Basic Information | |
---|---|
Family ID | F035449 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 172 |
Average Sequence Length | 46 residues |
Representative Sequence | MEYGNTAIIFMVIAVVACVLGLTFFGVYYLNKIVDQNAREGGSVRQP |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 172 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 88.24 % |
% of genes near scaffold ends (potentially truncated) | 13.95 % |
% of genes from short scaffolds (< 2000 bps) | 85.47 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.837 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (18.605 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.535 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.372 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.00% β-sheet: 0.00% Coil/Unstructured: 44.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 172 Family Scaffolds |
---|---|---|
PF01322 | Cytochrom_C_2 | 18.60 |
PF04392 | ABC_sub_bind | 1.16 |
PF01575 | MaoC_dehydratas | 0.58 |
COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
---|---|---|---|
COG3909 | Cytochrome c556 | Energy production and conversion [C] | 18.60 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.16 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.84 % |
Unclassified | root | N/A | 1.16 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_16855590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5068 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig59533 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
2170459002|F0B48LX02IN475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2421067 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2424170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2292 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1006038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2128 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1002801 | All Organisms → cellular organisms → Bacteria | 2805 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10061530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10132435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10142311 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10159626 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300001867|JGI12627J18819_10058854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1601 | Open in IMG/M |
3300001867|JGI12627J18819_10135782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1006 | Open in IMG/M |
3300002908|JGI25382J43887_10475678 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300002914|JGI25617J43924_10006028 | All Organisms → cellular organisms → Bacteria | 3728 | Open in IMG/M |
3300004267|Ga0066396_10022105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 867 | Open in IMG/M |
3300004281|Ga0066397_10098880 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300004633|Ga0066395_10047440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1885 | Open in IMG/M |
3300004633|Ga0066395_10149514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 1181 | Open in IMG/M |
3300004633|Ga0066395_10466171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
3300004633|Ga0066395_10556560 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005165|Ga0066869_10014701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1116 | Open in IMG/M |
3300005177|Ga0066690_10875388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
3300005332|Ga0066388_100230602 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
3300005332|Ga0066388_100350282 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
3300005332|Ga0066388_100458674 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
3300005332|Ga0066388_102090390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1018 | Open in IMG/M |
3300005332|Ga0066388_102698432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 906 | Open in IMG/M |
3300005332|Ga0066388_102844314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
3300005332|Ga0066388_103114788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 847 | Open in IMG/M |
3300005332|Ga0066388_104117032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 741 | Open in IMG/M |
3300005332|Ga0066388_104140150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 739 | Open in IMG/M |
3300005332|Ga0066388_104355564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 721 | Open in IMG/M |
