NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035084

Metagenome / Metatranscriptome Family F035084

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035084
Family Type Metagenome / Metatranscriptome
Number of Sequences 173
Average Sequence Length 60 residues
Representative Sequence MSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQNEEVVFSPLALIQLLNG
Number of Associated Samples 138
Number of Associated Scaffolds 173

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 12.14 %
% of genes near scaffold ends (potentially truncated) 35.26 %
% of genes from short scaffolds (< 2000 bps) 84.39 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (71.098 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(30.636 % of family members)
Environment Ontology (ENVO) Unclassified
(76.301 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.798 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.56%    β-sheet: 0.00%    Coil/Unstructured: 54.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 173 Family Scaffolds
PF04545Sigma70_r4 36.42
PF04542Sigma70_r2 33.53
PF00140Sigma70_r1_2 8.67
PF10269Tmemb_185A 1.16
PF14902DUF4494 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 173 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 42.20
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 33.53
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 33.53
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 33.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.57 %
UnclassifiedrootN/A25.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10026897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3231Open in IMG/M
3300000117|DelMOWin2010_c10121753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage910Open in IMG/M
3300000947|BBAY92_10057338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1055Open in IMG/M
3300001450|JGI24006J15134_10032162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2290Open in IMG/M
3300001589|JGI24005J15628_10058416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1451Open in IMG/M
3300001589|JGI24005J15628_10073231All Organisms → Viruses → Predicted Viral1230Open in IMG/M
3300001720|JGI24513J20088_1013062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage989Open in IMG/M
3300004097|Ga0055584_100203008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2013Open in IMG/M
3300004448|Ga0065861_1034522All Organisms → cellular organisms → Bacteria2244Open in IMG/M
3300006025|Ga0075474_10016606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2720Open in IMG/M
3300006027|Ga0075462_10155819Not Available697Open in IMG/M
3300006029|Ga0075466_1188357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300006164|Ga0075441_10026167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2388Open in IMG/M
3300006735|Ga0098038_1049892All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1512Open in IMG/M
3300006735|Ga0098038_1067419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1270Open in IMG/M
3300006737|Ga0098037_1082637Not Available1126Open in IMG/M
3300006737|Ga0098037_1182673All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300006737|Ga0098037_1205641All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300006749|Ga0098042_1020717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1937Open in IMG/M
3300006749|Ga0098042_1148825All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300006752|Ga0098048_1058305Not Available1202Open in IMG/M
3300006789|Ga0098054_1018415All Organisms → cellular organisms → Bacteria2796Open in IMG/M
3300006793|Ga0098055_1141157Not Available929Open in IMG/M
3300006802|Ga0070749_10065646Not Available2184Open in IMG/M
3300006803|Ga0075467_10731600All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300006867|Ga0075476_10157282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage846Open in IMG/M
3300006868|Ga0075481_10066018All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1370Open in IMG/M
3300006920|Ga0070748_1146001Not Available882Open in IMG/M
3300006921|Ga0098060_1014672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2506Open in IMG/M
3300007276|Ga0070747_1046931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1662Open in IMG/M
3300007345|Ga0070752_1372549Not Available532Open in IMG/M
3300007539|Ga0099849_1251135Not Available650Open in IMG/M
3300007555|Ga0102817_1076439All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300007647|Ga0102855_1102116Not Available769Open in IMG/M
