Metagenome / Metatranscriptome Family F035268

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F035268
Family Type	Metagenome / Metatranscriptome
Number of Sequences	172
Average Sequence Length	40 residues
Representative Sequence	LLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMA
Number of Associated Samples	149
Number of Associated Scaffolds	172

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.59 %
% of genes near scaffold ends (potentially truncated)	98.26 %
% of genes from short scaffolds (< 2000 bps)	90.70 %
Associated GOLD sequencing projects	140
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (66.860 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.372 % of family members)
Environment Ontology (ENVO)	Unclassified (26.744 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (40.698 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 172 Family Scaffolds
PF03069	FmdA_AmdA	41.86
PF00296	Bac_luciferase	5.23
PF05154	TM2	4.07
PF03795	YCII	3.49
PF04392	ABC_sub_bind	2.91
PF00903	Glyoxalase	2.91
PF07681	DoxX	2.91
PF00106	adh_short	2.33
PF01435	Peptidase_M48	2.33
PF13420	Acetyltransf_4	2.33
PF01243	Putative_PNPOx	1.74
PF03070	TENA_THI-4	1.74
PF12770	CHAT	1.16
PF13649	Methyltransf_25	1.16
PF00581	Rhodanese	1.16
PF13561	adh_short_C2	1.16
PF04542	Sigma70_r2	1.16
PF01841	Transglut_core	0.58
PF01244	Peptidase_M19	0.58
PF13340	DUF4096	0.58
PF02518	HATPase_c	0.58
PF13424	TPR_12	0.58
PF02776	TPP_enzyme_N	0.58
PF00005	ABC_tran	0.58
PF02633	Creatininase	0.58
PF02775	TPP_enzyme_C	0.58
PF00583	Acetyltransf_1	0.58
PF08281	Sigma70_r4_2	0.58
PF13474	SnoaL_3	0.58
PF00496	SBP_bac_5	0.58
PF00072	Response_reg	0.58

COG ID	Name	Functional Category	% Frequency in 172 Family Scaffolds
COG2421	Acetamidase/formamidase	Energy production and conversion [C]	41.86
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	5.23
COG2314	Uncharacterized membrane protein YozV, TM2 domain, contains pTyr	General function prediction only [R]	4.07
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	3.49
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	2.91
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.91
COG4270	Uncharacterized membrane protein	Function unknown [S]	2.91
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	1.16
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	1.16
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	1.16
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	1.16
COG1402	Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)	Coenzyme transport and metabolism [H]	0.58
COG2355	Zn-dependent dipeptidase, microsomal dipeptidase homolog	Posttranslational modification, protein turnover, chaperones [O]	0.58

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	66.86 %
Unclassified	root	N/A	33.14 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	66.86 %
Unclassified	root	N/A	33.14 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	66.86 %
Unclassified	root	N/A	33.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.14 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	16.28 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	4.65 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.16 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.16 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.58 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.14 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	16.28 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3.49 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.16 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.58 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.58 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.58 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.14 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	15.70 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2.91 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.16 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.58 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.58 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	0.58 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.58 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.58 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.14 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	9.88 %
Pseudonocardiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales	2.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.16 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.58 %
unclassified candidate division NC10	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10	0.58 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.58 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.58 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.58 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.14 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.88 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	2.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.16 %
candidate division NC10 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium	0.58 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.58 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.58 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.58 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.58 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.14 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.88 %
Saccharopolyspora	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora	2.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.16 %
