NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034608

Metagenome / Metatranscriptome Family F034608

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034608
Family Type Metagenome / Metatranscriptome
Number of Sequences 174
Average Sequence Length 43 residues
Representative Sequence VTKLLIILLFGGALANSLASANSEPPLLIDSQPAPASLDASN
Number of Associated Samples 122
Number of Associated Scaffolds 174

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.86 %
% of genes near scaffold ends (potentially truncated) 22.41 %
% of genes from short scaffolds (< 2000 bps) 79.31 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.805 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere
(15.517 % of family members)
Environment Ontology (ENVO) Unclassified
(54.598 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(67.816 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 28.57%    β-sheet: 0.00%    Coil/Unstructured: 71.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 174 Family Scaffolds
PF04551GcpE 39.66
PF00892EamA 33.33
PF07077DUF1345 9.20
PF01425Amidase 2.30
PF08937DUF1863 1.15
PF13650Asp_protease_2 1.15
PF13374TPR_10 0.57
PF13676TIR_2 0.57
PF12697Abhydrolase_6 0.57
PF00893Multi_Drug_Res 0.57
PF05299Peptidase_M61 0.57
PF04343DUF488 0.57
PF13975gag-asp_proteas 0.57
PF04339FemAB_like 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 174 Family Scaffolds
COG08214-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpELipid transport and metabolism [I] 39.66
COG4291Uncharacterized membrane proteinFunction unknown [S] 9.20
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 2.30
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.57
COG2076Multidrug transporter EmrE and related cation transportersDefense mechanisms [V] 0.57
COG3146Predicted N-acyltransferaseGeneral function prediction only [R] 0.57
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.57
COG3975Predicted metalloprotease, contains C-terminal PDZ domainGeneral function prediction only [R] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.80 %
UnclassifiedrootN/A9.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig03737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis903Open in IMG/M
2228664022|INPgaii200_c0735795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis738Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101470223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1072Open in IMG/M
3300001979|JGI24740J21852_10007234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00074525Open in IMG/M
3300003323|rootH1_10026065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1955Open in IMG/M
3300004081|Ga0063454_101602316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.562Open in IMG/M
3300004114|Ga0062593_100150079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1766Open in IMG/M
3300004114|Ga0062593_101196442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas797Open in IMG/M
3300004479|Ga0062595_100324578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1054Open in IMG/M
3300004479|Ga0062595_101073458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas701Open in IMG/M
3300005093|Ga0062594_100543891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16998Open in IMG/M
3300005165|Ga0066869_10040907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.785Open in IMG/M
3300005168|Ga0066809_10143904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6614Open in IMG/M
3300005290|Ga0065712_10617267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.583Open in IMG/M
3300005327|Ga0070658_10010869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00577299Open in IMG/M
3300005327|Ga0070658_10471812Not Available1082Open in IMG/M
3300005327|Ga0070658_10506791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1043Open in IMG/M
3300005327|Ga0070658_10620127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis938Open in IMG/M
3300005327|Ga0070658_11319871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas626Open in IMG/M
3300005327|Ga0070658_11564303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas571Open in IMG/M
3300005329|Ga0070683_100264071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.1638Open in IMG/M
3300005331|Ga0070670_100534865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-161044Open in IMG/M
3300005335|Ga0070666_10004402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00578579Open in IMG/M
3300005335|Ga0070666_10316767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1112Open in IMG/M
