSRHVREMVEESAKSEGIGVAD
Ga0170818_10240276813300031474Forest SoilVNGPLATTRETEAAPSKRVKEMVTASARTERVGVTD
Ga0318538_1050977713300031546SoilGAHYFTVNGPLSTARENEAPPSRHVVEMVEASAKIERVGATD
Ga0318561_1061230113300031679SoilYTVNGPLSTTRENEQPPSRRVKEMVESSAKAEGVAATD
Ga0310686_11269083433300031708SoilVHGPLATTRENEAAPSQRVVEMIETSARTERVTVPD
Ga0306917_1019189513300031719SoilVNGPLPTTRESEAPPSERVLERIEASAKNERVGVSSSRSR
Ga0307477_1023652713300031753Hardwood Forest SoilTQYHTVNGPLPTLREHDPAPSQRIVEMVEASARAEQVGVSD
Ga0318576_1028775523300031796SoilFTVNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD
Ga0318523_1020885923300031798SoilYHTVEGPLPTEREQEAPPSQRIVEMVEASARNEGVGVTR
Ga0307478_1077850423300031823Hardwood Forest SoilFTVNGPLSTTRENEAAPSRRVKEMVEASAKIEGVAATD
Ga0318512_1011366123300031846SoilVNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD
Ga0306923_1181889723300031910SoilVNGPLPTTRESEGEPSQSVRELIESSAQTERIGAAD
Ga0310916_1148383713300031942SoilLMVAGAHYFTVNGPLSTTRENEQVPSKLVVAMVEASAKKEGVAATD
Ga0310910_1007613633300031946SoilVNGALSTTRENEALPSRRVVEMVEASAKKEGVGAAD
Ga0307479_1022832413300031962Hardwood Forest SoilAHYYTVNGPLPTTRETEGSRSERVLEMIETSAKTERVGVSG
Ga0307479_1098817123300031962Hardwood Forest SoilAHYHTVNGPLSTTRENEAPPSSRVKEMVAAGAKVEGVAATD
Ga0306922_1000481113300032001SoilVNGPLSTARENEAPPSRHVLEMVEASAKIERVGATD
Ga0311301_1140528313300032160Peatlands SoilNGPLPTTRESESAPSRHVLDMIEASAKTERVGVAD
Ga0307471_10002656513300032180Hardwood Forest SoilMVAGAHDHTVNGPLATTRENEAPPSRRVKEMVAASAKVEGVAATD
Ga0307471_10175109223300032180Hardwood Forest SoilYFTVNGPLSTTREAEAAPSKRVKEMIAASAKTERVGVTD
Ga0306920_10058567313300032261SoilLMVAGAHYYTVNGPLETTRENEATPNQEVKEMIQAVAKHEGVAATD
Ga0335082_1121864823300032782SoilTQYHTVNGPLPTLREHDPAPSRRVVEMIEASAQTERVGATD
Ga0335079_1063322023300032783SoilHYFTVNGPLPTTRESEAAPSQRVLEMVEAGAKKEGVGVR
Ga0335081_1036269233300032892SoilNGPLPTTRENENEPSQRVVEMIEASSKAERVEVGD
Ga0335081_1199611613300032892SoilHYFTVDGPLATTREHDGPPSDRVVEMVEASARIEQAVTR
Ga0335076_1066723423300032955SoilHYFTVNGPLPTTRESEAPASSHVLEMIEASAKTEKVGV
Ga0335077_1164131113300033158SoilNGPLPTTRESEAPPSERVLDMIEASAKSERVGVSS
Ga0370514_085830_659_7963300034199Untreated Peat SoilLVAGAHYFTVNGPLSTTRESEAAPSKRVKEMVEASAKIERVGATD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.