candidate division NC10 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium	0.58 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.58 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.58 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.58 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.58 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.14 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.88 %
Saccharopolyspora gloriosae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora gloriosae	2.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.16 %
candidate division NC10 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium	0.58 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.58 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.58 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.58 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.58 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.58 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000890\|JGI11643J12802_11310977	All Organisms → cellular organisms → Bacteria	691	Open in IMG/M
3300000953\|JGI11615J12901_10059010	All Organisms → cellular organisms → Bacteria	1532	Open in IMG/M
3300002122\|C687J26623_10013204	All Organisms → cellular organisms → Bacteria	2104	Open in IMG/M
3300002558\|JGI25385J37094_10011637	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	3140	Open in IMG/M
3300002561\|JGI25384J37096_10013252	All Organisms → cellular organisms → Bacteria	3166	Open in IMG/M
3300002912\|JGI25386J43895_10177365	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	535	Open in IMG/M
3300003347\|JGI26128J50194_1001508	All Organisms → cellular organisms → Bacteria	1487	Open in IMG/M
3300003996\|Ga0055467_10181232	Not Available	643	Open in IMG/M
3300004052\|Ga0055490_10094314	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300004157\|Ga0062590_100261350	All Organisms → cellular organisms → Bacteria	1313	Open in IMG/M
3300004157\|Ga0062590_100276648	All Organisms → cellular organisms → Bacteria	1286	Open in IMG/M
3300004268\|Ga0066398_10074750	Not Available	740	Open in IMG/M
3300005178\|Ga0066688_10373586	Not Available	924	Open in IMG/M
3300005180\|Ga0066685_10376945	Not Available	985	Open in IMG/M
3300005183\|Ga0068993_10023329	All Organisms → cellular organisms → Bacteria	1596	Open in IMG/M
3300005290\|Ga0065712_10362854	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300005295\|Ga0065707_10221554	All Organisms → cellular organisms → Bacteria	1223	Open in IMG/M
3300005295\|Ga0065707_10675525	Not Available	651	Open in IMG/M
3300005330\|Ga0070690_100744014	Not Available	756	Open in IMG/M
3300005331\|Ga0070670_102001717	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	534	Open in IMG/M
3300005332\|Ga0066388_100464285	All Organisms → cellular organisms → Bacteria	1906	Open in IMG/M
3300005340\|Ga0070689_101168344	All Organisms → cellular organisms → Bacteria	690	Open in IMG/M
3300005446\|Ga0066686_10503248	Not Available	825	Open in IMG/M
3300005545\|Ga0070695_100249823	All Organisms → cellular organisms → Bacteria	1290	Open in IMG/M
3300005546\|Ga0070696_100548957	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300005549\|Ga0070704_101625178	Not Available	596	Open in IMG/M
3300005555\|Ga0066692_11012285	Not Available	508	Open in IMG/M
3300005577\|Ga0068857_101295828	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora gloriosae	707	Open in IMG/M
3300005586\|Ga0066691_10757706	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	573	Open in IMG/M
3300005713\|Ga0066905_100858010	Not Available	791	Open in IMG/M
3300005713\|Ga0066905_101358584	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	641	Open in IMG/M
3300005764\|Ga0066903_105960218	Not Available	639	Open in IMG/M
3300005937\|Ga0081455_10731657	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	627	Open in IMG/M
3300006032\|Ga0066696_10233169	Not Available	1185	Open in IMG/M
3300006049\|Ga0075417_10486255	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	619	Open in IMG/M
3300006755\|Ga0079222_11765829	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300006806\|Ga0079220_11856404	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	533	Open in IMG/M
3300006846\|Ga0075430_100904038	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	727	Open in IMG/M
3300006847\|Ga0075431_101155394	Not Available	738	Open in IMG/M
3300006852\|Ga0075433_10078696	All Organisms → cellular organisms → Bacteria	2905	Open in IMG/M
3300006853\|Ga0075420_101515782	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	575	Open in IMG/M
3300006871\|Ga0075434_102502144	Not Available	517	Open in IMG/M
3300006881\|Ga0068865_101218720	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300006954\|Ga0079219_11105036	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	673	Open in IMG/M
3300006969\|Ga0075419_11062960	Not Available	592	Open in IMG/M
3300007076\|Ga0075435_101587471	Not Available	574	Open in IMG/M
3300007258\|Ga0099793_10673772	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	521	Open in IMG/M
3300009012\|Ga0066710_100763371	All Organisms → cellular organisms → Bacteria	1479	Open in IMG/M
3300009012\|Ga0066710_102811902	Not Available	688	Open in IMG/M
3300009012\|Ga0066710_103620412	Not Available	582	Open in IMG/M
3300009012\|Ga0066710_104472125	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300009053\|Ga0105095_10316169	All Organisms → cellular organisms → Bacteria	859	Open in IMG/M
3300009088\|Ga0099830_10486529	All Organisms → cellular organisms → Bacteria	1005	Open in IMG/M
3300009089\|Ga0099828_10471860	All Organisms → cellular organisms → Bacteria	1132	Open in IMG/M