3300005336|Ga0070680_100202776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1673Open in IMG/M
3300005339|Ga0070660_101305915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis616Open in IMG/M
3300005344|Ga0070661_100104378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2111Open in IMG/M
3300005354|Ga0070675_101201217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae698Open in IMG/M
3300005355|Ga0070671_100008840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00578083Open in IMG/M
3300005355|Ga0070671_100016044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00076053Open in IMG/M
3300005355|Ga0070671_100058291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3215Open in IMG/M
3300005355|Ga0070671_101009923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.729Open in IMG/M
3300005355|Ga0070671_101774654Not Available548Open in IMG/M
3300005364|Ga0070673_102367661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6505Open in IMG/M
3300005367|Ga0070667_100360338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.1318Open in IMG/M
3300005435|Ga0070714_100047169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00573659Open in IMG/M
3300005435|Ga0070714_100068115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3070Open in IMG/M
3300005435|Ga0070714_100854584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae882Open in IMG/M
3300005436|Ga0070713_100122390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2284Open in IMG/M
3300005436|Ga0070713_100152499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2057Open in IMG/M
3300005455|Ga0070663_100057309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00572795Open in IMG/M
3300005455|Ga0070663_100455913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1055Open in IMG/M
3300005455|Ga0070663_100747298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.835Open in IMG/M
3300005457|Ga0070662_100309441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1286Open in IMG/M
3300005457|Ga0070662_101253901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas638Open in IMG/M
3300005458|Ga0070681_10639379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria979Open in IMG/M
3300005529|Ga0070741_10077134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00073697Open in IMG/M
3300005530|Ga0070679_100818026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis875Open in IMG/M
3300005532|Ga0070739_10014011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00077219Open in IMG/M
3300005544|Ga0070686_101666235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis541Open in IMG/M
3300005546|Ga0070696_100145960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.1733Open in IMG/M
3300005563|Ga0068855_101088600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas836Open in IMG/M
3300005564|Ga0070664_101562851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas625Open in IMG/M
3300005568|Ga0066703_10265482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1041Open in IMG/M
3300005574|Ga0066694_10301956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis762Open in IMG/M
3300005578|Ga0068854_102078958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas524Open in IMG/M
3300005614|Ga0068856_100632447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1091Open in IMG/M
3300005614|Ga0068856_100956697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.875Open in IMG/M
3300005616|Ga0068852_100372254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1400Open in IMG/M
3300005618|Ga0068864_101656367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas644Open in IMG/M
3300005764|Ga0066903_100818645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1669Open in IMG/M
3300005841|Ga0068863_100036522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas4681Open in IMG/M
3300005843|Ga0068860_102273122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6563Open in IMG/M
3300005844|Ga0068862_101821970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas618Open in IMG/M
3300006237|Ga0097621_100807969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas869Open in IMG/M
3300006358|Ga0068871_100180250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.1815Open in IMG/M
3300006880|Ga0075429_100457276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1119Open in IMG/M
3300006880|Ga0075429_100746020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales858Open in IMG/M