3300005332|Ga0066388_105356703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300005363|Ga0008090_15077918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 587 | Open in IMG/M |
3300005436|Ga0070713_100517115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1128 | Open in IMG/M |
3300005436|Ga0070713_101084255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
3300005445|Ga0070708_100040296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4090 | Open in IMG/M |
3300005454|Ga0066687_10280732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 938 | Open in IMG/M |
3300005467|Ga0070706_100384234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1307 | Open in IMG/M |
3300005471|Ga0070698_100835785 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300005546|Ga0070696_100251548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1336 | Open in IMG/M |
3300005547|Ga0070693_101364537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
3300005764|Ga0066903_101405734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1311 | Open in IMG/M |
3300005764|Ga0066903_102029335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 1105 | Open in IMG/M |
3300005764|Ga0066903_102397403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1020 | Open in IMG/M |
3300005764|Ga0066903_102545881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 991 | Open in IMG/M |
3300005764|Ga0066903_103516358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 844 | Open in IMG/M |
3300005764|Ga0066903_104972437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
3300005764|Ga0066903_105217386 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300005764|Ga0066903_107873551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
3300005764|Ga0066903_108921312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300005764|Ga0066903_108949322 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300006038|Ga0075365_10200948 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300006172|Ga0075018_10665446 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300006173|Ga0070716_101478157 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300006797|Ga0066659_10116750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1844 | Open in IMG/M |
3300006806|Ga0079220_11981319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
3300006914|Ga0075436_100782259 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300006914|Ga0075436_100894376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
3300006954|Ga0079219_10297346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 997 | Open in IMG/M |
3300009012|Ga0066710_100346768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2194 | Open in IMG/M |
3300009012|Ga0066710_102223119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 800 | Open in IMG/M |
3300009089|Ga0099828_10621183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 972 | Open in IMG/M |
3300009090|Ga0099827_11017606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
3300009094|Ga0111539_12061955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
3300009143|Ga0099792_10080259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1668 | Open in IMG/M |
3300009147|Ga0114129_11300230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
3300009162|Ga0075423_10676353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1089 | Open in IMG/M |
3300009162|Ga0075423_10759668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1025 | Open in IMG/M |
3300009488|Ga0114925_10354791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1006 | Open in IMG/M |
3300009792|Ga0126374_11700954 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300010043|Ga0126380_11192968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300010046|Ga0126384_10739604 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300010047|Ga0126382_10552294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 938 | Open in IMG/M |
3300010048|Ga0126373_10233881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1800 | Open in IMG/M |
3300010359|Ga0126376_10899657 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300010360|Ga0126372_10897122 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300010360|Ga0126372_11486807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
3300010361|Ga0126378_12813233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
3300010361|Ga0126378_12947004 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300010362|Ga0126377_11767897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