3300009089\|Ga0099828_11758576	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300009090\|Ga0099827_11911167	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	517	Open in IMG/M
3300009100\|Ga0075418_12638858	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	548	Open in IMG/M
3300009147\|Ga0114129_11874861	Not Available	727	Open in IMG/M
3300009162\|Ga0075423_10307449	Not Available	1662	Open in IMG/M
3300009174\|Ga0105241_11553663	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300009176\|Ga0105242_10679717	All Organisms → cellular organisms → Bacteria	1004	Open in IMG/M
3300009553\|Ga0105249_12201634	Not Available	624	Open in IMG/M
3300009837\|Ga0105058_1082766	Not Available	741	Open in IMG/M
3300010046\|Ga0126384_10038394	All Organisms → cellular organisms → Bacteria	3230	Open in IMG/M
3300010047\|Ga0126382_11180321	Not Available	684	Open in IMG/M
3300010047\|Ga0126382_12325552	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	519	Open in IMG/M
3300010304\|Ga0134088_10065201	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1686	Open in IMG/M
3300010322\|Ga0134084_10443685	Not Available	515	Open in IMG/M
3300010337\|Ga0134062_10276523	Not Available	788	Open in IMG/M
3300010360\|Ga0126372_10021971	All Organisms → cellular organisms → Bacteria	3790	Open in IMG/M
3300010360\|Ga0126372_10063689	All Organisms → cellular organisms → Bacteria	2579	Open in IMG/M
3300010360\|Ga0126372_10668682	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora gloriosae	1008	Open in IMG/M
3300010362\|Ga0126377_10587421	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium	1157	Open in IMG/M
3300010366\|Ga0126379_11905420	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300010398\|Ga0126383_10557585	All Organisms → cellular organisms → Bacteria	1212	Open in IMG/M
3300010398\|Ga0126383_11101168	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300010398\|Ga0126383_11866250	All Organisms → cellular organisms → Bacteria → Proteobacteria	689	Open in IMG/M
3300010401\|Ga0134121_10573429	All Organisms → cellular organisms → Bacteria	1051	Open in IMG/M
3300010403\|Ga0134123_11804393	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	665	Open in IMG/M
3300011271\|Ga0137393_10151616	All Organisms → cellular organisms → Bacteria	1936	Open in IMG/M
3300011429\|Ga0137455_1155694	Not Available	682	Open in IMG/M
3300011443\|Ga0137457_1129472	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300012202\|Ga0137363_10941809	Not Available	733	Open in IMG/M
3300012202\|Ga0137363_11016327	Not Available	704	Open in IMG/M
3300012203\|Ga0137399_10647929	Not Available	889	Open in IMG/M
3300012203\|Ga0137399_11589272	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	542	Open in IMG/M
3300012206\|Ga0137380_10297656	All Organisms → cellular organisms → Bacteria	1446	Open in IMG/M
3300012206\|Ga0137380_10335663	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1350	Open in IMG/M
3300012349\|Ga0137387_11014988	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	595	Open in IMG/M
3300012351\|Ga0137386_10186558	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1489	Open in IMG/M
3300012582\|Ga0137358_10861214	Not Available	597	Open in IMG/M
3300012685\|Ga0137397_10544670	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300012922\|Ga0137394_10551940	Not Available	976	Open in IMG/M
3300012925\|Ga0137419_11120119	Not Available	656	Open in IMG/M
3300012929\|Ga0137404_11539501	Not Available	616	Open in IMG/M
3300012930\|Ga0137407_11987773	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300012948\|Ga0126375_10633064	Not Available	822	Open in IMG/M
3300012957\|Ga0164303_10443687	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300012961\|Ga0164302_10774429	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300012977\|Ga0134087_10205263	Not Available	884	Open in IMG/M
3300013102\|Ga0157371_10118678	All Organisms → cellular organisms → Bacteria	1881	Open in IMG/M
3300014166\|Ga0134079_10113409	Not Available	1051	Open in IMG/M
3300014325\|Ga0163163_11364569	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora gloriosae	771	Open in IMG/M
3300014326\|Ga0157380_11017203	Not Available	863	Open in IMG/M
3300017974\|Ga0187777_11212928	Not Available	552	Open in IMG/M
3300018074\|Ga0184640_10077017	All Organisms → cellular organisms → Bacteria	1421	Open in IMG/M
3300018082\|Ga0184639_10472319	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300020060\|Ga0193717_1050833	All Organisms → cellular organisms → Bacteria	1470	Open in IMG/M
3300021560\|Ga0126371_11943985	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300022694\|Ga0222623_10396770	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	524	Open in IMG/M
3300025173\|Ga0209824_10074599	All Organisms → cellular organisms → Bacteria	1274	Open in IMG/M
3300025899\|Ga0207642_10672623	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300025916\|Ga0207663_10829243	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	737	Open in IMG/M
3300025925\|Ga0207650_10508979	All Organisms → cellular organisms → Bacteria	1007	Open in IMG/M
3300025927\|Ga0207687_11941919	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300025932\|Ga0207690_11481541	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	567	Open in IMG/M
3300025971\|Ga0210102_1057416	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300025992\|Ga0208775_1014135	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300026041\|Ga0207639_11172449	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora gloriosae	721	Open in IMG/M
3300026295\|Ga0209234_1088456	Not Available	1173	Open in IMG/M
3300026315\|Ga0209686_1015199	All Organisms → cellular organisms → Bacteria	3140	Open in IMG/M