3300006893|Ga0073928_10370240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1056Open in IMG/M
3300006954|Ga0079219_11021062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas689Open in IMG/M
3300009093|Ga0105240_10574271Not Available1245Open in IMG/M
3300009174|Ga0105241_12171585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas550Open in IMG/M
3300009176|Ga0105242_12671549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis549Open in IMG/M
3300009177|Ga0105248_10121456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00072947Open in IMG/M
3300009545|Ga0105237_11925780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis599Open in IMG/M
3300010039|Ga0126309_10739370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas636Open in IMG/M
3300010042|Ga0126314_10594880Not Available807Open in IMG/M
3300010373|Ga0134128_10079622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3742Open in IMG/M
3300010373|Ga0134128_12775358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas540Open in IMG/M
3300010375|Ga0105239_10211166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2176Open in IMG/M
3300010397|Ga0134124_10831897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.925Open in IMG/M
3300012212|Ga0150985_120299606Not Available762Open in IMG/M
3300012960|Ga0164301_11046605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum thermophilum645Open in IMG/M
3300013100|Ga0157373_10321932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1100Open in IMG/M
3300013105|Ga0157369_10006184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.13896Open in IMG/M
3300013105|Ga0157369_10898941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas908Open in IMG/M
3300013105|Ga0157369_12022555Not Available584Open in IMG/M
3300013296|Ga0157374_10198721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1963Open in IMG/M
3300015372|Ga0132256_102431742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis626Open in IMG/M
3300015373|Ga0132257_103491108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057572Open in IMG/M
3300015374|Ga0132255_105680624Not Available528Open in IMG/M
3300018433|Ga0066667_10403666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1105Open in IMG/M
3300018468|Ga0066662_10857486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis888Open in IMG/M
3300018476|Ga0190274_10556275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1163Open in IMG/M
3300018920|Ga0190273_10154851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1375Open in IMG/M
3300020069|Ga0197907_10322507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007934Open in IMG/M
3300020082|Ga0206353_11165868Not Available858Open in IMG/M
3300020082|Ga0206353_11536035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis510Open in IMG/M
3300021363|Ga0193699_10445485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6533Open in IMG/M
3300021445|Ga0182009_10084632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00071419Open in IMG/M
3300021445|Ga0182009_10118851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1226Open in IMG/M
3300021445|Ga0182009_10141305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00071137Open in IMG/M
3300025321|Ga0207656_10082672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1446Open in IMG/M
3300025321|Ga0207656_10191291Not Available985Open in IMG/M
3300025903|Ga0207680_10567535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16811Open in IMG/M
3300025904|Ga0207647_10225268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1080Open in IMG/M
3300025904|Ga0207647_10256750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-161001Open in IMG/M
3300025904|Ga0207647_10368804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007812Open in IMG/M
3300025904|Ga0207647_10392788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007782Open in IMG/M
3300025909|Ga0207705_10047500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3087Open in IMG/M
3300025909|Ga0207705_10462924All Organisms → cellular organisms → Bacteria → Proteobacteria984Open in IMG/M
3300025911|Ga0207654_10564831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007809Open in IMG/M
3300025917|Ga0207660_10271323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1344Open in IMG/M
3300025919|Ga0207657_10026544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00575320Open in IMG/M
3300025919|Ga0207657_10659921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas814Open in IMG/M