3300010362|Ga0126377_11908076 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300010366|Ga0126379_13847057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300010396|Ga0134126_12463274 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300010863|Ga0124850_1027015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1844 | Open in IMG/M |
3300012189|Ga0137388_10040376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3713 | Open in IMG/M |
3300012198|Ga0137364_10375391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1062 | Open in IMG/M |
3300012203|Ga0137399_11044991 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300012210|Ga0137378_11133164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
3300012361|Ga0137360_11211724 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300012948|Ga0126375_11768374 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300012971|Ga0126369_10611629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1161 | Open in IMG/M |
3300012971|Ga0126369_13271752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300012986|Ga0164304_11487100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
3300016294|Ga0182041_11581617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300016319|Ga0182033_10536243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1010 | Open in IMG/M |
3300016341|Ga0182035_11571552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
3300016357|Ga0182032_10560204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 946 | Open in IMG/M |
3300016357|Ga0182032_11268284 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300016404|Ga0182037_11102424 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300020199|Ga0179592_10326087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
3300020579|Ga0210407_10433680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1028 | Open in IMG/M |
3300020580|Ga0210403_10535572 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300021168|Ga0210406_10416825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1073 | Open in IMG/M |
3300021361|Ga0213872_10007307 | All Organisms → cellular organisms → Bacteria | 5450 | Open in IMG/M |
3300021372|Ga0213877_10150544 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300021372|Ga0213877_10262252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
3300021405|Ga0210387_10082821 | All Organisms → cellular organisms → Bacteria | 2651 | Open in IMG/M |
3300021444|Ga0213878_10134898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1018 | Open in IMG/M |
3300021478|Ga0210402_10287581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1521 | Open in IMG/M |
3300021560|Ga0126371_10457557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1422 | Open in IMG/M |
3300021560|Ga0126371_10546169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1308 | Open in IMG/M |
3300021560|Ga0126371_10809698 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300021560|Ga0126371_12591318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
3300024288|Ga0179589_10009774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2810 | Open in IMG/M |
3300025885|Ga0207653_10409709 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300025910|Ga0207684_10053909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3412 | Open in IMG/M |
3300025939|Ga0207665_10707365 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300026304|Ga0209240_1126818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 859 | Open in IMG/M |
3300026306|Ga0209468_1101085 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300026310|Ga0209239_1291495 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300026319|Ga0209647_1025246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3585 | Open in IMG/M |
3300026322|Ga0209687_1110923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
3300027502|Ga0209622_1023698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1081 | Open in IMG/M |
3300027548|Ga0209523_1003766 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
3300027576|Ga0209003_1008876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1469 | Open in IMG/M |
3300027646|Ga0209466_1004699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2861 | Open in IMG/M |
3300027654|Ga0209799_1000172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 11684 | Open in IMG/M |
3300027874|Ga0209465_10074508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1648 | Open in IMG/M |