3300026329\|Ga0209375_1243116	Not Available	611	Open in IMG/M
3300026333\|Ga0209158_1336868	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	523	Open in IMG/M
3300026335\|Ga0209804_1137925	Not Available	1099	Open in IMG/M
3300026335\|Ga0209804_1241217	Not Available	694	Open in IMG/M
3300026354\|Ga0257180_1021358	Not Available	843	Open in IMG/M
3300026507\|Ga0257165_1050752	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300026528\|Ga0209378_1192167	Not Available	695	Open in IMG/M
3300026528\|Ga0209378_1294706	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300026536\|Ga0209058_1040652	All Organisms → cellular organisms → Bacteria	2747	Open in IMG/M
3300026536\|Ga0209058_1075495	All Organisms → cellular organisms → Bacteria	1790	Open in IMG/M
3300026540\|Ga0209376_1223442	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300027364\|Ga0209967_1012290	Not Available	1208	Open in IMG/M
3300027552\|Ga0209982_1014140	All Organisms → cellular organisms → Bacteria	1205	Open in IMG/M
3300027678\|Ga0209011_1032492	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1651	Open in IMG/M
3300027765\|Ga0209073_10454488	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	533	Open in IMG/M
3300027787\|Ga0209074_10372733	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300027873\|Ga0209814_10315104	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	682	Open in IMG/M
3300027875\|Ga0209283_10217228	All Organisms → cellular organisms → Bacteria	1270	Open in IMG/M
3300027882\|Ga0209590_10274910	Not Available	1078	Open in IMG/M
3300027907\|Ga0207428_10884453	Not Available	632	Open in IMG/M
3300027909\|Ga0209382_11175950	Not Available	786	Open in IMG/M
3300027910\|Ga0209583_10718127	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300027947\|Ga0209868_1006339	Not Available	1113	Open in IMG/M
3300028536\|Ga0137415_10563640	Not Available	949	Open in IMG/M
3300028587\|Ga0247828_10769842	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300028589\|Ga0247818_10395340	All Organisms → cellular organisms → Bacteria	931	Open in IMG/M
3300028596\|Ga0247821_10527376	All Organisms → cellular organisms → Bacteria	754	Open in IMG/M
3300028809\|Ga0247824_10520458	Not Available	704	Open in IMG/M
3300028814\|Ga0307302_10149751	All Organisms → cellular organisms → Bacteria	1130	Open in IMG/M
3300028878\|Ga0307278_10210670	Not Available	866	Open in IMG/M
3300031538\|Ga0310888_10660014	Not Available	639	Open in IMG/M
3300031548\|Ga0307408_100264680	All Organisms → cellular organisms → Bacteria	1425	Open in IMG/M
3300031679\|Ga0318561_10271342	All Organisms → cellular organisms → Bacteria	926	Open in IMG/M
3300031713\|Ga0318496_10055523	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2059	Open in IMG/M
3300031720\|Ga0307469_10100851	All Organisms → cellular organisms → Bacteria	2027	Open in IMG/M
3300031720\|Ga0307469_10441265	Not Available	1124	Open in IMG/M
3300031720\|Ga0307469_10896353	All Organisms → cellular organisms → Bacteria	821	Open in IMG/M
3300031764\|Ga0318535_10072413	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1476	Open in IMG/M
3300031765\|Ga0318554_10062064	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2062	Open in IMG/M
3300031793\|Ga0318548_10068608	All Organisms → cellular organisms → Bacteria	1655	Open in IMG/M
3300031893\|Ga0318536_10151715	All Organisms → cellular organisms → Bacteria → Acidobacteria	1177	Open in IMG/M
3300031908\|Ga0310900_10791532	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300031947\|Ga0310909_10134427	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2020	Open in IMG/M
3300032180\|Ga0307471_100600882	All Organisms → cellular organisms → Bacteria	1259	Open in IMG/M
3300032180\|Ga0307471_102171427	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	699	Open in IMG/M
3300032180\|Ga0307471_103584452	Not Available	549	Open in IMG/M
3300032770\|Ga0335085_10258201	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2090	Open in IMG/M
3300034660\|Ga0314781_149323	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	505	Open in IMG/M
3300034773\|Ga0364936_134343	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	80.23%
Host-Associated	Host-Associated	19.77%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	72.09%
Plants	Host-Associated → Plants	19.77%
Aquatic	Environmental → Aquatic	8.14%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	71.51%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.95%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.23%
Sediment	Environmental → Aquatic → Sediment	3.49%
Marine	Environmental → Aquatic → Marine	2.91%
Freshwater	Environmental → Aquatic → Freshwater	1.16%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.58%
Floodplain	Environmental → Terrestrial → Floodplain	0.58%
Roots	Host-Associated → Plants → Roots	0.58%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	60.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.21%
Loam	Environmental → Terrestrial → Soil → Loam	8.14%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.49%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.91%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.74%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.74%