3300025919|Ga0207657_10736706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6764Open in IMG/M
3300025919|Ga0207657_10806758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007725Open in IMG/M
3300025920|Ga0207649_10740673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis764Open in IMG/M
3300025920|Ga0207649_11356702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae562Open in IMG/M
3300025923|Ga0207681_11487017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas568Open in IMG/M
3300025925|Ga0207650_11333362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae611Open in IMG/M
3300025928|Ga0207700_10084776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2485Open in IMG/M
3300025929|Ga0207664_10167332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1879Open in IMG/M
3300025929|Ga0207664_11153074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas692Open in IMG/M
3300025930|Ga0207701_10161990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1979Open in IMG/M
3300025930|Ga0207701_11401903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16569Open in IMG/M
3300025931|Ga0207644_10028106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3889Open in IMG/M
3300025931|Ga0207644_10404389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1116Open in IMG/M
3300025931|Ga0207644_11702581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae528Open in IMG/M
3300025932|Ga0207690_10018740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas4248Open in IMG/M
3300025932|Ga0207690_11137107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas651Open in IMG/M
3300025933|Ga0207706_11151344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057646Open in IMG/M
3300025934|Ga0207686_10308023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1179Open in IMG/M
3300025941|Ga0207711_10402182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00071272Open in IMG/M
3300025944|Ga0207661_11568183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas603Open in IMG/M
3300025945|Ga0207679_10109106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2180Open in IMG/M
3300025949|Ga0207667_10138590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2505Open in IMG/M
3300025960|Ga0207651_11423508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6624Open in IMG/M
3300025972|Ga0207668_12021029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples → uncultured Sphingomonas sp.519Open in IMG/M
3300026067|Ga0207678_10051206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00573565Open in IMG/M
3300026078|Ga0207702_10574442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1105Open in IMG/M
3300026088|Ga0207641_10035577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas4150Open in IMG/M
3300026121|Ga0207683_11770834Not Available567Open in IMG/M
3300026142|Ga0207698_10733799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16985Open in IMG/M
3300026527|Ga0209059_1079233Not Available1395Open in IMG/M
3300027766|Ga0209796_10005465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00574238Open in IMG/M
3300027766|Ga0209796_10014549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2411Open in IMG/M
3300027766|Ga0209796_10055211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1197Open in IMG/M
3300027773|Ga0209810_1044498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2408Open in IMG/M
3300027775|Ga0209177_10267346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis638Open in IMG/M
3300027880|Ga0209481_10476998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007643Open in IMG/M
3300028380|Ga0268265_11798601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae619Open in IMG/M
3300031231|Ga0170824_128319032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16978Open in IMG/M
3300031548|Ga0307408_100537867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00071029Open in IMG/M
3300031548|Ga0307408_100628372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas957Open in IMG/M
3300031731|Ga0307405_10016814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3998Open in IMG/M
3300031852|Ga0307410_11789318Not Available545Open in IMG/M
3300031901|Ga0307406_10083836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2126Open in IMG/M
3300031903|Ga0307407_10828762Not Available705Open in IMG/M
3300031903|Ga0307407_11429197Not Available545Open in IMG/M
3300031938|Ga0308175_100021750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00575134Open in IMG/M