3300007655|Ga0102825_1051509All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300008996|Ga0102831_1159400All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon748Open in IMG/M
3300008999|Ga0102816_1026718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1677Open in IMG/M
3300008999|Ga0102816_1032006All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1538Open in IMG/M
3300009024|Ga0102811_1147702Not Available879Open in IMG/M
3300009026|Ga0102829_1067795All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1087Open in IMG/M
3300009086|Ga0102812_10049993All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2331Open in IMG/M
3300009086|Ga0102812_10609949Not Available599Open in IMG/M
3300009149|Ga0114918_10139820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1456Open in IMG/M
3300009426|Ga0115547_1016168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3058Open in IMG/M
3300009433|Ga0115545_1002596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8891Open in IMG/M
3300009436|Ga0115008_10470472Not Available896Open in IMG/M
3300009472|Ga0115554_1240593Not Available726Open in IMG/M
3300009785|Ga0115001_10732286Not Available598Open in IMG/M
3300010148|Ga0098043_1042323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1411Open in IMG/M
3300010148|Ga0098043_1132997Not Available711Open in IMG/M
3300010148|Ga0098043_1148493Not Available664Open in IMG/M
3300010936|Ga0137784_1078500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage672Open in IMG/M
3300012920|Ga0160423_10239727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1257Open in IMG/M
3300012936|Ga0163109_10114412Not Available1978Open in IMG/M
3300012936|Ga0163109_10433418All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage963Open in IMG/M
3300012953|Ga0163179_10871803Not Available777Open in IMG/M
3300012954|Ga0163111_10994811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage809Open in IMG/M
3300013010|Ga0129327_10028749Not Available2871Open in IMG/M
3300017697|Ga0180120_10387326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300017706|Ga0181377_1002500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5553Open in IMG/M
3300017708|Ga0181369_1103951Not Available589Open in IMG/M
3300017709|Ga0181387_1013015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1606Open in IMG/M
3300017713|Ga0181391_1046647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1029Open in IMG/M
3300017713|Ga0181391_1093908All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300017713|Ga0181391_1096417Not Available669Open in IMG/M
3300017717|Ga0181404_1073482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage848Open in IMG/M
3300017720|Ga0181383_1013708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2172Open in IMG/M
3300017720|Ga0181383_1018677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1861Open in IMG/M
3300017720|Ga0181383_1122522All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300017724|Ga0181388_1005103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3569Open in IMG/M
3300017725|Ga0181398_1058996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage924Open in IMG/M
3300017727|Ga0181401_1167389Not Available529Open in IMG/M
3300017730|Ga0181417_1069246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage857Open in IMG/M
3300017730|Ga0181417_1071516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage843Open in IMG/M
3300017731|Ga0181416_1030596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1264Open in IMG/M
3300017732|Ga0181415_1041570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1052Open in IMG/M
3300017733|Ga0181426_1047770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage845Open in IMG/M
3300017733|Ga0181426_1099563Not Available583Open in IMG/M
3300017737|Ga0187218_1042967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1138Open in IMG/M
3300017738|Ga0181428_1026288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1348Open in IMG/M
3300017738|Ga0181428_1069927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300017739|Ga0181433_1008913All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2801Open in IMG/M
3300017739|Ga0181433_1016453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1993Open in IMG/M
3300017740|Ga0181418_1036658All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1243Open in IMG/M
3300017740|Ga0181418_1129209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300017742|Ga0181399_1019676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1897Open in IMG/M
3300017742|Ga0181399_1073270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage868Open in IMG/M
3300017743|Ga0181402_1056596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1050Open in IMG/M
3300017743|Ga0181402_1091711All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300017744|Ga0181397_1073305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage921Open in IMG/M
3300017748|Ga0181393_1070079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300017752|Ga0181400_1128369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300017753|Ga0181407_1029508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1484Open in IMG/M
3300017753|Ga0181407_1117464All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300017756|Ga0181382_1065144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1027Open in IMG/M
3300017756|Ga0181382_1136812All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage646Open in IMG/M
3300017756|Ga0181382_1164074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300017758|Ga0181409_1170892Not Available632Open in IMG/M
3300017759|Ga0181414_1094003Not Available790Open in IMG/M
3300017760|Ga0181408_1039720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1274Open in IMG/M
3300017760|Ga0181408_1179015Not Available542Open in IMG/M
3300017763|Ga0181410_1207131Not Available535Open in IMG/M
3300017764|Ga0181385_1111813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage835Open in IMG/M
3300017765|Ga0181413_1267634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300017773|Ga0181386_1068367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1127Open in IMG/M
3300017776|Ga0181394_1115741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage848Open in IMG/M
3300017779|Ga0181395_1064725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1192Open in IMG/M
3300017779|Ga0181395_1079242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1061Open in IMG/M
3300017779|Ga0181395_1124280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300017782|Ga0181380_1088343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1081Open in IMG/M
3300017782|Ga0181380_1241938Not Available600Open in IMG/M
3300018420|Ga0181563_10102287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1873Open in IMG/M
3300018642|Ga0188867_1005446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300020347|Ga0211504_1010301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2824Open in IMG/M
3300020347|Ga0211504_1034428All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1266Open in IMG/M
3300020382|Ga0211686_10339314Not Available613Open in IMG/M
3300020403|Ga0211532_10183478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
3300020404|Ga0211659_10083083All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1488Open in IMG/M
3300020421|Ga0211653_10214050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage844Open in IMG/M
3300020428|Ga0211521_10398985All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300020469|Ga0211577_10211277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1272Open in IMG/M
3300021085|Ga0206677_10000533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage36078Open in IMG/M
3300021335|Ga0213867_1041409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1790Open in IMG/M
3300021375|Ga0213869_10428702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300021378|Ga0213861_10215359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1037Open in IMG/M
3300021389|Ga0213868_10203417Not Available1186Open in IMG/M
3300021957|Ga0222717_10011487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6123Open in IMG/M
3300021957|Ga0222717_10099402All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1819Open in IMG/M
3300021959|Ga0222716_10182386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1344Open in IMG/M
3300021960|Ga0222715_10501832Not Available644Open in IMG/M
3300022069|Ga0212026_1035598Not Available738Open in IMG/M
3300022074|Ga0224906_1004314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6114Open in IMG/M
3300022074|Ga0224906_1036844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1636Open in IMG/M
3300022168|Ga0212027_1017732Not Available975Open in IMG/M
(restricted) 3300023109|Ga0233432_10030112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3729Open in IMG/M
(restricted) 3300023210|Ga0233412_10406787Not Available609Open in IMG/M
3300024188|Ga0228602_1068154Not Available594Open in IMG/M
3300024235|Ga0228665_1129142Not Available519Open in IMG/M
3300024237|Ga0228653_1067581Not Available790Open in IMG/M
3300024262|Ga0210003_1071864Not Available1664Open in IMG/M