Sand	Environmental → Terrestrial → Soil → Sand	1.16%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.58%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.58%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.58%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.58%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.58%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.58%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.07%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	14.53%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.21%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.72%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.65%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.07%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.07%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.49%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.49%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.49%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.91%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.74%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.16%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.58%
Unchlorinated	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated	0.58%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.58%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.58%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.58%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.58%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.58%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.58%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	9.88%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.14%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.23%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.07%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.49%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.33%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.91%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.91%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.91%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.74%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.16%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.16%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.16%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.16%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.16%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.16%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.16%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.16%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.16%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.16%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.16%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.58%
Wastewater	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater	0.58%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	0.58%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.58%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.58%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.58%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.58%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.58%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.58%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.58%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.58%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.58%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.58%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.58%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.58%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.58%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.58%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.58%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300002122	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2	Environmental	Open in IMG/M
3300002558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm	Environmental	Open in IMG/M
3300002561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm	Environmental	Open in IMG/M
3300002912	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm	Environmental	Open in IMG/M
3300003347	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM	Host-Associated	Open in IMG/M
3300003996	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2	Environmental	Open in IMG/M
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005183	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009444	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300011429	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2	Environmental	Open in IMG/M
3300011443	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2	Environmental	Open in IMG/M
3300020060	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300025173	Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025971	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025992	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes)	Environmental	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026315	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)	Environmental	Open in IMG/M
3300026329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)	Environmental	Open in IMG/M
3300026333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)	Environmental	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026354	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B	Environmental	Open in IMG/M
3300026507	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300026540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)	Environmental	Open in IMG/M
3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)	Host-Associated	Open in IMG/M
3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027678	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300027947	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300028596	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14	Environmental	Open in IMG/M