3300031938|Ga0308175_100651991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1138Open in IMG/M
3300031938|Ga0308175_102008236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007648Open in IMG/M
3300031938|Ga0308175_102329685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6600Open in IMG/M
3300031939|Ga0308174_10173752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00071624Open in IMG/M
3300031996|Ga0308176_10217169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1810Open in IMG/M
3300031996|Ga0308176_10510880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00071221Open in IMG/M
3300031996|Ga0308176_11689173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis675Open in IMG/M
3300032074|Ga0308173_10251926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1496Open in IMG/M
3300032074|Ga0308173_11796833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas578Open in IMG/M
3300032074|Ga0308173_12150612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007526Open in IMG/M
3300032080|Ga0326721_10132591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1240Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere15.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere10.34%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere8.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.02%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.30%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.72%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.72%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.15%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.15%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.15%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.15%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.15%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.57%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.57%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.57%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.57%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300003323Sugarcane root Sample H1Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300027766Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_013494802124908016LPAHDGAVTKLLFILFLGGALANGLAATHSEPPMLIDSAPTSLDAQN
INPgaii200_073579522228664022SoilILILGGALANSLANARSEPPLLIDSQPSPPSLDAAN
INPhiseqgaiiFebDRAFT_10147022313300000364SoilLLLILILGGALANSLANARSEPPLLIDSQPSPPSLDAAN*
JGI24740J21852_1000723453300001979Corn RhizosphereVIKLLLILALGGALANGVAKSQEQPPLLIDNASSPAP
rootH1_1002606533300003323Sugarcane Root And Bulk SoilVIKLLIILLFGGALANSLASASSEPPLLIDSQPSPAALDASR*
Ga0063454_10160231623300004081SoilVTKLLLILILGGVLANGLARSHEAPPLLIDDTPAPFAASK*
Ga0062593_10015007923300004114SoilVTKLLLIVLFGVVANALASPSEPPLLIDSQPAPTALDANN*
Ga0062593_10119644223300004114SoilLWAQLGAVTKLLLILLFSGALANALASQKEPPLLIDSQPAPTSLDASN*
Ga0062595_10032457813300004479SoilAAHKGAVTKLLLILFLGGALANGLAATHTDPPLLIDPAPASLDAQN*
Ga0062595_10107345823300004479SoilLWAQLRAVTKLLLILILGGALANSLASANSQPPLLIDSQPSPPSLDANN*
Ga0062594_10054389123300005093SoilVTKLLLILLVGGVLANGLAKSHSEPPLLIDSAPAGTSLDASK*
Ga0066869_1004090723300005165SoilVTKLLLILILGGALANSLASSHSKPPLLIDSQPSPPSLDAAN*
Ga0066809_1014390413300005168SoilVTKLLLILLFSGALVNALEANKQPPLLIDSQPSPVTLDASN*
Ga0065712_1061726723300005290Miscanthus RhizosphereLAVHHGTVTKLLLILLFGGALANALESPSEPPLLIDSQATSASLDAQN*
Ga0070658_1001086923300005327Corn RhizosphereVTKLLLILLASTALAASVAPKAEPPLLIDSQPSQPSLDANR*
Ga0070658_1047181223300005327Corn RhizosphereLSAQLGRVIKLLLILMLGGALANGVAKSQEQPPLLIDNASSPAPLDAAN*
Ga0070658_1050679123300005327Corn RhizosphereVTKLLLILLFGGALANGVARSQEQPPLLIDSQPSPTSLDANS*
Ga0070658_1062012723300005327Corn RhizosphereLAAHKGAVTKLLLILFLGGALANGLAATHTDPPLLIDPAPASLDAQN*
Ga0070658_1131987123300005327Corn RhizosphereLSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDGNS*
Ga0070658_1156430323300005327Corn RhizosphereLSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS*
Ga0070683_10026407113300005329Corn RhizospherePFFTLSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS*
Ga0070670_10053486523300005331Switchgrass RhizosphereVTKLLLILILGGVLANGIAKSHEQPPLLIESQPSALDEGK*
Ga0070666_1000440223300005335Switchgrass RhizosphereVTKLLLILILGGALANSLASANSQPPLLIDSQPSPPSLDANN*
Ga0070666_1031676723300005335Switchgrass RhizosphereAQPRAVTKLLLILILGGALANSLASANSQPPLLIDSQPSPPSLDANN*
Ga0070680_10020277623300005336Corn RhizosphereMAKLFLILMLGGALANGLVASKSEPPLLIDSPTSAAPLDAAH*
Ga0070660_10130591523300005339Corn RhizosphereLSAQLGAVTKLLLILLASTALAESVAPKAEPPLLIDSQPSQPSLDADR*