3300027874|Ga0209465_10189534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1026 | Open in IMG/M |
3300027882|Ga0209590_10030018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2862 | Open in IMG/M |
3300027909|Ga0209382_10215323 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
3300028705|Ga0307276_10079397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
3300028824|Ga0307310_10677476 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031446|Ga0170820_17678237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1548 | Open in IMG/M |
3300031543|Ga0318516_10022116 | All Organisms → cellular organisms → Bacteria | 3263 | Open in IMG/M |
3300031543|Ga0318516_10088758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1733 | Open in IMG/M |
3300031544|Ga0318534_10418566 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300031545|Ga0318541_10189267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1137 | Open in IMG/M |
3300031545|Ga0318541_10430782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
3300031545|Ga0318541_10573036 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300031545|Ga0318541_10649929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
3300031564|Ga0318573_10148232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1229 | Open in IMG/M |
3300031572|Ga0318515_10570524 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300031573|Ga0310915_10275979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1185 | Open in IMG/M |
3300031681|Ga0318572_10887926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300031716|Ga0310813_10407208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1171 | Open in IMG/M |
3300031719|Ga0306917_11341888 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300031740|Ga0307468_101902544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
3300031794|Ga0318503_10241959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
3300031794|Ga0318503_10297643 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300031798|Ga0318523_10101229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1413 | Open in IMG/M |
3300031798|Ga0318523_10560508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
3300031805|Ga0318497_10402727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
3300031859|Ga0318527_10269766 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300031879|Ga0306919_10011855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4965 | Open in IMG/M |
3300031879|Ga0306919_10626518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 829 | Open in IMG/M |
3300031879|Ga0306919_10902155 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300031912|Ga0306921_12181226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
3300031941|Ga0310912_10598290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 858 | Open in IMG/M |
3300031947|Ga0310909_10553723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 962 | Open in IMG/M |
3300032059|Ga0318533_10344023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1086 | Open in IMG/M |
3300032059|Ga0318533_11274580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300032067|Ga0318524_10190093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1048 | Open in IMG/M |
3300032261|Ga0306920_100951091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1253 | Open in IMG/M |
3300032261|Ga0306920_101482254 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300032261|Ga0306920_101552379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 943 | Open in IMG/M |
3300032261|Ga0306920_103239538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
3300033289|Ga0310914_11761493 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 18.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.30% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.23% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.07% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.07% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.91% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.16% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.58% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.58% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.58% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_02140310 | 2088090014 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFAVYCLNKIVDRNAREGGSAREP |
KansclcFeb2_08198400 | 2124908045 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYYLNKIVDQNAREGGSVRQP |
E1_02662830 | 2170459002 | Grass Soil | VDYGNTAIVFMVIAVVSCVLGLSFFGVYYLDKSVDQNAPEGGDVRKT |
ICChiseqgaiiDRAFT_24210673 | 3300000033 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYYLNKIVDQNAREGGSVRQP* |
ICChiseqgaiiDRAFT_24241702 | 3300000033 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFAVYCLNKIVDRNAREGGSAREP* |
AP72_2010_repI_A01DRAFT_10060383 | 3300000579 | Forest Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRKT* |
AF_2010_repII_A01DRAFT_10028013 | 3300000580 | Forest Soil | MEYGNAAIIFMVIAVVACVLGLTFFGVYCLNKFVDQNTREGGSVRQP* |
AF_2010_repII_A1DRAFT_100615302 | 3300000597 | Forest Soil | MEHGNTAIIFMVVAVVSCVLGLTFLGVYYLNKIVDQNAPEGGSARKT* |
AF_2010_repII_A1DRAFT_101324352 | 3300000597 | Forest Soil | MEYGNTAIIFMVIAVVSCVLGLSFFGVYYLNKIVEQNAPEGGSVRKM* |
AF_2010_repII_A1DRAFT_101423111 | 3300000597 | Forest Soil | MEYGNTAIIFMVVAVVSCVLALSFFGVYYLNXIXDQNAPEGGSXRKT* |
AF_2010_repII_A1DRAFT_101596262 | 3300000597 | Forest Soil | MEYGNPAIISMVIAVVACVLGLTFFGVYYLNKIVDRNAREGGSVRKT* |
JGI12627J18819_100588543 | 3300001867 | Forest Soil | MEYGNTAIIFMVIAVVACGLGVTFFGVYYLNKIVDQNAREGGSVRQP* |
JGI12627J18819_101357822 | 3300001867 | Forest Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYYLNKFVDQNAREGGSVRKT* |
JGI25382J43887_104756782 | 3300002908 | Grasslands Soil | EYGNTAIIFMVIAVVACVLGLTFFGVYYLNKIVDQNAREGGSVRQP* |
JGI25617J43924_100060283 | 3300002914 | Grasslands Soil | MEYGNTAIIFTVIAVVACVLGLTFFGVYCLNKFVDQNAREGGSVRQP* |
Ga0066396_100221052 | 3300004267 | Tropical Forest Soil | MEYGNTAIIFMVVAVVSCVLALSFFGIYYLNKIVDQNAPEGGSVRKT* |
Ga0066397_100988802 | 3300004281 | Tropical Forest Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRKR* |
Ga0066395_100474402 | 3300004633 | Tropical Forest Soil | MEYGNTAIIFMVVAVVSCVLALSFFGIYYLNKIVDQNAPGGGSVRKT* |
Ga0066395_101495142 | 3300004633 | Tropical Forest Soil | MEYGNTAIIFMVVAVVSCVLALSFFGVYYLNKIVDQNAPEGGSARKT* |
Ga0066395_104661711 | 3300004633 | Tropical Forest Soil | MEYGNAAIIFMVIAVVACVLGLVFFGVYCLNKFVDQNAREGGSVRQP* |
Ga0066395_105565602 | 3300004633 | Tropical Forest Soil | MEYGNAAIIFMVIAVVACVLGLTFFGVYCLNKFVDQNTRKGGSVRQP* |
Ga0066869_100147011 | 3300005165 | Soil | MEYGNTAIIFMVIAVVGCVLGFTFFGVYYLNKFVDQNTREGGSVGKT* |
Ga0066690_108753882 | 3300005177 | Soil | MEYGNTAIIFMVIAVVACALGLTFFGVYYLNKIVDQNAREGSSGRQT* |
Ga0066388_1002306023 | 3300005332 | Tropical Forest Soil | MDYGNTAIIFMVITVVACVLALTFFAVYCLNKIVDRNAREGGSAREP* |
Ga0066388_1003502823 | 3300005332 | Tropical Forest Soil | MDYGNTAIIFMVLAVVACVLGLTFFGVYYLNKIVDRNAREGGSAREP* |
Ga0066388_1004586741 | 3300005332 | Tropical Forest Soil | MEYGNTAIIFMVIAVVAGVLGLTAFGVYYLNKIVDQSAREGGSGRQT* |
Ga0066388_1020903902 | 3300005332 | Tropical Forest Soil | MQYDNTAIIFMVIAVVACVLALTFFGVYYLNKIVDQNAREGGSAREP* |
Ga0066388_1026984322 | 3300005332 | Tropical Forest Soil | MEYGNTAIIFMVIAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRKS* |
Ga0066388_1028443142 | 3300005332 | Tropical Forest Soil | MDYGNTAIIVMVLAVVACVLGLTFFAVYYLNKIVDQNAREGGSAREP* |
Ga0066388_1031147882 | 3300005332 | Tropical Forest Soil | MDYGNTAIIFMVIAVVACVLGLTFIGVYYLNKIVDRNAREGGSAREP* |
Ga0066388_1041170322 | 3300005332 | Tropical Forest Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYCLNKFVDQNTREGGSVRQP* |
Ga0066388_1041401502 | 3300005332 | Tropical Forest Soil | MEYGNAAIIFMVIAVVACVLGLTFFGVYCLNKLVDQNTREGGSVRQP* |
Ga0066388_1043555642 | 3300005332 | Tropical Forest Soil | MEYDNTAIIFMVIAVVACVLALTFFGVYYLNKIVDQNAHDGGSGRQT* |
Ga0066388_1053567032 | 3300005332 | Tropical Forest Soil | MEYGNAAIIFMVIAVVACVLGLTFFGVYYLNKIVDQNAREGGPVRKT* |
Ga0008090_150779182 | 3300005363 | Tropical Rainforest Soil | MDYGNTAIIFMVIAVVACVLGLTFIGVYYLNKIVDQNAGEGGSAREP* |
Ga0070713_1005171152 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VEYDNTVIIFVVIAVVACVLGLTFFGVYYLNKIVDQNAREGGSVRQTQR* |
Ga0070713_1010842551 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MEHGNTAIAVVSCVLGLSFFGVYYLDKIVDQNAPKGGDVRKT* |
Ga0070708_1000402962 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYGNPAIIFTVIAVVACALGLTFFGVYYLNKFVDQNTREGGSVRKT* |
Ga0066687_102807322 | 3300005454 | Soil | MDYGNPAIIVMVIAVVACVLGLTFFAVYYLNKIVDQNGRDGGSARKP* |
Ga0070706_1003842343 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYGNTAIIFTVIAVVACALGLTFFGVYYLNKFVDQNTREGGSVRKT* |
Ga0070698_1008357851 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VEYDNTVIIFVVIAVVACVLGLTFFGVYYLNKIVDQNAREGGSGRQT* |
Ga0070696_1002515482 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYGNTAIIFMVIAVVACVLGLTFFAVYCLNKIVDRNAREGGSARDP* |