3300028809	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031764	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300034660	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034773	Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI11643J12802_113109773	3300000890	Soil	AWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSEIA*
JGI11615J12901_100590101	3300000953	Soil	GGTAELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPHAAD*
C687J26623_100132041	3300002122	Soil	AWILALAFTSGPADVLAYMPAVAWRSGTGMVVWPDVKN*
JGI25385J37094_100116375	3300002558	Grasslands Soil	LLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNELAA*
JGI25384J37096_100132521	3300002561	Grasslands Soil	LLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWTELAA*
JGI25386J43895_101773652	3300002912	Grasslands Soil	ELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMA*
JGI26128J50194_10015084	3300003347	Arabidopsis Thaliana Rhizosphere	AELLAWVLALAFTRGPAEVLAYMPAVAWRSGTGMVVWPGLQS*
Ga0055467_101812322	3300003996	Natural And Restored Wetlands	TAELLAWILVLAMTRGPADVLAYMPAIAWRSGTGMVVWNELGGADAP*
Ga0055490_100943141	3300004052	Natural And Restored Wetlands	ELLAWILALAFTSGPAEVLAYMPAIAWRSGTGMVVWPGVQN*
Ga0062590_1002613501	3300004157	Soil	AELLAWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSEIA*
Ga0062590_1002766483	3300004157	Soil	TAELLAWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSDLA*
Ga0066398_100747502	3300004268	Tropical Forest Soil	GGTAELLAWVLVLAFTRGAADVLAYMPAVAWRSGTGMVVWNEMAR*
Ga0066688_103735862	3300005178	Soil	ELLSWFLVLAMTRGPADVLAYMPAIAWRSGTGMIAWNEIAED*
Ga0066685_103769452	3300005180	Soil	LSWFLVLAMTHGPADVLAYMPAVAWRSGTGMVAWNELADGAAARRS*
Ga0068993_100233293	3300005183	Natural And Restored Wetlands	ELLAWVLALAFTTGPAEVLAYMPALAWRSGTGMVVWNGLAS*
Ga0068993_100873031	3300005183	Natural And Restored Wetlands	AELLAWIAALPFTAGPAEVLGYAPSVAWRTGTGMVAWPRLA*
Ga0065712_103628541	3300005290	Miscanthus Rhizosphere	LAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPQVAN*
Ga0065707_102215544	3300005295	Switchgrass Rhizosphere	TAELLAWILALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN*
Ga0065707_106755252	3300005295	Switchgrass Rhizosphere	LLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAQ*
Ga0070690_1007440141	3300005330	Switchgrass Rhizosphere	GGTAELLAWVLVLAFTRGPADVLAYMPAIAWRSGTGMVVWNEMA*
Ga0070670_1020017171	3300005331	Switchgrass Rhizosphere	AELLAWIMALAFTRGPAEVLAYMPAVAWRSGTGMVVWGKFA*
Ga0066388_1004642853	3300005332	Tropical Forest Soil	LLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVVWDGFAGSAAALV*
Ga0070689_1011683442	3300005340	Switchgrass Rhizosphere	ELIAWVLAMAFTKGSAEVLAYMPALAWRSGTGMVVWPHLA*
Ga0066686_105032481	3300005446	Soil	GTAELLAWVLVLALTRGPADVLAYMPAVAWRSGTGMVVWNEMA*
Ga0070695_1002498233	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	LAWILVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELAS*
Ga0070696_1005489573	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	GTAELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVRN*
Ga0070704_1016251781	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	GTAELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVTWNDMA*
Ga0066692_110122851	3300005555	Soil	AELLAWVLVLARTRGPADVLAYMPAVAWRSGTGMVVWNEMA*
Ga0068857_1012958282	3300005577	Corn Rhizosphere	LAWILVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELVS*
Ga0066691_107577062	3300005586	Soil	TAELLAWIVALACTRGPADVLAYMPAIAWRSGTGMVVWNELA*
Ga0066905_1008580101	3300005713	Tropical Forest Soil	GTAELNAWITTLAFTRGPADVLAYMPAIAWRSGTGMVVWNELR*
Ga0066905_1013585842	3300005713	Tropical Forest Soil	LVLAFTRGPADVLAYMPAVAWRSGTGMVAWNELTA*
Ga0066903_1059602182	3300005764	Tropical Forest Soil	TAELLAWVLVLAFTTGPAEVLAYMPAIAWRSGTGMVVWNGLGS*
Ga0081455_107316572	3300005937	Tabebuia Heterophylla Rhizosphere	IAWVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA*
Ga0066696_102331691	3300006032	Soil	LAWIVALACTRGPADVLAYMPAIAWRSGTGMVVWNELA*
Ga0075417_104862552	3300006049	Populus Rhizosphere	LAWIAVLPFTTGPADVLAYMPALAWRSGTGMVVWNELAA*
Ga0079222_117658291	3300006755	Agricultural Soil	TAELLAWMVALAFTSGPAEVLAYMPAIAWRSGTGMVVWPDVKN*
Ga0079220_118564041	3300006806	Agricultural Soil	AELLAWVLVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR*
Ga0075430_1009040381	3300006846	Populus Rhizosphere	ELLAWIMALAFTRGPAEVLAYMPAVAWRSGTGMVVWGEFA*
Ga0075431_1011553941	3300006847	Populus Rhizosphere	GTAELLAWVLVLAFTAGPADVLAYMPAVAWRSGTGMVVWNELAP*
Ga0075433_100786961	3300006852	Populus Rhizosphere	VLAFTSGPADVLAYMPAIAWRTGTGMVVWNEVAR*
Ga0075420_1015157821	3300006853	Populus Rhizosphere	WVLVLAFTAGPADVLAYMPAVAWRSGTGMVVWNEFSA*
Ga0075434_1025021441	3300006871	Populus Rhizosphere	TAELLAWIAVLPFTTGPADVVGYAPTLAWRTGTGMVAWPCSS*
Ga0068865_1012187201	3300006881	Miscanthus Rhizosphere	LAMAFTKGSAEVLAYMPALAWRSGTGMVVWPHLA*
Ga0079219_111050362	3300006954	Agricultural Soil	CVAVLPFPTGPADVLTYMPAIAWRSGTGMVVWDGIAG*
Ga0075419_110629602	3300006969	Populus Rhizosphere	GTAELLAWIVALAFTRGSADVLAYMPAVAWRSGTGMVAWNELAA*
Ga0075435_1015874711	3300007076	Populus Rhizosphere	TAELLAWVLVMAFTNGPADVLAYMPAVAWRSGTGMVVWNEFSA*
Ga0099793_106737722	3300007258	Vadose Zone Soil	AELLSWFLVLAMTRGPADVLAYMPAIAWRSGTGMVAWNEIAQDPALAMD*
Ga0066710_1007633711	3300009012	Grasslands Soil	LLSWFLVLAMTHGPADVLAYMPAVAWRSGTGMVAWNELADAAAARRS
Ga0066710_1028119022	3300009012	Grasslands Soil	WFLVLAMTRGPADVLAYMPAVAWRSGTGMVAWSELAGD
Ga0066710_1036204122	3300009012	Grasslands Soil	VLAFTAGPADVLAYMPAIAWRTGTGMVVWNELAAATAE
Ga0066710_1044721252	3300009012	Grasslands Soil	LTMAFTRGPADVLAYMPAIEWRTGTGMVVWNEMAS
Ga0105095_103161692	3300009053	Freshwater Sediment	AELLAWILVLAFTRGPADILAYMPAIAWRSGTGMVAWSELA*