3300024346|Ga0244775_10240304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1511Open in IMG/M
3300024348|Ga0244776_10453974Not Available838Open in IMG/M
3300024417|Ga0228650_1177692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
(restricted) 3300024528|Ga0255045_10085242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1125Open in IMG/M
3300025048|Ga0207905_1007596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1964Open in IMG/M
3300025071|Ga0207896_1010239All Organisms → Viruses → Predicted Viral1680Open in IMG/M
3300025071|Ga0207896_1016718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1286Open in IMG/M
3300025086|Ga0208157_1085961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300025101|Ga0208159_1010132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2571Open in IMG/M
3300025102|Ga0208666_1061395All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1018Open in IMG/M
3300025103|Ga0208013_1094733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage758Open in IMG/M
3300025120|Ga0209535_1080784All Organisms → Viruses → Predicted Viral1235Open in IMG/M
3300025120|Ga0209535_1087418All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1158Open in IMG/M
3300025127|Ga0209348_1094971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage934Open in IMG/M
3300025132|Ga0209232_1152555Not Available737Open in IMG/M
3300025132|Ga0209232_1162163Not Available707Open in IMG/M
3300025610|Ga0208149_1122273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300025653|Ga0208428_1016748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2458Open in IMG/M
3300025671|Ga0208898_1039566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1820Open in IMG/M
3300025674|Ga0208162_1196992Not Available514Open in IMG/M
3300025696|Ga0209532_1053074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1618Open in IMG/M
3300025759|Ga0208899_1172986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage714Open in IMG/M
3300025840|Ga0208917_1101210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1053Open in IMG/M
3300025889|Ga0208644_1263667Not Available705Open in IMG/M
3300026505|Ga0228647_1011373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2438Open in IMG/M
3300027186|Ga0208797_1028927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage727Open in IMG/M
3300027186|Ga0208797_1029250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300027196|Ga0208438_1005272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2462Open in IMG/M
3300027320|Ga0208923_1006150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2109Open in IMG/M
3300028125|Ga0256368_1005560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1979Open in IMG/M
3300029448|Ga0183755_1047782All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1100Open in IMG/M
3300031519|Ga0307488_10127560Not Available1813Open in IMG/M
3300034375|Ga0348336_160079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater30.64%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.65%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.14%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.67%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.78%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.20%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.31%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.31%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.73%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.16%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.16%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.16%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.16%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.16%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.58%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.58%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.58%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.58%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.58%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.58%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.58%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.58%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.58%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.58%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007647Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010936Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15mEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018642Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024188Seawater microbial communities from Monterey Bay, California, United States - 2DEnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024237Seawater microbial communities from Monterey Bay, California, United States - 65DEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024417Seawater microbial communities from Monterey Bay, California, United States - 62DEnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026505Seawater microbial communities from Monterey Bay, California, United States - 59DEnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027196Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1002689783300000101MarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG*
DelMOWin2010_1012175323300000117MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLFNG*
BBAY92_1005733833300000947Macroalgal SurfaceMGKVRKGYDSQDGIIARFKRDARSSTNNSAVARAMRNSKGKVKQQDKDAVVFSPLALNQLYNG*
JGI24006J15134_1003216223300001450MarineMSKKMSKGYDAQDRVLAGFKRAAKSSNVNSAVAKAMRNKKKVKPQKDEDIVFSPMALIELYNG*
JGI24005J15628_1005841613300001589MarineMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQNEEVVFSPLALIQLTNG*
JGI24005J15628_1007323133300001589MarineSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQNEEVVFSPLALIQLTNG*
JGI24513J20088_101306223300001720MarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQNEEVVFSPLALIQLTNG*
Ga0055584_10020300833300004097Pelagic MarineMAKVKKGYDSQDGVIARFRRDAKSSTKNSAVARAMRNSKGNVKQQDKDAVVFSPLALNQLYNG*
Ga0065861_103452253300004448MarineDMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQNEEVVFSPLALIQLTNG*
Ga0075474_1001660663300006025AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDVVFSPLALIQLLNG*
Ga0075462_1015581943300006027AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKTQNEEVVFSPLALIQL
Ga0075466_118835713300006029AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDVVFSPLALIQLQNG*
Ga0075441_1002616723300006164MarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQQDKDIVFSPNALIQLTNG*
Ga0098038_104989213300006735MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKTQNEEVVFSPLALIQLQNG*
Ga0098038_106741923300006735MarineMAKMKKGYDAQDRVIARFRRDAKSSNNNSAVANALRNKKKVKKQNDDIVFSPLALIQLQNG*
Ga0098037_108263753300006737MarineMAKMKKGYDAQDRVIARFRRDAKSSNANSAVAKALRNKKKVKQQKDEDVVFSPLALIELYNG*
Ga0098037_118267323300006737MarineMAKVRKGYDAQDRIIARFRRDAKASTNNSAVAKAMRNKKSLKKQKDDGVVFSPLALIQLQNG*
Ga0098037_120564123300006737MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQKDEEVVFSPLALNELYNG*
Ga0098042_102071743300006749MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDIVFSPLALIQLQNG*
Ga0098042_114882523300006749MarineMAKVRKGYDAQDRIIARFKRDAKSSNNNSAVANALRNKKKVKKQNDDIVFSPLALIQLQNG*
Ga0098048_105830513300006752MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQKDEEVVFSPLALNELYNG*
Ga0098054_101841573300006789MarineMSKVRKGYDAQDRVIARFKRDARSVSNNSAVAKAMRNKKKLKKKKDEDVVFSPLALIQLQNG*
Ga0098055_114115733300006793MarineMAKVRKGYDAQDRIIARFKRDAKSSNNNSAVAKALRNKKKVKKQNDDIVFSPLALIQLQNG*
Ga0070749_1006564673300006802AqueousMSKKMSKGYDAQDRVIAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLFNG*
Ga0075467_1073160013300006803AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLLNG*
Ga0075476_1015728223300006867AqueousDMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLLNG*
Ga0075481_1006601813300006868AqueousMSKKMSKGYDAQDRVIAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLLNG*
Ga0070748_114600153300006920AqueousMSKKMSKGYDAQDRVLAGFKRAAKSSNVNSAVAKAMRNKKKVKQQKDEDIVFSPLALIELYNG*
Ga0098060_101467253300006921MarineMGKVRKGYDSQDGIIARFKRDAKSSTNNSAVARAMRNKKSLKKQKDDGVVFSPLALIQLQNG*
Ga0070747_104693153300007276AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKTQNEEVVFSPLALIQLLNG*
Ga0070752_137254923300007345AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDVVFSPLA
Ga0099849_125113513300007539AqueousMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQL
Ga0102817_107643913300007555EstuarineKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0102855_110211613300007647EstuarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG*
Ga0102825_105150913300007655EstuarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQNEEVVFSPLALIQLTNG*
Ga0102831_115940033300008996EstuarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQKDEEIVFSPLALNELYNG*
Ga0102816_102671823300008999EstuarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEVVFSPLALNELYNG*
Ga0102816_103200613300008999EstuarineGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG*
Ga0102811_114770243300009024EstuarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQKDEEIVFSPLALNELYNG*
Ga0102829_106779523300009026EstuarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG*
Ga0102812_1004999313300009086EstuarineKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0102812_1060994933300009086EstuarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQNEEVVFSPLALIQLVNG*
Ga0114918_1013982013300009149Deep SubsurfaceMGKVRKGYDCQDGILARFKRDARSSTNNSAVARAMRSKKDKIKPQVKDEIQFSPFALTQLNNG*
Ga0115547_101616853300009426Pelagic MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKTQNEEVVFSPLALILLQNG*
Ga0115545_1002596133300009433Pelagic MarineMAKVRKGYDAQDRIIARFRRDAKASTNNSAVAKAMRNKKSLKKQKDEDVVFSPLALIQLQNG*
Ga0115008_1047047223300009436MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAIKNKKKVKTQNEEVVFSPLALIQLQNG*
Ga0115554_124059323300009472Pelagic MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMKNKKKVKTQNEEVVFSPLALIQLQNG*
Ga0115001_1073228623300009785MarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQNEEVGFSPLALIQLTNG*
Ga0098043_104232333300010148MarineMAKMKKGYDAQDRVIARFRRDAKSSNNNSAVAKALRNKKKVKEQVEDVVFSPAALIELYNG*
Ga0098043_113299743300010148MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDIVFSPL
Ga0098043_114849313300010148MarineMAKVRKGYDAQDRIIARFKRDAKSSNVNSAVAKAMKNKKKVKKQNDDIVFSPAALIELYNG*
Ga0137784_107850023300010936MarineMAKVRKGYDAQDRIIARFKRDAKSSNKNSAVAQALRNKKKVKKQDEAVYSPLALIELYNG
Ga0160423_1023972733300012920Surface SeawaterMAKVRKGYDAQDRIIARFKRDAKSSNINSAVAQALKNKKKVKKQDEAVYSPLALIELYNG
Ga0163109_1011441283300012936Surface SeawaterMAKVRKGYDAQDRIIARFKRDAKSSNKNSAVAKALRNKKKVKKQNDDIVFSPAGLIELYNG*
Ga0163109_1043341813300012936Surface SeawaterMAKVRKGYDAQDRIIARFKRDAKSSNINSAVAQALKNKKKVKKQDEAVFSPLALIQLQNG
Ga0163179_1087180313300012953SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLQNG*
Ga0163111_1099481113300012954Surface SeawaterMAKVKKGYDAQDRVIARFKRDAKSSNVNSAVAKAMRNKKKVKKQDEDIVFSPLALIELYNG*
Ga0129327_1002874993300013010Freshwater To Marine Saline GradientMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKTQNEEVVFSPLALIQLQNG*
Ga0180120_1038732613300017697Freshwater To Marine Saline GradientSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0181377_100250053300017706MarineMAKVRKGYDAQDRIIARFRRDAKASTNNSAVAKAMRNKKSLKKQKDDGVVFSPLALIQLQNG
Ga0181369_110395113300017708MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDIVF
Ga0181387_101301513300017709SeawaterMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKKQDEAVFSPLALIQLQNG
Ga0181391_104664723300017713SeawaterDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLLNG
Ga0181391_109390823300017713SeawaterDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0181391_109641743300017713SeawaterMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEV
Ga0181404_107348213300017717SeawaterIKDMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0181383_101370813300017720SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKKQDEAVFSPLALIQLQN
Ga0181383_101867753300017720SeawaterMSKKMSKGYDAQDRVLAGFKRAAKSSNVNSAVAKAMRNKKKVKPQKDEDIVFSPLALIQLYNG
Ga0181383_112252213300017720SeawaterMAKMKKGYDAQDRIIARFRRDAKSSNANSAVAKALRNKKKVKQQKDEDVVFSPLALIELYNG
Ga0181388_100510313300017724SeawaterDMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQKDEEVVFSPLALNELYNG
Ga0181398_105899613300017725SeawaterDMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLLNG
Ga0181401_116738923300017727SeawaterMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLLNG
Ga0181417_106924643300017730SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKQQKDEDIVFSPLALNELYNG
Ga0181417_107151623300017730SeawaterFKIKDMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG
Ga0181416_103059613300017731SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRHKKKVKTQNEEVVFSPLALIQLQNG
Ga0181415_104157023300017732SeawaterMAKMKKGYDAQDRVIARFRRDAKSSNNNSAVANALRNKKKVKKQDEDIVFSPLALIELYN
Ga0181426_104777013300017733SeawaterIKDMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG
Ga0181426_109956313300017733SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNIHSAVAKAMRNKKKVKPQKDEDIVFSPLALIQLYNG
Ga0187218_104296723300017737SeawaterMSKKMSKGCEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0181428_102628823300017738SeawaterMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKTVKPQNEEVVFSPLALIQLLNG
Ga0181428_106992713300017738SeawaterMRKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0181433_100891333300017739SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKQQKDEDIVFSPLALIELYNG
Ga0181433_101645333300017739SeawaterSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKKQDEAVFSPLALIQLQNG
Ga0181418_103665813300017740SeawaterDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQNEEVVFSPLALIQLLNG
Ga0181418_112920913300017740SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKQQKDEDIV
Ga0181399_101967643300017742SeawaterKDMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQKDEEVVFSPLALNELYNG
Ga0181399_107327023300017742SeawaterMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEVVFSPLALNELYNG
Ga0181402_105659623300017743SeawaterDMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQNEEVVFSPLALIQLLNG
Ga0181402_109171113300017743SeawaterMSKKMSKGYDAQDIVLAGFRRVAKSSNINSAVEKAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0181397_107330513300017744SeawaterKIKDMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQNEEVVFSPLALIQLLNG
Ga0181393_107007923300017748SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEVVFSPLALNELYNG
Ga0181400_112836923300017752SeawaterMSKKMSKGYDAQDRVLAGFRRAVKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0181407_102950843300017753SeawaterDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0181407_111746413300017753SeawaterDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSHLALIKLLNG
Ga0181382_106514423300017756SeawaterSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKQQKDEDIVFSPLALIELYNG
Ga0181382_113681213300017756SeawaterKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKKQDEAVFSPLALIQLQNG
Ga0181382_116407413300017756SeawaterKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQNEEVVFSPLALIQLTNG
Ga0181409_117089233300017758SeawaterMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPSALIQLLNG
Ga0181414_109400333300017759SeawaterMAKIKKGYDAQDRVIARFRRDAKSSNANSAVANALRNKKKVKKQDEAVFSPLALIELLNG
Ga0181408_103972023300017760SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKQQKDEDIVFSPLALIELYNG
Ga0181408_117901513300017760SeawaterMAKMKKGYDAQDRVIARFRRDAKSSNANSAVAKALRNKKKVKQQKDEDVVFSPLALNELYNG
Ga0181410_120713123300017763SeawaterMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEVVFSPLALNELYNG
Ga0181385_111181323300017764SeawaterSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0181413_126763423300017765SeawaterDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKKQDEAVFSPLALIQLQNG
Ga0181386_106836733300017773SeawaterFKIKDMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQKDEEVVFSPLALNELYNG
Ga0181394_111574123300017776SeawaterKIKDMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG
Ga0181395_106472533300017779SeawaterKIKDMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0181395_107924223300017779SeawaterDMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0181395_112428013300017779SeawaterKDMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG
Ga0181380_108834333300017782SeawaterQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQKDEEVVFSPLALNELYNG
Ga0181380_124193823300017782SeawaterMSKKMSKGYDAQDRVLSGFRRAAKSSNINSAVAKAMRNKKKVKQQKDEDIVFSPLALIQLYNR
Ga0181563_1010228723300018420Salt MarshMAKVRKGYDAQDRIIAKFKRDAKSSNRNSAVAQALRNKKVVKKQDEAVFSPLALIELYNG
Ga0188867_100544613300018642Freshwater LakeMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0211504_101030163300020347MarineMGKVRKGYDSQDGIIARFKRDAKSSTNNSAVARAMRNKKSLKKQKDDGIVFSPLALIQLQNG
Ga0211504_103442853300020347MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNVNSAVAKAMRNKKKVKQQKDEDVVFSPLALIQLTNG
Ga0211686_1033931423300020382MarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQQDKDIVFSPNALIQLTNG
Ga0211532_1018347823300020403MarineMAKVRKGYDAQDRIIARFKRDAKSSNRNSAVAQALRNKKVVKKQDEAVFSPLALIELYNG
Ga0211659_1008308323300020404MarineMAKVRKGYDAQDRIIARFKRDAKSSNKNSAVAKALRNKKKVKEQNDDIVFSPAALNELYN
Ga0211653_1021405013300020421MarineKKGYDAQDRVIARFRRDAKSSNNNSAVAKALRNKKKVKEQVEDVVFSPAALIELYNG
Ga0211521_1039898513300020428MarineKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0211577_1021127733300020469MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQNEEVVFSPLALIQLLNG
Ga0206677_10000533163300021085SeawaterMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQNEEVVFSPLALIQLLNG
Ga0213867_104140923300021335SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDVVFSPLALIQLLNG
Ga0213869_1042870223300021375SeawaterSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLN
Ga0213861_1021535923300021378SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG
Ga0213868_1020341763300021389SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLFNG
Ga0222717_1001148763300021957Estuarine WaterMAKVRKGYDSQDGVIARFRRDARSSTNNSAVARAMRNSKGKVKQQDKDAVVFSPLALNQLYNG
Ga0222717_1009940223300021957Estuarine WaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQKDEEVVFSPLALNELYNG
Ga0222716_1018238663300021959Estuarine WaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQNEEVVFSPLALIQLVNG
Ga0222715_1050183213300021960Estuarine WaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQKDEEVVFSP
Ga0212026_103559813300022069AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDVVFS
Ga0224906_100431443300022074SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQKDEEVVFSPLALNELYNG
Ga0224906_103684443300022074SeawaterMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0212027_101773253300022168AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDVVFSPLALIQLQNG
(restricted) Ga0233432_1003011253300023109SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQKDEEVVFSPLALIQLVNG
(restricted) Ga0233412_1040678723300023210SeawaterMGKVRKGYDCQDGIIARFKRDARSSTNNSAVARAMRSKKDKIKPQVKDEIEFSPYALTQLNNG
Ga0228602_106815413300024188SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQNEEVVFSPLALIQLLNG
Ga0228665_112914233300024235SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQKDEEIVFSPLALNE
Ga0228653_106758143300024237SeawaterMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0210003_107186463300024262Deep SubsurfaceMGKVRKGYDSQDGIIARFKRDARSSTNNSAVARAMRNSKGKVKQQDKDAVVFSPLALNQLYNG
Ga0244775_1024030413300024346EstuarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG
Ga0244776_1045397443300024348EstuarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0228650_117769213300024417SeawaterKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQKDEEVVFSPLALNELYNG
(restricted) Ga0255045_1008524213300024528SeawaterMGKVRKGYDSQDGIIARFKRDAKSSTNNSAVARAMRNKKSLKKQKDDGVVFSPLALIQLQNG
Ga0207905_100759653300025048MarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQNEEVVFSPLALIQLTNG
Ga0207896_101023943300025071MarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQNEEVVFSPLALIQLTNG
Ga0207896_101671813300025071MarineKDMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQNEEVVFSPLALIQLTNG
Ga0208157_108596123300025086MarineMSKMKKGYDAQDRVIARFRRDAKSSNANSAVAKALRNKKKVKQQKDEDVVFSPLALIELYNG
Ga0208159_101013243300025101MarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDIVFSPLALIQLQNG
Ga0208666_106139543300025102MarineMAKMKKGYDAQDRVIARFRRDAKSSNANSAVAKALRNKKKVKQQKDEDVVFSPLALIELYNG
Ga0208013_109473313300025103MarineMSKVRKGYDAQDRVIARFKRDARSVSNNSAVAKAMRNKKKLKKKKDEDVVFSPLALIQLQNG
Ga0209535_108078433300025120MarineMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKPQNEEVVFSPLALIQLTNG
Ga0209535_108741823300025120MarineMSKKMSKGYDAQDRVLAGFKRAAKSSNVNSAVAKAMRNKKKVKPQKDEDIVFSPMALIELYNG
Ga0209348_109497123300025127MarineMAKVRKGYDAQDRIIARFKRDAKSSNINSAVAQALKNKKKVKKQDEAVYSPLALIQLLNG
Ga0209232_115255513300025132MarineMAKMKKGYDAQDRVIARFRRDAKSSNANSAVAKALRNKKKVKQQKD
Ga0209232_116216313300025132MarineMAKMKKGYDAQDRIIARFRRDAKSSNANSAVAKALRNKKKVKQQKD
Ga0208149_112227313300025610AqueousMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDVVFSPLALIQLLNG
Ga0208428_101674843300025653AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLLNG
Ga0208898_103956613300025671AqueousMSKKMSKGYDAQDRVIAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLLNG
Ga0208162_119699223300025674AqueousMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0209532_105307433300025696Pelagic MarineMAKVRKGYDAQDRIIARFRRDAKASTNNSAVAKAMRNKKSLKKQKDEDVVFSPLALIQLQNG
Ga0208899_117298623300025759AqueousKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKTQNEEVVFSPLALIQLQNG
Ga0208917_110121023300025840AqueousMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEEVVFSPLALIQLFNG
Ga0208644_126366743300025889AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKTQNEDVVF
Ga0228647_101137343300026505SeawaterMSKKMSKGYDSQDRVLAGFRRAAKSSNINSAVAKAMRNKKKVKPQNEEVVFSPLALIQLLNG
Ga0208797_102892713300027186EstuarineSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0208797_102925023300027186EstuarineSKGYEAQDRVLAGFRRAAKSSNINSAVAKAMRDKKKVKPQNEEVVFSPLALIQLLNG
Ga0208438_100527213300027196EstuarineMSKKMSKGYEAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQNEEVVFSPLALIQLLNG
Ga0208923_100615063300027320EstuarineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRDKKKVKPQKDEEIVFSPLALNELYNG
Ga0256368_100556043300028125Sea-Ice BrineMGKVRKGYDCQDGIIARFKRDARSSTNNSAVARAMRSKKDKIKPQVKDEIEFSPFALTQLNNG
Ga0183755_104778213300029448MarineMSKKMSKGYDAQDRVLAGFKRAAKSSNVNSAVAKAMRNKKKVKQQKDEDIVFSPLALIELYNG
Ga0307488_1012756083300031519Sackhole BrineMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVAKAMKNKKKVKPQNEEVVFSPLALIQLLNG
Ga0348336_160079_458_6463300034375AqueousMSKKMSKGYDAQDRVLAGFRRAAKSSNINSAVARAMRNKKKVKTQNEEVVFSPLALIQLLNG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.