Ga0070693_1013645371 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYGNTAIIFMVIAVVACVLSLTFFAVYCLNKIVDRNAREGGSAREP* |
Ga0066903_1014057342 | 3300005764 | Tropical Forest Soil | MEYGNPAIISMVIAVVVCVLGLVFFGVYCLNKIVDRNAREGGSGRQM* |
Ga0066903_1020293352 | 3300005764 | Tropical Forest Soil | MEHGNTAIVFMVIAVVSCVLGLSFFGVFYLDKIVDQNAPKGGDARKT* |
Ga0066903_1023974031 | 3300005764 | Tropical Forest Soil | ILCVREGWLMEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSARKT* |
Ga0066903_1025458812 | 3300005764 | Tropical Forest Soil | MEYGNTAIIFMVIAVVACALGLTFFGVYYLNKIVDQNAHDGGSGRQT* |
Ga0066903_1035163582 | 3300005764 | Tropical Forest Soil | MEYGNPAIIFMVIAVVACVLALSFFGVYYLNKIVDRNAPEGGSVRKT* |
Ga0066903_1049724372 | 3300005764 | Tropical Forest Soil | MDYGNTVIIFMVLAVVACVLGLTFFGVYYLNKVVDRNAREGGSAREP* |
Ga0066903_1052173862 | 3300005764 | Tropical Forest Soil | MEYDNTAIIFMVIAVVACVLALTVFGVYSLNKIVDQNARGSGSIRQT* |
Ga0066903_1078735512 | 3300005764 | Tropical Forest Soil | MEYGNAAIIFMVIAVVACVLGLTFFGVYCLNKFVDQNTREGGSVQQP* |
Ga0066903_1089213122 | 3300005764 | Tropical Forest Soil | MEYGNTAIIFLVVAVVSFVLGLTFLGVYYLNKIVDQNAPEGGSARKT* |
Ga0066903_1089493221 | 3300005764 | Tropical Forest Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDQNALKGGSVRKT* |
Ga0075365_102009482 | 3300006038 | Populus Endosphere | MEYDNTAIILMVIAVVACVLGLTFFAVYYLNKIVDQNAREGGSAREP* |
Ga0075018_106654461 | 3300006172 | Watersheds | MEYGNAAIIFMVIAVVACVLGLAFFGVYCLNKFVDQNAREGGSVRQP* |
Ga0070716_1014781572 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYGNAAIIFTVIAVVACILGLVFLGVYYLNKFVDQNAREGGSVRQP* |
Ga0066659_101167502 | 3300006797 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYYLNKIVDQNAREGSSGRQT* |
Ga0079220_119813192 | 3300006806 | Agricultural Soil | MDYGNTAIICMVLAVVACVLGLTFFAVYYLNKIVDQNAREGGSARE |
Ga0075436_1007822592 | 3300006914 | Populus Rhizosphere | MEYGNTAIIFTVIAVVACVLGLTFFGVYCLNKFVDQNAREGGSVR* |
Ga0075436_1008943762 | 3300006914 | Populus Rhizosphere | VEYDNTVIIFVVIAVVACVLGLTFFGVYYLNKIVDQNARE |
Ga0079219_102973462 | 3300006954 | Agricultural Soil | MEYDNTAIILMVIAVVACVLGLTFFAVYYLNKIVDQNAHEGGSTREP* |
Ga0066710_1003467683 | 3300009012 | Grasslands Soil | MEYGNTAIIFMVIAVVACALGLTFFGVYYLNKIVDQNAREGSSGRQT |
Ga0066710_1022231192 | 3300009012 | Grasslands Soil | MDDGNPAIIVMVIAVVACVLGLTFFAVYYLNKIVDQNGRDGGSARKP |
Ga0099828_106211832 | 3300009089 | Vadose Zone Soil | MEYGNPAIIFMVIAVVACALGLTFFGVYYLNKIADQNAREGGSGRQT* |
Ga0099827_110176062 | 3300009090 | Vadose Zone Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYCLNKIVDQNTREGGSMRQP* |
Ga0111539_120619551 | 3300009094 | Populus Rhizosphere | MEYGNTAIIFMVIAVVACVLGLTFFAVYCLNKIVDRNAREGG |
Ga0099792_100802592 | 3300009143 | Vadose Zone Soil | MEYDNTAIIFMVIAVVACVLGLTFFGVYCLNKIVDRNARASRSAREP* |
Ga0114129_113002302 | 3300009147 | Populus Rhizosphere | MEYGNTAIIFMVIAVVACALGLTFFCVYYLNKIVDQNAREGGSGRQT* |
Ga0075423_106763532 | 3300009162 | Populus Rhizosphere | VEYDNTVIIFVVIAVVACVLGLTFFGVYYLNKIVDQNAREGGSVRQP* |
Ga0075423_107596683 | 3300009162 | Populus Rhizosphere | MEYGNTAIIFMVIAVVACVLGLTFFAVYCLIKIVDRNAREGGSAREP* |
Ga0114925_103547913 | 3300009488 | Deep Subsurface | MEYGNAAIIFMVIAVVACVLGLVFFGVYCLNKFVDQNAREGGSVQQP* |
Ga0126374_117009542 | 3300009792 | Tropical Forest Soil | MEYGNTAIIFMVIAVVSCVLALTFFGVYYLNKIVDQNAGESGSVRKM* |
Ga0126380_111929682 | 3300010043 | Tropical Forest Soil | MDYGNTAIIVMVLAVVACVLGLTFFAVYCLNRIVDRNAREGGSAREP* |
Ga0126384_107396041 | 3300010046 | Tropical Forest Soil | MEYGNAAIIFMVIAVVACVLSLTFFGVYCLNKFVDQNTREGGSVRQP* |
Ga0126382_105522942 | 3300010047 | Tropical Forest Soil | MEYGNSTIIFMVIAVVACALGLTFFGVYHLNKVVDQSAREGGCGRQT* |
Ga0126373_102338814 | 3300010048 | Tropical Forest Soil | MEYGNTAIIFVVVAVVSFVLGLTFLGAYYLNKIVDQNAPEGGSARKT* |
Ga0126376_108996571 | 3300010359 | Tropical Forest Soil | MEYGNPAIIFMVVAVVSCVLALSFFGVYYLNKIVDQNAPEGGSVRKT* |
Ga0126372_108971222 | 3300010360 | Tropical Forest Soil | MDYGNTAIIVMVLAVVACVLGLTFFAVYYLNKILDRNAREGGSAREP* |
Ga0126372_114868072 | 3300010360 | Tropical Forest Soil | MEYGNPAIIFMVIAVVACVLGLTFFGVYYLNKIVDRNAREGGSVRKT* |
Ga0126378_128132331 | 3300010361 | Tropical Forest Soil | MEYGNTAIVFMVVAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRKT* |
Ga0126378_129470042 | 3300010361 | Tropical Forest Soil | MDYGNTAIIFMVIAVVACVLGLTFFGVYYLNKIVDRNAREGGSAREP* |
Ga0126377_117678972 | 3300010362 | Tropical Forest Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYYLNKFVDQNAPEGGSVRQP* |
Ga0126377_119080762 | 3300010362 | Tropical Forest Soil | MEYGNTAIVFMVVAVVSCVLGLSLFGVYYLNKIVDQNAPEGGSVRKT* |
Ga0126379_138470572 | 3300010366 | Tropical Forest Soil | MEHGNTAIIFMVVAVVSCVLDLSFFGVYYLNKIVDQNAPEGGSARKT* |
Ga0134126_124632741 | 3300010396 | Terrestrial Soil | AIIFTVIAVVACVLGLVFLGVYYLNKFVDQNAREGGSVRQP* |
Ga0124850_10270153 | 3300010863 | Tropical Forest Soil | MEYGNTAIIFMVVAVVSCVLALSFFGVYYLNKIVDQNALEGGSVRKT* |
Ga0137388_100403766 | 3300012189 | Vadose Zone Soil | MEYGNTAIIFTVIAVVACALGLTFFGVYYLNKIADQNAREGGSGRQT* |
Ga0137364_103753912 | 3300012198 | Vadose Zone Soil | MDYGNPAIIVMVIAVVACVLGLTFFAVYYLNKIVDQNGRD |
Ga0137399_110449912 | 3300012203 | Vadose Zone Soil | MEYDNTAIIFMVIAVVASVLGLTFFGVYYLDKIVDRNARESRSAREP* |
Ga0137378_111331642 | 3300012210 | Vadose Zone Soil | MEYGSTAIIFMVIAVVACVLGLTFFGVYYLNKIVDQNAREGGSVRQP* |
Ga0137360_112117242 | 3300012361 | Vadose Zone Soil | MEYDNTAIIFMVIAVVACVLGLTFFGVYYLNKIVDQNARESGSVRRT* |
Ga0126375_117683742 | 3300012948 | Tropical Forest Soil | FMVVAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRQP* |
Ga0126369_106116292 | 3300012971 | Tropical Forest Soil | MQYDNTAIIFMVIAVVACVLALTFFGVYYLNKIVDHNARESGSIRQT* |
Ga0126369_132717522 | 3300012971 | Tropical Forest Soil | MEYGNTAIIFMVVAVVSCVLALSFFGVYYLNKIVDQNAPEGGSVRKT* |
Ga0164304_114871002 | 3300012986 | Soil | MEYGNTAIIFTVIAVVACVLGLVFFGVYCLNKFVDQNAREGGSVRQP* |
Ga0182041_115816172 | 3300016294 | Soil | MEYGNAAIIFMVIAVVACVLGLTFFGVYCLDKFVEQNTREGGSVRQP |
Ga0182033_105362433 | 3300016319 | Soil | MEYGNTAIIFMVVAVVSRVLGLSFFGVYYLNKIVDQNAPEGGSVRKT |
Ga0182035_115715522 | 3300016341 | Soil | MGYGNAAIIFMVIAVVACVLGLTFFGVYYLNKFVDQNTREGGSVRKT |
Ga0182032_105602042 | 3300016357 | Soil | MEYGNTAIIFMVIAVVACALGLTFFGVYYLNKIVDQNPHDGGSGRQT |
Ga0182032_112682842 | 3300016357 | Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDKNAPEGVLFGRRSDQGK |
Ga0182037_111024242 | 3300016404 | Soil | MEYGNAAIIFMVIAVVACVLGLTFFGVYCLNKFVDQNTREGGSVRQP |
Ga0179592_103260871 | 3300020199 | Vadose Zone Soil | MEYGNTAIIFTVIAVVACVLGLTFFGVYCLNKFVDQNAREGGSVRQP |
Ga0210407_104336802 | 3300020579 | Soil | MEYDNTAIIFMVIAVVACVLGLTFFGVYCLNKIVDRNVRASGSAREP |
Ga0210403_105355721 | 3300020580 | Soil | MEYGNAAIIFTVIAVVACVLGLVFFGVYCLNKFVDQNAREGGSVRQP |
Ga0210406_104168251 | 3300021168 | Soil | MEYDNTAIIFMVIAVVACVLGLTFFGVYCLNKIVDRNARASGSAR |
Ga0213872_100073074 | 3300021361 | Rhizosphere | MEYGNTAIIFMVVAVVACVLGLTFVGVYCLNKVVDQNTREGGSVRQP |
Ga0213877_101505441 | 3300021372 | Bulk Soil | MEYGNTAIIFMVVAVVACVLGLTFFGVYCLNKFVDQNTSEGGSVRQP |
Ga0213877_102622522 | 3300021372 | Bulk Soil | MEYGNTAIIFMVVAVVACVLGLTFFGVYCLNKFVDQNTREGGS |
Ga0210387_100828215 | 3300021405 | Soil | MEYDNTAIIFMVIAVVACVLGLTFFGVYCLNKIVDRNARASGSAREP |
Ga0213878_101348982 | 3300021444 | Bulk Soil | MEYGNTAIIFMVVAVVACVLGLTFFGVYCLNKFVDQNTREGGSVRQP |
Ga0210402_102875811 | 3300021478 | Soil | MEYGNAAIIFTVIAVVACVLGLVFFGVYCLNKFVDQNA |
Ga0126371_104575573 | 3300021560 | Tropical Forest Soil | MDYGNTVIIFMVLAVVACVLGLTFIGVYYLNKIVDQNAGEGGSAREP |
Ga0126371_105461692 | 3300021560 | Tropical Forest Soil | MEYGNAAIIFMVIAVVACVLGLVFFGVYCLNKFVDQNAREGGSVRQP |
Ga0126371_108096983 | 3300021560 | Tropical Forest Soil | MEYGNTAIIFMVIAVVACVLALTVFGVYSLNKIVDQNARGSGSIRQT |
Ga0126371_125913182 | 3300021560 | Tropical Forest Soil | MQYDNTAIIFMVIAVVACVLALTFFGVYYLNKIVDQNAREGGSAREP |
Ga0179589_100097747 | 3300024288 | Vadose Zone Soil | MEYDNTAIIFMVIAVVACVLGLTFFGVYCLNKIVDRNARASRSAREP |
Ga0207653_104097092 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYGNPAIIFMVIAVVACALSLTFFGVYYLNKFVDQNTREGGSGRQT |
Ga0207684_100539092 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYGNPAIIFTVIAVVACALGLTFFGVYYLNKFVDQNTREGGSVRKT |
Ga0207665_107073652 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VEYDNTVIIFVVIAVVACVLGLTFFGVYYLNKFVDQNAREGGSVRQP |
Ga0209240_11268182 | 3300026304 | Grasslands Soil | MEYGNTAIVFMVIAVVSCVLGLSFFGVYYLDKIVDQNAPEGGSVRKT |
Ga0209468_11010853 | 3300026306 | Soil | DYGNPAIIVMVIAVVACVLGLTFFAVYYLNKIVDQNGRDGGSARKP |
Ga0209239_12914952 | 3300026310 | Grasslands Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYYLNKIVDQNAREGSSGRQT |
Ga0209647_10252466 | 3300026319 | Grasslands Soil | MEYGNTAIIFMVIAVVACALGLAFFGVYCLNKFVDRNAREGGSVRQP |
Ga0209687_11109232 | 3300026322 | Soil | MDYGNPAIIVMVIAVVACVLGLTFFAVYYLNKIVDQNGRDGGSARKP |
Ga0209622_10236982 | 3300027502 | Forest Soil | MEYGNTAIIFMVIAVVACVLGLVFFGVYCLNKFVDQNAREGGSVRQP |
Ga0209523_10037662 | 3300027548 | Forest Soil | MEYGNTAIIFMVIAVVACGLGVTFFGVYYLNKIVDQNAREGGSVRQP |
Ga0209003_10088762 | 3300027576 | Forest Soil | MEYGNAAIIFTVIAVVACVLGLTFFGVYYLNKIVDQNAREGGSVRQP |
Ga0209466_10046992 | 3300027646 | Tropical Forest Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRKR |
Ga0209799_10001724 | 3300027654 | Tropical Forest Soil | MEYGNTAIVFMVVAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRKT |
Ga0209465_100745082 | 3300027874 | Tropical Forest Soil | MEYGNTAIIFMVVAVVSCVLALSFFGVYYLNKILDQNAPEGGSVRKT |
Ga0209465_101895342 | 3300027874 | Tropical Forest Soil | MEYGNAAIIFMVIAVVACVLGLTFFGVYCLNKFVDQNTRKGGSVRQP |
Ga0209590_100300181 | 3300027882 | Vadose Zone Soil | MEYGNPAIIFMVIAVVACVLGLTFFGVYCLNKIVDQNTREGGSMRQP |
Ga0209382_102153233 | 3300027909 | Populus Rhizosphere | MEYGNTAIIFMVIAVVACVLGLTFFAVYCLNKIVDWNAREGGSAREP |
Ga0307276_100793972 | 3300028705 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFAVFCLNKIVDRNAREGGSAREP |
Ga0307310_106774762 | 3300028824 | Soil | MDYGNTAIIFMVIAVVACVLGLTFFAVYCLNKIVDRNAREGGSAREP |
Ga0170820_176782372 | 3300031446 | Forest Soil | MEYGNAAIVFMVIAVVSCVLGLSFFGVYYLDKIVDQNAPEGDSVRKT |
Ga0318516_100221163 | 3300031543 | Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRKS |
Ga0318516_100887583 | 3300031543 | Soil | MEYGNTAIIFMVVAVVSCVLALSFFGVYYLNKIVDQNAPEGGSVRKT |
Ga0318534_104185662 | 3300031544 | Soil | MEYGNAAIIFMVIAVVACVLGLTFFGVYCLDKFVDQNTREGGSVRQP |
Ga0318541_101892671 | 3300031545 | Soil | IFMVVAVVSCVLGLSFFGVYYLDKIVDQNAPEGGSVRKT |
Ga0318541_104307822 | 3300031545 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYCLNKFVDQNTREGGSVRQP |
Ga0318541_105730362 | 3300031545 | Soil | IIFMVIAVVACVLGLTFFGVYYLNKFVDQNTREGGSVRKT |
Ga0318541_106499292 | 3300031545 | Soil | MEYGNTAIIFLVVAVVSFVLGLTFLGVYYLNKIVDQNAPEGGSARKT |
Ga0318573_101482322 | 3300031564 | Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIADQNAPEGGSVRKS |
Ga0318515_105705242 | 3300031572 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYYLNKFVDQNTREGGSVRKT |
Ga0310915_102759792 | 3300031573 | Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDQNSPEGGSVRKT |
Ga0318572_108879262 | 3300031681 | Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLDKIVDQNAPE |
Ga0310813_104072082 | 3300031716 | Soil | MEYDNTAIILMVIAVVACVLALTFFAVYYLNRIVDQNAREGGSAREP |
Ga0306917_113418882 | 3300031719 | Soil | MEYGNTAIIFMVIAVVACALGLTFFGVYYLNKIVDQNAREGGSGRQT |
Ga0307468_1019025442 | 3300031740 | Hardwood Forest Soil | MEYGNAAIIFMVIAVVACVLGLTLFGVYYLNKIVDQNAREGGSVRQP |
Ga0318503_102419592 | 3300031794 | Soil | MEYGNTAIILMVIAVVACVLGLTFFGVYCLNTIVDQNAREGGSG |
Ga0318503_102976431 | 3300031794 | Soil | LMEYGNTAIIFMVIAVVACVLGLTFFGVYCLNKFVDQNTREGGSVRQP |
Ga0318523_101012293 | 3300031798 | Soil | NTAIIFMVVAVVSCVLALSFFGVYYLNKIVDQNAPEGGSVRKT |
Ga0318523_105605081 | 3300031798 | Soil | MEYGNTAIIFMVVAVVSCVLALSFFGVYYLNKIVDQNAPEGGSARKT |
Ga0318497_104027272 | 3300031805 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYCLDKFVEQNTREGGSVRQP |
Ga0318527_102697661 | 3300031859 | Soil | EYGNAAIIFMVIAVVACVLGLTFFGVYCLDKFVDQNTREGGSVRQP |
Ga0306919_100118557 | 3300031879 | Soil | MEYGNTAIIFMVIAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRKS |
Ga0306919_106265182 | 3300031879 | Soil | MEYGNTAIILMVIAVVACVLGLTFFGVYCLNTIVDQNAREGGSGRQT |
Ga0306919_109021552 | 3300031879 | Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLDKIVDQNAPEGGSVRKT |
Ga0306925_107673321 | 3300031890 | Soil | MVVAVVSCVLGLSFFGVYYLDKIVDQNAPEGGSVRKT |
Ga0318520_102787473 | 3300031897 | Soil | FMVIAVVACVLGLTFFGVYYLNKFVDQNTREGGSVRKT |
Ga0306921_121812262 | 3300031912 | Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDQNAPEGVLFGRRSD |
Ga0310912_105982902 | 3300031941 | Soil | MEYGNTAIIFMVIAVVACALGLTFFGVYYLNKIVDQNAHDGGSGRQT |
Ga0310909_105537231 | 3300031947 | Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLNKIVDQNSPE |
Ga0318533_103440233 | 3300032059 | Soil | IFMVVAVVSCVLGLSFFGVYYLDKIVDQNAPEGGSVRKI |
Ga0318533_112745801 | 3300032059 | Soil | MEYGNTAIVFMVIAVVACVLGLTFFGVYCLNKVVDQNTREGGSVRQP |
Ga0318524_101900932 | 3300032067 | Soil | MEYGNTAIIFMVIAVVSCVLGLSFFGVYYLNKIVDQNAPEGGSVRKT |
Ga0306920_1009510912 | 3300032261 | Soil | MEYGNTAIIFMVVAVVSCVLALSFFGIYYLNKIVDQNAPEGGSVRKT |
Ga0306920_1014822542 | 3300032261 | Soil | MEYGNTAIIFMVIAVVACVLGLTFFGVYCLDKFVDQNTREGGSVRQP |
Ga0306920_1015523791 | 3300032261 | Soil | MEYGNTAIIFMVVAVVSCVLGLSFFGVYYLDKIVDHNAPEGGSVRKT |
Ga0306920_1032395382 | 3300032261 | Soil | MEYGNAAIISMVIAVVACVLGLVFFGVYCLNKFVDQNAREGGSVRQP |
Ga0310914_117614932 | 3300033289 | Soil | IFMVIAVVACVLGLTFFGVYYLNKFVDQNTREGGSVRKT |
⦗Top⦘ |