Ga0070661_10010437833300005344Corn RhizosphereVIKLLLILALGGALANGVAKSQEQPPLLIDNASSPAPLDAAN*
Ga0070675_10120121713300005354Miscanthus RhizosphereVTKLLLILILGGVLANGIAKSNEQPPLLIESQPSALDEGK*
Ga0070671_10000884063300005355Switchgrass RhizosphereVAKLLLILFLGGALVNSLASARAEPPLLIDSQAAPASLDANG*
Ga0070671_10001604443300005355Switchgrass RhizosphereLAAHKCAVTKLLLILFLGGALANGLAATHTDPPLLIDPAPASLDAQN*
Ga0070671_10005829133300005355Switchgrass RhizosphereVTKLLLILLVGGALANGLARSHSEPPLLIDSAPVGASLDASK*
Ga0070671_10100992323300005355Switchgrass RhizosphereVTKLLLIFLFGLMANALATPAEPPLLIDSQPASASLDASN*
Ga0070671_10177465413300005355Switchgrass RhizosphereLWAQLWPVTKLLIILLLGGALTNELARSHSEPPLLIDSQPSPTSLDASN*
Ga0070673_10236766123300005364Switchgrass RhizosphereVTKLLLILLVGGALANSLAARSEPPLLIDTQPAPASLDAAD*
Ga0070667_10036033833300005367Switchgrass RhizosphereLPAQHGAVVKLLIILLFGGVLANSLASAQSEPPLLIDSQPASAALDANP*
Ga0070714_10004716923300005435Agricultural SoilVTKLLLILFLGGALANGVARSQEQPPLLIDSQPSSASLDANG*
Ga0070714_10006811533300005435Agricultural SoilVTKLLLILLLGGAVANGVARSHEQPPLMIDSQPSPAGLDANS*
Ga0070714_10085458423300005435Agricultural SoilVTKLLLILLASTALAESVAPKAEPPLLIDSSPSTLDAGK*
Ga0070713_10012239023300005436Corn, Switchgrass And Miscanthus RhizosphereVTKLFIILLFGTALADSVAPKAQPPLLIDSQPSQPSLDAAR*
Ga0070713_10015249933300005436Corn, Switchgrass And Miscanthus RhizosphereLAAHKSAVTKLLLILFLVGALANGLAAAHSEPPLLIDPAPASLDAPN*
Ga0070663_10005730913300005455Corn RhizosphereTKLLLILLASTALAESVAPKAEPPLLIDSQPSQPSLDADR*
Ga0070663_10045591323300005455Corn RhizosphereFFTLPAQHGAVVKLLIILLFGGVLANSLASAQSEPPLLIDSQPASAALDANP*
Ga0070663_10074729823300005455Corn RhizosphereVTKLLLILALSGALASGLGATSEPPLLIDNSPAPASLDANG*
Ga0070662_10030944123300005457Corn RhizosphereLSAQHRAVFKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS*
Ga0070662_10125390123300005457Corn RhizosphereVTKLLLILLIGTALANGLAQSQAEPPLLIDSAPSPTTAAN*
Ga0070681_1063937923300005458Corn RhizosphereMAKLFLILMLGGALANGLVASKSEPPLLIDSPTSPAPLDAAH*
Ga0070741_1007713433300005529Surface SoilVTKLLLILLLGGALANGVAKSHEQPPLLIDNASSPAPLDAGN*
Ga0070679_10081802623300005530Corn RhizosphereGRVIKLLLILMLGGALANGVAKSQEQPPLLIDNASSPAPLDAAN*
Ga0070739_1001401183300005532Surface SoilVAKLLLILLFGGALANGLAASHSEPPLLIDSSPAAAHLDAQS*
Ga0070686_10166623523300005544Switchgrass RhizosphereVKLLIILLFGGVLANSLASAQSEPPLLIDSQPASAALDANP*
Ga0070696_10014596023300005546Corn, Switchgrass And Miscanthus RhizosphereLRHGEAVPDLILGGALANGFAASNSEPPLLIDSPVSAAPLDAAN*
Ga0068855_10108860023300005563Corn RhizosphereVQPGRVTKLLLILLLGGALANGVARSKEQPPLLIDNASSPAPLDAGN*
Ga0070664_10156285123300005564Corn RhizosphereLPAQDCAVTKLLLILLFGGALANGLAAPHSEPPLLIDPAPTSLDAQN*
Ga0066703_1026548213300005568SoilVTKLLIMLAAFVALASGLAKAQSEPPLLIDSQPAPPSLDASN*
Ga0066694_1030195613300005574SoilMIAPVIKLLVILALGGALANGFATAHSEPPLLIDSAPAALDAPR*
Ga0068854_10207895823300005578Corn RhizosphereVIKLLLILILGGALANGLAPSRSQPPLLIDNLSAPAPLDEAD*
Ga0068856_10063244723300005614Corn RhizosphereVTKLLLILLASTALAESLAPKAEPPLLIDSQPSQPSLDANQ*
Ga0068856_10095669723300005614Corn RhizosphereVIKLLLIIAAAGALANSLAPKAEPPLLIDSQPAPASLDADR*
Ga0068852_10037225423300005616Corn RhizosphereLSAQHRAVTKLLIILLFGGALAKSLAPPPLLIDAQPAPAPLDATN*
Ga0068864_10165636723300005618Switchgrass RhizosphereVTKLLIILLFSGALLNSLAAPSEPPLLIDSPASLDASR*
Ga0066903_10081864523300005764Tropical Forest SoilMIKLLLILILGGALANGLAASHSEPPLLIDSQPAPASLDVNG*
Ga0068863_10003652233300005841Switchgrass RhizosphereVTKLLLILILGGALANGIAKSHEQPPLLIESQPSALDEGK*
Ga0068860_10227312223300005843Switchgrass RhizosphereVTKLLLILILGGGLANGIAKSHEQPPLLIESQPSALDEGK*
Ga0068862_10182197023300005844Switchgrass RhizosphereVTKLLLILILGGALANGITKSHEQPPLLIESQPSALDEGK*
Ga0097621_10080796923300006237Miscanthus RhizosphereVTKLLLIVAAFGALANGLAAFSQSQPPLLIDDGRSLDAAN*
Ga0068871_10018025023300006358Miscanthus RhizosphereLPVHHGTVTKLLLILLFGGALANALESPSEPPLLIDSQATSASLDAQN*
Ga0079221_1061011223300006804Agricultural SoilMGAVIKLLLLLAIGGAVASSLAAQSQPPLLIDSAPSPASLDANS*
Ga0075429_10045727613300006880Populus RhizosphereRAMAKLFLILMLGGALANGLAASKSEPPLLIDSPASAVPLDAAH*
Ga0075429_10074602023300006880Populus RhizosphereMAKLFLILMLGGALANGLAASKSEPPLLIDSPTSAAPLDAAH*
Ga0073928_1037024023300006893Iron-Sulfur Acid SpringVTKLLIILALGGALANGFAHSHSEPPLLIDSKTTPNPLDAGY*
Ga0079219_1102106223300006954Agricultural SoilLPAHDGAVTKLLFILFLGGALANGLAATHSEPPLLIDSAPTSLDAQN*
Ga0105240_1057427123300009093Corn RhizosphereVTKLLLILLFGGALANGVARSQEQPPLLIDSQPSPTSLDA
Ga0105241_1217158523300009174Corn RhizosphereMVKLFLILILGGALANGFAASNSEPPLLIDSPVSAAPLDAAN*
Ga0105242_1267154923300009176Miscanthus RhizosphereTKLLLILILGGALANSLASANSQPPLLIDSQPSPPSLDANN*
Ga0105248_1012145633300009177Switchgrass RhizosphereVTKLLLILFLGGALVNSLASARAEPPLLIDSQAAPASLDANG*
Ga0105237_1192578023300009545Corn RhizosphereLLIILLFGGALANSLAAPSDPPLLIDSQPAPSPLDANS*
Ga0126309_1073937023300010039Serpentine SoilMIKFLLILLIGGALANGLSPKEPPLLIDTPTASGPLDAAG*
Ga0126314_1059488013300010042Serpentine SoilLAAQHSAVTKILHILALAGALAQGLASGQSEPPLLID
Ga0134128_1007962253300010373Terrestrial SoilVIKLLLILALSGALASGLTAQSQPPLLIDNASAPAPLDAAD*
Ga0134128_1277535823300010373Terrestrial SoilVTKLLLILILGGALANGVAKSHEPPPLLIDSHPSPASLDANG*
Ga0105239_1021116653300010375Corn RhizosphereVTKLLLILLFGGALANGVARSLAQPPLLIDSQPSPTSLDANS*
Ga0134124_1083189723300010397Terrestrial SoilVTKLLLILLIGTALANGLARSQAEPPLLIDPAPSPTTAAN*
Ga0150985_12029960613300012212Avena Fatua RhizosphereVTKLLLILLVGGALANGLARSHSEPPLLIDSGPVGTSLDASK*
Ga0164301_1104660513300012960SoilLSAQLGAVTKLLIILLSGGALANSLASAQSDPPLLIDSTPSAPLDATN*
Ga0157373_1032193213300013100Corn RhizosphereLFLILMLGGALANGLVASKSEPPLLIDSPTSPATLDAAH*
Ga0157369_1000618493300013105Corn RhizosphereLSAQHGAVTKLLIILLTSAALASGLSPKSDPPLLIDSQPAPASLDANN*
Ga0157369_1089894123300013105Corn RhizosphereMTKLLLILLASTALAASVAPKAEPPLLIDSQPSQPSLDANR*
Ga0157369_1202255513300013105Corn RhizosphereVTKLLLILILGGVLANGIAKSHEQPPLLIESQPSAL
Ga0157374_1019872123300013296Miscanthus RhizosphereLAAHKGAVTKLLLVLFLGGALANGLAATHTDPPLLIDPAPASLDAQN*
Ga0132256_10243174223300015372Arabidopsis RhizosphereAQLGAVTKLLLILLIGGALANALATPSAPPLLIDSGPSPAALDVSN*
Ga0132257_10349110813300015373Arabidopsis RhizosphereVTKLLLILLIGTALANGLAQSQAEPPLLIDSAPSPTAAN*
Ga0132255_10568062413300015374Arabidopsis RhizosphereVTKILVILGLFGAVANALSAKAEPPLLIDSSPSPVH
Ga0066667_1040366623300018433Grasslands SoilMLLLILLIGGALANSLSAHSEPPLLIDSHPASTSLDAVN
Ga0066662_1085748623300018468Grasslands SoilVTKLLIILAAFGALASGLAKAQSEPPLLIDSQPAPPSLDASN
Ga0190274_1055627523300018476SoilVTKLLIILLFGGALANGLAKADSEPPLLIDSQPAAALDAAN
Ga0190273_1015485123300018920SoilVTKLLIILLFGGALANGLAKADSEPPLLIDSQPAAALDAGN
Ga0197907_1032250723300020069Corn, Switchgrass And Miscanthus RhizosphereLSAQLGRVIKLLLILMLGGALANGVAKSQEQPPLLIDNASSPAPLDAAN
Ga0206353_1116586823300020082Corn, Switchgrass And Miscanthus RhizosphereVIKLLLILALGGALANGVAKSQEQPPLLIDNASSPAPLDAAN
Ga0206353_1153603523300020082Corn, Switchgrass And Miscanthus RhizosphereMTKLLLILLFGGALANGVARSQEQPPLLIDSQPSPTSLDANS
Ga0193699_1044548513300021363SoilLSAQLGVVTKLLLILILGGALANGVAKSHEQPPLLIDSQPAPATPLDATN
Ga0182009_1008463223300021445SoilLAAQARAVTKLLLILILGGALASSLSARSDPPLLIDSAPSTALDAQS
Ga0182009_1011885123300021445SoilVTKLLLILGFFGALANGLASAQSEPPLLIDSSPAATLDAQQ
Ga0182009_1014130523300021445SoilLAVHHGTVTKLLLILLFGGAVANALESPSEPPLLIDSQATSASLDAQN
Ga0207656_1008267233300025321Corn RhizosphereLAVHHGTVTKLLLILLFGGALANALESPSEPPLLIDSQATSASLDAQN
Ga0207656_1019129123300025321Corn RhizosphereLSAQHRAVFKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS
Ga0207680_1056753523300025903Switchgrass RhizosphereVTKLLLILLVGGVLANGLAKSHSEPPLLIDSAPAGTSLDASK
Ga0207647_1022526823300025904Corn RhizosphereVTKLLLILILGGVLANGIAKSHEQPPLLIESQPSALDEGK
Ga0207647_1025675023300025904Corn RhizosphereVTKLLLILALSGALASGLGATSEPPLLIDNSPAPASLDANG
Ga0207647_1036880423300025904Corn RhizosphereMVKLFLILILGGALANGFAASNSEPPLLIDSPVSAAPLDAAN
Ga0207647_1039278823300025904Corn RhizosphereLSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS
Ga0207705_1004750033300025909Corn RhizosphereVHGCAVTKLLLILLFGGALANGFAAQSEPPLLIDAPQTLDAAN
Ga0207705_1046292423300025909Corn RhizosphereVAKLLIILLFGGALAKSLTPPREPPLLIDSQPAPAPL
Ga0207654_1056483123300025911Corn RhizosphereLSAQLGRVIKLLLILALGGALANGVAKSQEQPPLLIDNASSPAPLDAAN
Ga0207660_1027132333300025917Corn RhizosphereAHFRAMAKLFLILMLGGALANGLVASKSEPPLLIDSPTSAAPLDAAH
Ga0207657_1002654473300025919Corn RhizosphereVTKLLLIVLFGVVANALASPSEPPLLIDSQPAPTALDANN
Ga0207657_1065992123300025919Corn RhizosphereVTKLLIILLLGGALTNELARSHSEPPLLIDSQPSPTSLDASN
Ga0207657_1073670623300025919Corn RhizosphereMAKLFLILMLGGALANGLVASKSEPPLLIDSPTSAAPLDAAH
Ga0207657_1080675823300025919Corn RhizosphereLPVHHGTVTKLLLILLFGGALANALESPSEPPLLIDSQATSASLDAQN
Ga0207649_1074067323300025920Corn RhizosphereVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS
Ga0207649_1135670223300025920Corn RhizosphereVTKLLIILLLGGALTNELARAHSEPPLLIDSQPSPASLDASN
Ga0207681_1148701723300025923Switchgrass RhizosphereVTKLLIILLFGALANSLASANSEPPLLIDSQPAPASLDASN
Ga0207650_1133336213300025925Switchgrass RhizosphereGQLGAVTKLLLILIIGGALANGIAKSHEQPPLLIESQPSALDEGK
Ga0207700_1008477623300025928Corn, Switchgrass And Miscanthus RhizosphereVTKLLLILFLGGALANGVARSQEQPPLLIDSQPSSASLDANG
Ga0207664_1016733223300025929Agricultural SoilVTKLLLILLLGAALADSVAPKAEPPLLIDSQPSQPSLDANR
Ga0207664_1115307423300025929Agricultural SoilVTKLLLILLASTALAESVAPKAEPPLLIDSSPSTLDAGK
Ga0207701_1016199033300025930Corn, Switchgrass And Miscanthus RhizosphereLPAQHGAVVKLLIILLFGGVLANSLASAQSEPPLLIDSQPASAALDANP
Ga0207701_1140190313300025930Corn, Switchgrass And Miscanthus RhizosphereVTKLLLILLVGGVLANGLAKSHSEPPLLIDSAPAGTSLDAS
Ga0207644_1002810643300025931Switchgrass RhizosphereVAKLLLILFLGGALVNSLASARAEPPLLIDSQAAPASLDANG
Ga0207644_1040438923300025931Switchgrass RhizosphereLAAHKCAVTKLLLILFLGGALANGLAATHTDPPLLIDPAPASLDAQN
Ga0207644_1170258133300025931Switchgrass RhizosphereVTKLLIILLLGGALTNELARSHSEPPLLIDSQPSPTSL
Ga0207690_1001874033300025932Corn RhizosphereMAKLFLILMLGGALANGLVASKSEPPLLIDSPTSPAPLDAAH
Ga0207690_1113710723300025932Corn RhizosphereLSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDGNS
Ga0207706_1115134423300025933Corn RhizosphereKLLLILLIGTALANGLAQSQAEPPLLIDSAPSPTTAAN
Ga0207686_1030802313300025934Miscanthus RhizosphereMAKLFLILMLGGALANGLVASKSEPPLLIDSPTSA
Ga0207711_1040218223300025941Switchgrass RhizosphereVTKLLLILFLGGALVNSLASARAEPPLLIDSQAAPASLDANG
Ga0207661_1156818323300025944Corn RhizosphereVTKLLLIMLFGGALANGVARSQEQPPLLIDSQPSPASLDANS
Ga0207679_1010910623300025945Corn RhizosphereLPAQDCAVTKLLLILLFGGALANGLAAPHSEPPLLIDPAPTSLDAQN
Ga0207667_1013859023300025949Corn RhizosphereVIKLLLILILGGALANGLAPSRSQPPLLIDNLSAPAPLDEAD
Ga0207651_1142350823300025960Switchgrass RhizosphereVTKLLLILLVGGALANSLAARSEPPLLIDTQPAPASLDAAD
Ga0207668_1202102923300025972Switchgrass RhizosphereLPAQHGAVVKLLIILLFGGVLANSLASAQSEPPLLIDSQPAS
Ga0207678_1005120663300026067Corn RhizosphereTKLLLILLASTALAESVAPKAEPPLLIDSQPSQPSLDADR
Ga0207702_1057444223300026078Corn RhizosphereLSAQHGVVTKLLLILLATTAIADSLAPKAEPPLLIDSQPAPASLDADR
Ga0207641_1003557723300026088Switchgrass RhizosphereVTKLLLILILGGALANGIAKSHEQPPLLIESQPSALDEGK
Ga0207683_1177083413300026121Miscanthus RhizosphereSPVRAQHGAMAKLLLILVFGGALATSLASAHSEPPLLIDSQPAPASLDATN
Ga0207698_1073379913300026142Corn RhizosphereLSAQLGAVTKLLLILLASTALAESVAPKAEPPLLIDSQPSQPSLDADR
Ga0209059_107923343300026527SoilVTKLLIILAAFGALASGLAKAQSDPPLLIDSQPAPPS
Ga0209796_1000546523300027766AgaveVTKLLFLLVLGGAIASSIASAQSQPPLLIDSAPSPTSVDANG
Ga0209796_1001454923300027766AgaveLVIVTKLLLILALGGAVASGLSAKSEPPLLIDNTASPTLDAQQ
Ga0209796_1005521123300027766AgaveLQAQHCAVIKLLIILILGGALASGLSAQSQPPLLIDSSPAPASLDANG
Ga0209810_104449823300027773Surface SoilVAKLLLILLFGGALANGLAASHSEPPLLIDSSPAAAHLDAQS
Ga0209177_1026734623300027775Agricultural SoilLAAHKSAVTKLLLILFLVGALANGLAAAHSEPPLLIDPAPASLDAPN
Ga0209481_1047699823300027880Populus RhizosphereMAKLFLILMLGGALANGLAASKSEPPLLIDSPASAVPLDAAH
Ga0268265_1179860113300028380Switchgrass RhizosphereFLILILGGALANGFAASNSEPPLLIDSPVSAAPLDAAN
Ga0170824_12831903223300031231Forest SoilMTKLLLILFLGGALANQVAASHSEPPLLIDTSPSHPLDAGN
Ga0307408_10053786723300031548RhizosphereVTKLLLILLFSGVLANGLVSNAEPPLLIDSAPTALDANN
Ga0307408_10062837223300031548RhizosphereVTKLLIILLFGGALANSLASANSEPPLLIDSQPTPASLDASN
Ga0307405_1001681423300031731RhizosphereVTKLLLILLFSGALANALASNAEPPLLIDSAPTALDANN
Ga0307410_1178931823300031852RhizosphereVTKLLIILLFGGALANSLASASSEPPLLIDSQPAPA
Ga0307406_1008383623300031901RhizosphereVTKLLIILLFGGALANSLASANSEPPLLIDSQPAPASLDASN
Ga0307407_1082876213300031903RhizosphereVTKLLIILLFGGALANSLASASSEPPLLIDSQPAPASLDASN
Ga0307407_1142919723300031903RhizosphereVTKLLIILLFGGALANSLASANSEPPLLIDSQPTPASL
Ga0308175_10002175023300031938SoilVTKLLLILILGGALAHSLVSERSEPPLLIDSQPSPASLDAIN
Ga0308175_10065199123300031938SoilVTKLLIILLFGGALVNSLAKPAEPPLLIDSQPSPTALDANN
Ga0308175_10200823623300031938SoilLPAQHGAVTKLLLVLLFGGALANGLATTHSDPPLLIDPAPPPAAALDAANQ
Ga0308175_10232968513300031938SoilVTKLLIIVALAGALANGLASHKQPPLLIDNSQAPPAP
Ga0308174_1017375213300031939SoilVTKLLLILLASTALAESVAPKAEPPLLIDSQPSQTSLDANR
Ga0308174_1111531423300031939SoilLPAQHSAVAKLLIIICVGGALASGLSAQSQPPLLIDSAPAPAHLDAQP
Ga0308176_1021716923300031996SoilMTKLLLILLASTALAASVAPKAEPPLLIDSQPSQPSLDANR
Ga0308176_1051088013300031996SoilLTAAAQHRAVTKLLLILILGGALAHSLVSERSEPPLLIDSQPSPASLDAIN
Ga0308176_1168917323300031996SoilMVTKLLLILLFGGALANGVARSQEQPPLLIDSQPSPTSLDANS
Ga0308173_1025192623300032074SoilVQDCAVTKLLLILILSGALANGLASAHSEPPLLIDDSPSLDAAN
Ga0308173_1179683323300032074SoilVTKLLLILILGGALANGVAKSHEPPPLLIDSQPSPASLDANG
Ga0308173_1215061223300032074SoilVTKLLLILALSGALASGLGAKSEPPLLIDNSPAPASLDANG
Ga0326721_1013259133300032080SoilKLLIILLFGGALANSLASANSEPPLLIDSQPAPASLDASN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.