Ga0099830_104865291	3300009088	Vadose Zone Soil	LVLAFTAGPAEVLAYMPAIAWRSGTGMVVWDGLSR*
Ga0099828_104718601	3300009089	Vadose Zone Soil	TAELLAWILVLAFTAGPAEVLAYMPAIAWRSGTGMVVWNGLSR*
Ga0099828_117585762	3300009089	Vadose Zone Soil	ELLAWFMALAFTSGPAEVLVYMPAIAWRSGTGMVIWNEMA*
Ga0099827_119111671	3300009090	Vadose Zone Soil	PADVLAYMPAIAWRSGTGMVAWNEIAQDPALAMD*
Ga0075418_126388582	3300009100	Populus Rhizosphere	LVLAFTAGPADVLAYMPAVAWRSGTGMVVWNEFSV*
Ga0114129_118748612	3300009147	Populus Rhizosphere	LLSWFLVLAFTAGAADVLAYMPAVAWRSGTGMVTWNEMA*
Ga0075423_103074494	3300009162	Populus Rhizosphere	LAWIVTLAFTRGPADVLAYMPAIAWRSGTGMVVWNEVT*
Ga0105241_115536632	3300009174	Corn Rhizosphere	VLALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN*
Ga0105242_106797173	3300009176	Miscanthus Rhizosphere	WMVALAFTTGPAEVLAYMPAIVWRSGTGMVVWPDVRN*
Ga0114945_103956761	3300009444	Thermal Springs	TAELLAWIAVLPFTAGPAELLAYTASTAWRTGVGMAAWPVSS*
Ga0105249_122016342	3300009553	Switchgrass Rhizosphere	GGTAELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVTWNEMA*
Ga0105058_10827662	3300009837	Groundwater Sand	WVLVLAFTRGPADVLTYMPAVAWRSGTGMVVWNELAR*
Ga0126384_100383941	3300010046	Tropical Forest Soil	AELLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNGLAA*
Ga0126382_111803212	3300010047	Tropical Forest Soil	LVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAG*
Ga0126382_123255521	3300010047	Tropical Forest Soil	LVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR*
Ga0134088_100652013	3300010304	Grasslands Soil	LLAWVLVLAFTQGPADVLAYMPAVAWRSGTGMVVWNEMAK*
Ga0134084_104436852	3300010322	Grasslands Soil	AWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNELAA*
Ga0134062_102765232	3300010337	Grasslands Soil	ELLSWFLVLAMTRGPADVLAYMPAVAWRSGTGMVAWGELAGD*
Ga0126372_100219717	3300010360	Tropical Forest Soil	GGTAELLAWIVALAFTRGSADVLAYMPAVAWRSGTGMVAWNDLAA*
Ga0126372_100636895	3300010360	Tropical Forest Soil	VLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA*
Ga0126372_106686821	3300010360	Tropical Forest Soil	LVMAFTRGPAEVLAYMPAIAWRTGTGMVIWNELAS*
Ga0126377_105874211	3300010362	Tropical Forest Soil	GTAELLAWIAALPFTAGPAEVLGYAPSLAWRTGTGMVVWPRLV*
Ga0126379_119054202	3300010366	Tropical Forest Soil	EVAATLAFTEGPADVLAYMPAIDWRTGTGMVIWNQLAGR*
Ga0126383_105575853	3300010398	Tropical Forest Soil	IAWVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPDLA*
Ga0126383_111011681	3300010398	Tropical Forest Soil	TLVLAFTKGPAEVLAYMPALAWRSGTGMVVWPQLA*
Ga0126383_118662503	3300010398	Tropical Forest Soil	WVLALAFTAGPAEVLAYVPALAWRTGTGMVVWNQLT*
Ga0134121_105734291	3300010401	Terrestrial Soil	LLAWILVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELAS*
Ga0134123_118043931	3300010403	Terrestrial Soil	AELLAWIMALAFTRGPAEVLAYMPAVAWRSGTGMVVWGEFA*
Ga0137393_101516165	3300011271	Vadose Zone Soil	WMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVRN*
Ga0137455_11556941	3300011429	Soil	AWILVLAFTRGPADILAYMPAIAWRSGTGMVAWNALS*
Ga0137457_11294722	3300011443	Soil	LLAWILVLAFTRGPADILAYMPAIAWRSGTGMVAWNALS*
Ga0137363_109418092	3300012202	Vadose Zone Soil	LAWVLVLAFTRGPADVLTYMPAVAWRSGTGMVVWNELAQ*
Ga0137363_110163272	3300012202	Vadose Zone Soil	LAMTRGPADVLAYMPAVAWRSGTGMVAWGELAGD*
Ga0137399_106479291	3300012203	Vadose Zone Soil	LAWIVALAFTRGPADVLAYMPAIAWRSGTGMVAWNELAA*
Ga0137399_115892722	3300012203	Vadose Zone Soil	VALAFTTGPAEVLAYMPAVAWRSGTGMVVWNTLAA*
Ga0137380_102976561	3300012206	Vadose Zone Soil	ELLSWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPTLA*
Ga0137380_103356631	3300012206	Vadose Zone Soil	GPADVLAYMPAVAWRTGTGMVVWNEFAEPSATRT*
Ga0137387_110149882	3300012349	Vadose Zone Soil	ELLAWVLVLAFTRGPVDVLTYMPAVAWRSGTGMVIWNELAR*
Ga0137386_101865583	3300012351	Vadose Zone Soil	ALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA*
Ga0137358_108612141	3300012582	Vadose Zone Soil	ELLSWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPGLI*
Ga0137397_105446703	3300012685	Vadose Zone Soil	AWILALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN*
Ga0137394_105519402	3300012922	Vadose Zone Soil	ELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAP*
Ga0137419_111201192	3300012925	Vadose Zone Soil	SWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPGLI*
Ga0137404_115395011	3300012929	Vadose Zone Soil	TAELLAWVLVLAFTQGPADILAYMPALAWRSGTGMVVWNDMAK*
Ga0137407_119877733	3300012930	Vadose Zone Soil	IVALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA*
Ga0126375_106330642	3300012948	Tropical Forest Soil	WVLVLAFTRGPADVLAYMPAVAWRSGTGMVTWNEMA*
Ga0164303_104436871	3300012957	Soil	ELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGLVVWPAVAH*
Ga0164302_107744291	3300012961	Soil	WMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVAN*
Ga0134087_102052632	3300012977	Grasslands Soil	WFLVLAMTRGPADVLAYMPAVAWRSGTGMVAWSALAGD*
Ga0157371_101186781	3300013102	Corn Rhizosphere	GGTAELLAWVLALAFTRGPAEVLAYMPAVAWRSGTGMVVWPGLQS*
Ga0134079_101134091	3300014166	Grasslands Soil	GGTAELLSWFLVLAMTRGPADVLAYMPAIAWRSGTGMIAWNEIAED*
Ga0163163_113645691	3300014325	Switchgrass Rhizosphere	LLAWILVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELVS*
Ga0157380_110172031	3300014326	Switchgrass Rhizosphere	SELLAWILVLAFTRGPADILAYMPAIAWRSGTGMVAWNALA*
Ga0187777_112129281	3300017974	Tropical Peatland	AWVLVMAFTRGPADVLAYMPAVAWRSGTGMVVWDEMAS
Ga0184640_100770173	3300018074	Groundwater Sediment	AWVAVLPFTAGPADVLAYMPAIAWRSGTGMVVWNELAS
Ga0184639_104723192	3300018082	Groundwater Sediment	WILTLAFTTGPAEVLAYMPAIAWRSGTGMVVWSGVKN
Ga0193717_10508331	3300020060	Soil	ARNPYVMAFTRGPAEVLAYMPAIAWRSGTGMVIWNELAS
Ga0126371_119439851	3300021560	Tropical Forest Soil	AWVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA
Ga0222623_103967702	3300022694	Groundwater Sediment	LVLPFTHGPADVLTYMPAVAWRSGTGMVVWNELAR
Ga0209824_100745991	3300025173	Wastewater	AWILVLAFTTGPADVLAYMPAIAWRSGTGMVVWNHFA
Ga0207642_106726232	3300025899	Miscanthus Rhizosphere	ELLAWVLVMAFTRGPAEALAYMPAIAWRSGTGMVIWNELAS
Ga0207663_108292431	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	GGTAELLAWVVALAFTSGPAEVLAYMPAIAWRTGTGMVVWPDVKN
Ga0207650_105089791	3300025925	Switchgrass Rhizosphere	ELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPQVAN
Ga0207687_119419192	3300025927	Miscanthus Rhizosphere	LAWIMALAFTRGPAEVLAYMPAVAWRSGTGMVVWGEFA
Ga0207690_114815411	3300025932	Corn Rhizosphere	AWILVLAFTTGPAEVLAYMPAIAWRSGTGMVAWSQFAA
Ga0210102_10574161	3300025971	Natural And Restored Wetlands	ELLAWILALAFTSGPAEVLAYMPAIAWRSGTGMVVWPGVQN
Ga0208775_10141352	3300025992	Rice Paddy Soil	WMVAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVKN
Ga0207639_111724491	3300026041	Corn Rhizosphere	LVMAFTRGPAEVLAYMPAIAWRSGTGMAIWNELAS
Ga0209234_10884561	3300026295	Grasslands Soil	TAELLSWFLVLAMTRGPADVLAYMPAIAWRSGTGMIAWNEIAED
Ga0209686_10151995	3300026315	Soil	LLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMA
Ga0209375_12431162	3300026329	Soil	ELLAWIVALAFTRGPADVLAYMPAIAWRSGTGMVAWTELAA
Ga0209158_13368682	3300026333	Soil	TAELLAWIVALACTRGPADVLAYMPAIAWRSGTGMVVWNELA
Ga0209804_11379251	3300026335	Soil	GGTAELLAWIVALACTRGPADVLAYMPAIAWRSGTGMVVWNELA
Ga0209804_12412172	3300026335	Soil	VLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNGLAR
Ga0257180_10213582	3300026354	Soil	WVLVLAFTRGPADVLTYMPAVAWRSGTGMVVWNELAR
Ga0257165_10507521	3300026507	Soil	GGTAELLAWILALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN
Ga0209378_11921672	3300026528	Soil	ELLAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNELAA
Ga0209378_12947062	3300026528	Soil	IVALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA
Ga0209058_10406525	3300026536	Soil	LAWIVALAFTRGPADVLAYMPAVAWRSGTGMVAWNELAA
Ga0209058_10754951	3300026536	Soil	ELLAWIVALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA
Ga0209376_12234421	3300026540	Soil	LLAWIVALAFTTGPAEVLAYMPAIAWRSGTGMVVWNTFAA
Ga0209967_10122901	3300027364	Arabidopsis Thaliana Rhizosphere	GGTAELLAWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSEIA
Ga0209982_10141402	3300027552	Arabidopsis Thaliana Rhizosphere	GTAELLAWIAVLAMTRGPADVLAYMPAIAWRSGTGMVVWSEIA
Ga0209011_10324921	3300027678	Forest Soil	TAELLAWIVALAFTRGPADVLAYMPAIAWRSGTGMVAWNELAA
Ga0209073_104544881	3300027765	Agricultural Soil	AELLAWVLVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR
Ga0209074_103727331	3300027787	Agricultural Soil	TAELLAWMVALAFTSGPAEVLAYMPAIAWRSGTGMVVWPDVKN
Ga0209814_103151042	3300027873	Populus Rhizosphere	LLAWIAVLPFTTGPADVLAYMPALAWRSGTGMVVWNELAA
Ga0209283_102172283	3300027875	Vadose Zone Soil	AMTRGPADVLAYMPAIAWRSGTGMVAWNEIAQDPALAMH
Ga0209590_102749102	3300027882	Vadose Zone Soil	LLSWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPSLI
Ga0207428_108844531	3300027907	Populus Rhizosphere	LLAWIAVLPFTTGPADVVGYAPTLAWRTGTGMVAWPCSS
Ga0209382_111759501	3300027909	Populus Rhizosphere	AWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR
Ga0209583_107181272	3300027910	Watersheds	GGTAELLAWIMALAFTSGPAEVLAYMPAVAWRSGTGMVVWPEVRT
Ga0209868_10063392	3300027947	Groundwater Sand	TAELLAWVLVLAFTRGPADVLTYMPAVAWRSGTGMVVWNELAR
Ga0137415_105636402	3300028536	Vadose Zone Soil	LLAWIVALAFTRGPADVLAYMPALAWRSGTGMVVWNEMT
Ga0247828_107698422	3300028587	Soil	RHVREHLGGTAELLAWMVALAFTTGPAEVLAYMPAIAWRSGTGMVVWPDVAN
Ga0247818_103953403	3300028589	Soil	LLAWVAVLPFTAGPADVLAYMPAVAWRSGTGMVVWTEMA
Ga0247821_105273761	3300028596	Soil	VGIGGTAELLAWVAVLPFTAGPADVLAYMPAVAWRSGTGMVVWTEMA
Ga0247824_105204581	3300028809	Soil	VLVLAMTRGPADVLAYMPAIAWRSGTGMVVWNEVA
Ga0307302_101497512	3300028814	Soil	ILALAFTTGPAEVLAYMPAFAWRSGTGMVVWNNLAA
Ga0307278_102106702	3300028878	Soil	ELLAWVLVLPFTHGPADVLTYMPAVAWRSGTGMVVWNELAR
Ga0310888_106600142	3300031538	Soil	AELLAWVLVLACTRGPADVLAYMPAVAWRSGTGMVVWNEMA
Ga0307408_1002646803	3300031548	Rhizosphere	LAWIVVLAFTRGPADVLAYMPAIAWRSGTGMVVWNEVT
Ga0318561_102713421	3300031679	Soil	VLVMAFTKGPADVLAYMPAVAWRSGTGMVVWNEFAA
Ga0318496_100555234	3300031713	Soil	TAELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR
Ga0307469_101008511	3300031720	Hardwood Forest Soil	GGTAELNAWVLVMAFTRGPADVLAYMPAVAWRSGTGMVAWNELA
Ga0307469_104412651	3300031720	Hardwood Forest Soil	GTAELLAWILVLAFTAGPADVLAYMPAVAWRTGTGMVSWNEFA
Ga0307469_108963531	3300031720	Hardwood Forest Soil	LLSWILAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPSLIP
Ga0318535_100724131	3300031764	Soil	ELLAWVLVMAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAS
Ga0318554_100620641	3300031765	Soil	GGTAELLAWVLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNAMAR
Ga0318548_100686081	3300031793	Soil	ELIAWVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA
Ga0318536_101517153	3300031893	Soil	WVLAMAFTKGPAEVLAYMPALAWRSGTGMVVWPELA
Ga0310900_107915322	3300031908	Soil	ELLAWVLALAFTRGPADVLAYMPAVAWRSGTGMVVWPGLQS
Ga0310909_101344271	3300031947	Soil	VLVLAFTRGPADVLAYMPAVAWRSGTGMVVWNEMAR
Ga0307471_1006008821	3300032180	Hardwood Forest Soil	ELLSLIIAMAFTTGPAEVLAYMPAIAWRSGTGMVVWPTLA
Ga0307471_1021714271	3300032180	Hardwood Forest Soil	TAELLAWILVLAFTVGPADVLAYMPAIDWRSGTGMVAWNGLAG
Ga0307471_1035844522	3300032180	Hardwood Forest Soil	LAWILVLAFTAGPAEVLAYMPAIAWRSGTGMVAWNHFAS
Ga0335085_102582011	3300032770	Soil	GTAELLAWILVLAFTEGPADVLAYMPAIDWRTGTGMVIWNQLAGR
Ga0314781_149323_378_503	3300034660	Soil	ELLAWIAVLPFTTGPADVLAYMPAIAWRSGTGMVVWNELAA
Ga0364936_134343_388_504	3300034773	Sediment	AWILALAFTSGPAEVLAYMPAVAWRSGTGMVVWPDVKN

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F035268

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences