Basic Information | |
---|---|
Family ID | F034472 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 174 |
Average Sequence Length | 44 residues |
Representative Sequence | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDIS |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 174 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 99.43 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 74.71 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (43.103 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (18.391 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.379 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.299 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 0.00% Coil/Unstructured: 71.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 174 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 20.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.92 % |
Unclassified | root | N/A | 39.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002274|B570J29581_103554 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 984 | Open in IMG/M |
3300002408|B570J29032_109067620 | Not Available | 583 | Open in IMG/M |
3300002835|B570J40625_100056312 | Not Available | 5478 | Open in IMG/M |
3300002835|B570J40625_100311003 | Not Available | 1589 | Open in IMG/M |
3300002835|B570J40625_100349476 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1466 | Open in IMG/M |
3300003394|JGI25907J50239_1013302 | All Organisms → Viruses → Predicted Viral | 1903 | Open in IMG/M |
3300003430|JGI25921J50272_10079226 | Not Available | 710 | Open in IMG/M |
3300003430|JGI25921J50272_10142463 | Not Available | 501 | Open in IMG/M |
3300003490|JGI25926J51410_1039459 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 850 | Open in IMG/M |
3300003491|JGI25924J51412_1021967 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1106 | Open in IMG/M |
3300004112|Ga0065166_10277311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 680 | Open in IMG/M |
3300005517|Ga0070374_10534948 | Not Available | 583 | Open in IMG/M |
3300005525|Ga0068877_10162385 | All Organisms → Viruses → Predicted Viral | 1359 | Open in IMG/M |
3300005528|Ga0068872_10063068 | All Organisms → Viruses → Predicted Viral | 2286 | Open in IMG/M |
3300005528|Ga0068872_10550184 | Not Available | 615 | Open in IMG/M |
3300005582|Ga0049080_10005861 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4256 | Open in IMG/M |
3300005584|Ga0049082_10072103 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1212 | Open in IMG/M |
3300005662|Ga0078894_10408671 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1226 | Open in IMG/M |
3300005662|Ga0078894_11260458 | Not Available | 623 | Open in IMG/M |
3300005941|Ga0070743_10224308 | Not Available | 614 | Open in IMG/M |
3300007516|Ga0105050_10732956 | Not Available | 567 | Open in IMG/M |
3300007546|Ga0102874_1060701 | Not Available | 1213 | Open in IMG/M |
3300007546|Ga0102874_1153548 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 715 | Open in IMG/M |
3300007550|Ga0102880_1013789 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2219 | Open in IMG/M |
3300007550|Ga0102880_1196091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300007559|Ga0102828_1018488 | All Organisms → Viruses → Predicted Viral | 1496 | Open in IMG/M |
3300007560|Ga0102913_1250756 | Not Available | 566 | Open in IMG/M |
3300007561|Ga0102914_1225160 | Not Available | 575 | Open in IMG/M |
3300007561|Ga0102914_1233469 | Not Available | 564 | Open in IMG/M |
3300007585|Ga0102916_1118216 | Not Available | 712 | Open in IMG/M |
3300007590|Ga0102917_1304952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300007603|Ga0102921_1133973 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 899 | Open in IMG/M |
3300007603|Ga0102921_1189474 | Not Available | 741 | Open in IMG/M |
3300007622|Ga0102863_1107108 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 821 | Open in IMG/M |
3300007630|Ga0102903_1068220 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 990 | Open in IMG/M |
3300007639|Ga0102865_1082983 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 956 | Open in IMG/M |
3300007642|Ga0102876_1109826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300007972|Ga0105745_1043872 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1209 | Open in IMG/M |
3300008052|Ga0102893_1218557 | Not Available | 548 | Open in IMG/M |
3300008106|Ga0114339_1217800 | Not Available | 621 | Open in IMG/M |
3300008107|Ga0114340_1034658 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2291 | Open in IMG/M |
3300008107|Ga0114340_1088606 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1261 | Open in IMG/M |
3300008107|Ga0114340_1130549 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 957 | Open in IMG/M |
3300008108|Ga0114341_10116730 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
3300008108|Ga0114341_10486823 | Not Available | 562 | Open in IMG/M |
3300008110|Ga0114343_1058736 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1454 | Open in IMG/M |
3300008111|Ga0114344_1036361 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2518 | Open in IMG/M |
3300008116|Ga0114350_1121224 | Not Available | 786 | Open in IMG/M |
3300008261|Ga0114336_1013645 | All Organisms → Viruses → Predicted Viral | 4976 | Open in IMG/M |
3300008261|Ga0114336_1171237 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 941 | Open in IMG/M |
3300008261|Ga0114336_1211681 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 805 | Open in IMG/M |
3300008450|Ga0114880_1031134 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2384 | Open in IMG/M |
3300008962|Ga0104242_1083076 | Not Available | 532 | Open in IMG/M |
3300008996|Ga0102831_1101326 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 959 | Open in IMG/M |
3300008996|Ga0102831_1151627 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 769 | Open in IMG/M |
3300009050|Ga0102909_1118955 | Not Available | 638 | Open in IMG/M |
3300009059|Ga0102830_1108890 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 819 | Open in IMG/M |
3300009152|Ga0114980_10061215 | Not Available | 2272 | Open in IMG/M |
3300009159|Ga0114978_10005324 | Not Available | 10292 | Open in IMG/M |
3300009161|Ga0114966_10358433 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 865 | Open in IMG/M |
3300009164|Ga0114975_10106886 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1617 | Open in IMG/M |
3300009184|Ga0114976_10052059 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2412 | Open in IMG/M |
3300010354|Ga0129333_10282373 | Not Available | 1489 | Open in IMG/M |
3300010374|Ga0114986_1019540 | Not Available | 1288 | Open in IMG/M |
3300010388|Ga0136551_1003117 | All Organisms → Viruses → Predicted Viral | 3942 | Open in IMG/M |
3300011009|Ga0129318_10014096 | All Organisms → Viruses → Predicted Viral | 1689 | Open in IMG/M |
3300011268|Ga0151620_1007563 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3952 | Open in IMG/M |
3300011268|Ga0151620_1024634 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2076 | Open in IMG/M |
3300012000|Ga0119951_1037239 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1508 | Open in IMG/M |
3300012000|Ga0119951_1043803 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1331 | Open in IMG/M |
3300012000|Ga0119951_1114752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300013372|Ga0177922_10311445 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 930 | Open in IMG/M |
3300014050|Ga0119952_1015264 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2774 | Open in IMG/M |
3300014819|Ga0119954_1007208 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2732 | Open in IMG/M |
3300014819|Ga0119954_1040496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300017766|Ga0181343_1214292 | Not Available | 525 | Open in IMG/M |
3300020048|Ga0207193_1127771 | All Organisms → Viruses → Predicted Viral | 2208 | Open in IMG/M |
3300020160|Ga0211733_10896833 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1608 | Open in IMG/M |
3300020161|Ga0211726_10003682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2689 | Open in IMG/M |
3300020161|Ga0211726_10360622 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 757 | Open in IMG/M |
3300020162|Ga0211735_11160057 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1297 | Open in IMG/M |
3300020514|Ga0208202_1025313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 676 | Open in IMG/M |
3300020541|Ga0208359_1039729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300020554|Ga0208599_1011458 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1504 | Open in IMG/M |
3300020556|Ga0208486_1004381 | All Organisms → Viruses → Predicted Viral | 2340 | Open in IMG/M |
3300020570|Ga0208465_1037250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 622 | Open in IMG/M |
3300021961|Ga0222714_10403904 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 721 | Open in IMG/M |
3300021962|Ga0222713_10030767 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4330 | Open in IMG/M |
3300021963|Ga0222712_10027623 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4555 | Open in IMG/M |
3300021963|Ga0222712_10047408 | All Organisms → Viruses → Predicted Viral | 3236 | Open in IMG/M |
3300021963|Ga0222712_10075919 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2415 | Open in IMG/M |
3300021963|Ga0222712_10491632 | Not Available | 727 | Open in IMG/M |
3300022752|Ga0214917_10007613 | Not Available | 10900 | Open in IMG/M |
3300023174|Ga0214921_10014579 | Not Available | 9086 | Open in IMG/M |
3300023174|Ga0214921_10058031 | Not Available | 3308 | Open in IMG/M |
3300024289|Ga0255147_1017467 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1521 | Open in IMG/M |
3300024346|Ga0244775_11550358 | Not Available | 505 | Open in IMG/M |
3300024357|Ga0255165_1026857 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1047 | Open in IMG/M |
3300024495|Ga0255164_1005897 | All Organisms → Viruses → Predicted Viral | 2189 | Open in IMG/M |
3300024506|Ga0255168_1075001 | Not Available | 530 | Open in IMG/M |
3300026455|Ga0255155_1079913 | Not Available | 533 | Open in IMG/M |
3300026457|Ga0255160_1025394 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1046 | Open in IMG/M |
3300026566|Ga0256334_1160368 | Not Available | 510 | Open in IMG/M |
3300027121|Ga0255074_1021192 | Not Available | 825 | Open in IMG/M |
3300027125|Ga0255106_1026642 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 822 | Open in IMG/M |
3300027131|Ga0255066_1002640 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3094 | Open in IMG/M |
3300027135|Ga0255073_1046018 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 721 | Open in IMG/M |
3300027216|Ga0208677_1024476 | Not Available | 823 | Open in IMG/M |
3300027217|Ga0208928_1019238 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1109 | Open in IMG/M |
3300027218|Ga0208165_1015729 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1144 | Open in IMG/M |
3300027221|Ga0208557_1011049 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1692 | Open in IMG/M |
3300027223|Ga0208169_1039427 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 887 | Open in IMG/M |
3300027227|Ga0208929_1031355 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1179 | Open in IMG/M |
3300027236|Ga0208026_1055400 | Not Available | 541 | Open in IMG/M |
3300027246|Ga0208931_1003797 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3585 | Open in IMG/M |
3300027261|Ga0208933_1076155 | Not Available | 541 | Open in IMG/M |
3300027301|Ga0255127_1065125 | Not Available | 588 | Open in IMG/M |
3300027380|Ga0208432_1080803 | Not Available | 523 | Open in IMG/M |
3300027387|Ga0208311_1012276 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2152 | Open in IMG/M |
3300027508|Ga0255072_1046050 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 898 | Open in IMG/M |
3300027508|Ga0255072_1093367 | Not Available | 597 | Open in IMG/M |
3300027563|Ga0209552_1075436 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 926 | Open in IMG/M |
3300027601|Ga0255079_1012906 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2007 | Open in IMG/M |
3300027601|Ga0255079_1081701 | Not Available | 650 | Open in IMG/M |
3300027631|Ga0208133_1135083 | Not Available | 571 | Open in IMG/M |
3300027644|Ga0209356_1003890 | Not Available | 5634 | Open in IMG/M |
3300027644|Ga0209356_1091483 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 895 | Open in IMG/M |
3300027707|Ga0209443_1021215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2891 | Open in IMG/M |
3300027710|Ga0209599_10085066 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 830 | Open in IMG/M |
3300027712|Ga0209499_1287988 | Not Available | 558 | Open in IMG/M |
3300027751|Ga0208304_10227530 | Not Available | 666 | Open in IMG/M |
3300027754|Ga0209596_1280199 | Not Available | 671 | Open in IMG/M |
3300027782|Ga0209500_10332953 | Not Available | 632 | Open in IMG/M |
3300027785|Ga0209246_10193338 | Not Available | 796 | Open in IMG/M |
3300027805|Ga0209229_10083911 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1431 | Open in IMG/M |
3300027805|Ga0209229_10140955 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1087 | Open in IMG/M |
3300027805|Ga0209229_10337681 | Not Available | 660 | Open in IMG/M |
3300027892|Ga0209550_10163493 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1568 | Open in IMG/M |
3300027973|Ga0209298_10043931 | Not Available | 2102 | Open in IMG/M |
3300027976|Ga0209702_10365348 | Not Available | 575 | Open in IMG/M |
3300028025|Ga0247723_1002789 | Not Available | 9056 | Open in IMG/M |
3300028025|Ga0247723_1040572 | All Organisms → Viruses → Predicted Viral | 1388 | Open in IMG/M |
3300028025|Ga0247723_1090975 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 785 | Open in IMG/M |
3300028112|Ga0256335_1202261 | Not Available | 514 | Open in IMG/M |
3300031758|Ga0315907_10789505 | Not Available | 710 | Open in IMG/M |
3300031758|Ga0315907_11052019 | Not Available | 583 | Open in IMG/M |
3300031784|Ga0315899_11280893 | Not Available | 629 | Open in IMG/M |
3300031786|Ga0315908_10160890 | Not Available | 1846 | Open in IMG/M |
3300031787|Ga0315900_10183684 | All Organisms → Viruses → Predicted Viral | 1879 | Open in IMG/M |
3300031857|Ga0315909_10176882 | All Organisms → Viruses → Predicted Viral | 1720 | Open in IMG/M |
3300031963|Ga0315901_10010817 | Not Available | 10334 | Open in IMG/M |
3300031963|Ga0315901_10096781 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2737 | Open in IMG/M |
3300031963|Ga0315901_10557683 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 879 | Open in IMG/M |
3300031963|Ga0315901_11133702 | Not Available | 535 | Open in IMG/M |
3300032050|Ga0315906_10047374 | All Organisms → Viruses → Predicted Viral | 4507 | Open in IMG/M |
3300032050|Ga0315906_10371562 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1257 | Open in IMG/M |
3300032050|Ga0315906_11047168 | Not Available | 608 | Open in IMG/M |
3300032092|Ga0315905_11145584 | Not Available | 640 | Open in IMG/M |
3300032116|Ga0315903_10114705 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2543 | Open in IMG/M |
3300032116|Ga0315903_10570710 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 876 | Open in IMG/M |
3300033816|Ga0334980_0060272 | Not Available | 1599 | Open in IMG/M |
3300033978|Ga0334977_0026661 | All Organisms → Viruses → Predicted Viral | 3281 | Open in IMG/M |
3300034018|Ga0334985_0208185 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1286 | Open in IMG/M |
3300034021|Ga0335004_0076774 | All Organisms → Viruses → Predicted Viral | 2282 | Open in IMG/M |
3300034062|Ga0334995_0189347 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1442 | Open in IMG/M |
3300034066|Ga0335019_0043944 | Not Available | 3067 | Open in IMG/M |
3300034082|Ga0335020_0258563 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 860 | Open in IMG/M |
3300034104|Ga0335031_0733851 | Not Available | 562 | Open in IMG/M |
3300034106|Ga0335036_0017501 | Not Available | 5804 | Open in IMG/M |
3300034109|Ga0335051_0256543 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 858 | Open in IMG/M |
3300034109|Ga0335051_0370583 | Not Available | 683 | Open in IMG/M |
3300034112|Ga0335066_0049850 | All Organisms → Viruses → Predicted Viral | 2791 | Open in IMG/M |
3300034272|Ga0335049_0111107 | All Organisms → Viruses → Predicted Viral | 1990 | Open in IMG/M |
3300034272|Ga0335049_0226123 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1300 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 18.39% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.77% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.77% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.20% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.90% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.90% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.17% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.60% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.45% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.72% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.72% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.72% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.15% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.15% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.15% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.15% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.15% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.57% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.57% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.57% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300027216 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027217 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027218 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027221 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027223 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027227 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027236 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027261 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027301 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d | Environmental | Open in IMG/M |
3300027380 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027387 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29581_1035543 | 3300002274 | Freshwater | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFVLAQETYGMGDISSMGF |
B570J29032_1090676202 | 3300002408 | Freshwater | MPNWCYNTLTIQGPKSEVDYIKDRLNAPFTLAQETFGMGDISTM |
B570J40625_1000563121 | 3300002835 | Freshwater | MPNWVYNTLTIQGPKGEIDSIKDRLNKPFTLAIETHGMGDIN |
B570J40625_1003110031 | 3300002835 | Freshwater | MPNWCYNTLTIQGPKAEIDYIKDKLNAPFTLAQETFGMGDISTM |
B570J40625_1003494765 | 3300002835 | Freshwater | MPNWVYNTLTIQGPKDQVDSIKDRLNAPFTLAQETFGMGDIS |
JGI25907J50239_10133026 | 3300003394 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFGMGDINA |
JGI25921J50272_100792263 | 3300003430 | Freshwater Lake | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFVLAQETYGMGDI |
JGI25921J50272_101424632 | 3300003430 | Freshwater Lake | MPNWVYNTLTIQGPKSEVDMIKDRLNRPFTLAMETHGMGDISSMGFPT |
JGI25926J51410_10394591 | 3300003490 | Freshwater Lake | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQENHGMGDINPH |
JGI25924J51412_10219673 | 3300003491 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDYIKDRLNAPFTLAMENHGMGDISSMGFPTK |
Ga0065166_102773112 | 3300004112 | Freshwater Lake | MPNWVYNTLTIQGPKSEVDSIKERLNRPFTLAQETYGMGDIS |
Ga0070374_105349482 | 3300005517 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDYIKDRLNSPFTLAQETYGMGDISTMGFPT |
Ga0068877_101623851 | 3300005525 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDYIKDRLNSPFTLAQET |
Ga0068872_100630687 | 3300005528 | Freshwater Lake | MPNWVYNTLTIQGPKEEIDYIKDRLNRPFTLAQETFGMGDISLSGFPTKIEQVT |
Ga0068872_105501842 | 3300005528 | Freshwater Lake | MPNWVYNTLTIQGPKSEIDYIKDRLNRPFTLAQETFGMGDISLS |
Ga0049080_100058611 | 3300005582 | Freshwater Lentic | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFVLAQETYGMGDISLSGF |
Ga0049082_100721034 | 3300005584 | Freshwater Lentic | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETYGMGD |
Ga0078894_104086714 | 3300005662 | Freshwater Lake | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDIS |
Ga0078894_112604581 | 3300005662 | Freshwater Lake | MPNWCYNTLTIQGPKAEVDMIKDRLNKPFTLAQETYGMGDISSS |
Ga0070743_102243081 | 3300005941 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDI |
Ga0105050_107329561 | 3300007516 | Freshwater | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDI |
Ga0102874_10607013 | 3300007546 | Estuarine | MPNWCYNTLTIQGPKAEVDMIKERLNKPFTLAQETYGMGDISS |
Ga0102874_11535482 | 3300007546 | Estuarine | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISSSGFPTK |
Ga0102880_10137891 | 3300007550 | Estuarine | MPNWVYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDI |
Ga0102880_11960911 | 3300007550 | Estuarine | MPNWCYNTLTIQGPKSEIDSIKERLNRPFTLAQETF |
Ga0102828_10184881 | 3300007559 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISSM |
Ga0102913_12507561 | 3300007560 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQENHGMGDINPNG |
Ga0102914_12251601 | 3300007561 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQENHGMG |
Ga0102914_12334692 | 3300007561 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFGMGDISSSGFPT |
Ga0102916_11182162 | 3300007585 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISTMGFPTK |
Ga0102917_13049521 | 3300007590 | Estuarine | MPNWCYNTLTIQGPKSEIDSIKERLNRPFTLAQETFGMGDISTMGFPT |
Ga0102921_11339731 | 3300007603 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETF |
Ga0102921_11894742 | 3300007603 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGD |
Ga0102863_11071082 | 3300007622 | Estuarine | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDINPN |
Ga0102903_10682201 | 3300007630 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETYGMGDISLSGFPTKIELVE |
Ga0102865_10829833 | 3300007639 | Estuarine | MPNWVYNTLTIQGHKSEVDYIKDRLNTPFTLAQENHGLGDITPHGFP |
Ga0102876_11098263 | 3300007642 | Estuarine | MPNWVYNTLTIQGPKSEIDSIKERLNRPFTLAQET |
Ga0105745_10438724 | 3300007972 | Estuary Water | MPNWCYNTLTIQGPKSEVDYIKDRLNTPFTLAQENHGMGDINPNGFPTK |
Ga0102893_12185571 | 3300008052 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAIETHGMGDIS |
Ga0114339_12178001 | 3300008106 | Freshwater, Plankton | MPNWCYNTLTIQGPKSEVDYIKDRLNSPFTLAQETYGMGDISSSGFPTKIQQVKY |
Ga0114340_10346587 | 3300008107 | Freshwater, Plankton | MPNWVYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFG |
Ga0114340_10886061 | 3300008107 | Freshwater, Plankton | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISTMGFPTKIEQV |
Ga0114340_11305491 | 3300008107 | Freshwater, Plankton | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETYGMGDISSSGFPTKIKLV |
Ga0114341_101167301 | 3300008108 | Freshwater, Plankton | MPNWVYNTLTIQGPKEEIDSIKDRLNKPFTLAQETYGMGDI |
Ga0114341_104868232 | 3300008108 | Freshwater, Plankton | MPNWVYNTLTIQGPKQEIDSIKERLNRPFTLAQETFGMGDISGMGFPTKITQVTY |
Ga0114343_10587366 | 3300008110 | Freshwater, Plankton | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETY |
Ga0114344_10363619 | 3300008111 | Freshwater, Plankton | MPNWCYNTLTIQGPKSEVDYIKDRLNSPFTLAQETYGMGDIS |
Ga0114350_11212243 | 3300008116 | Freshwater, Plankton | MPNWVYNTLTIQGPKEEIDSIKDRLNKPFTLAQETYGMGDISSSGFPT |
Ga0114336_101364512 | 3300008261 | Freshwater, Plankton | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMG |
Ga0114336_11712372 | 3300008261 | Freshwater, Plankton | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISSSGFPTKIKL |
Ga0114336_12116811 | 3300008261 | Freshwater, Plankton | MPNWCYNTLTIQGPKAEVDMIKDRLNTPFTLAQETYGM |
Ga0114880_10311341 | 3300008450 | Freshwater Lake | MPNWVYNTVTIQGPKSEIDYIKDRLNRPFTLAQETFGMGDISLSGFPTKIEQVTYSNP |
Ga0104242_10830762 | 3300008962 | Freshwater | MPNWVYNTLTIQGPKSEIDMIKDRLNAPFTLAQET |
Ga0102831_11013261 | 3300008996 | Estuarine | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAIETHGMGDI |
Ga0102831_11516271 | 3300008996 | Estuarine | MHMPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAIETHGM |
Ga0102909_11189551 | 3300009050 | Estuarine | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAIETHGMGDISSSGF |
Ga0102830_11088901 | 3300009059 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDINANGFPTKI |
Ga0114980_100612151 | 3300009152 | Freshwater Lake | MPNWCYNTLTIQGPKSEIDMIKDRLNKPFTLAQENHG |
Ga0114978_100053241 | 3300009159 | Freshwater Lake | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFGMGDI |
Ga0114966_103584332 | 3300009161 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISTMGFPTKIEQVSY |
Ga0114975_101068866 | 3300009164 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDYIKDRLNTPFTLAQENHGMGDINPHGFPTKIK |
Ga0114976_100520591 | 3300009184 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFGMGDISTMGFPTKI |
Ga0129333_102823731 | 3300010354 | Freshwater To Marine Saline Gradient | MPNWVYNTLTIQGPKQEIDSIKERLNRPFTLAQETFGMGDISGMG |
Ga0114986_10195403 | 3300010374 | Deep Subsurface | MPNWCYNTLTIQGPKAEVDMIKDRLNKPFTLAQET |
Ga0136551_100311710 | 3300010388 | Pond Fresh Water | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISSSGFPTKFEVV |
Ga0129318_100140961 | 3300011009 | Freshwater To Marine Saline Gradient | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISSMGFPTKI |
Ga0151620_10075631 | 3300011268 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNRPFTLAQETHGMG |
Ga0151620_10246346 | 3300011268 | Freshwater | MPNWCYNTLTIQGPKVEVDMIKDRLNAPFTLAQET |
Ga0119951_10372391 | 3300012000 | Freshwater | MPNWVYNTLTIQGPKSEIDMIKDRLNKPFTLAQETYGMGDISTM |
Ga0119951_10438035 | 3300012000 | Freshwater | MPNWVYNTLTIQGPKSEIDMIKDRLNAPFTLAQETFGMGDISTMGFPTKI |
Ga0119951_11147523 | 3300012000 | Freshwater | MPNWVYNTLTIQGPKSEIDMIKDRLNKPFTLAQETYGMGDISSSG |
Ga0177922_103114453 | 3300013372 | Freshwater | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQENHGM |
Ga0119952_10152641 | 3300014050 | Freshwater | MPNWVYNTLTIQGPKSEIDMIKDRLNAPFTLAQETFG |
Ga0119954_10072081 | 3300014819 | Freshwater | MPNWCYNTLTIQGPKSEIDYIKDRLNAPFTLAQETFGM |
Ga0119954_10404961 | 3300014819 | Freshwater | MPNWVYNTLTIQGPKSEIDMIKDRLNAPFTLAQETY |
Ga0181343_12142921 | 3300017766 | Freshwater Lake | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDINTHGFPTKIKEVTY |
Ga0207193_11277716 | 3300020048 | Freshwater Lake Sediment | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFGMGDISTMGFPTKIE |
Ga0211733_108968336 | 3300020160 | Freshwater | MPNWVYNTLTIQGPKSEVDYIKDRLNKPFTLAQENH |
Ga0211726_100036828 | 3300020161 | Freshwater | MPNWVYNTLTIQGPKSEVDYIKDRLNAPFTLAQETHGMGD |
Ga0211726_103606221 | 3300020161 | Freshwater | MPNWCYNTLTIQGPKVEVDMIKDRLNKPFTLAQENHGM |
Ga0211735_111600571 | 3300020162 | Freshwater | MPNWCYNTLTIQGPKSEVDYIKDRLNAPFTLAQEDHGMGDINAHGFPTKIKVVE |
Ga0208202_10253133 | 3300020514 | Freshwater | MPNWCYNTLTIQGPKAEIDYIKDKLNAPFTLAQETFGMG |
Ga0208359_10397294 | 3300020541 | Freshwater | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISSSGFP |
Ga0208599_10114581 | 3300020554 | Freshwater | MPNWVYNTLTIQGPKGEIDSIKDRLNKPFTLAIETHGMGDINPNGF |
Ga0208486_10043817 | 3300020556 | Freshwater | MPNWVYNTLTIQGPKGEIDSIKDRLNKPFTLAIETHGMGDINANG |
Ga0208465_10372501 | 3300020570 | Freshwater | MPNWCYNTLTIQGPKAEIDYIKDKLNAPFTLAQETFGMGDISTMGFPTKIEQV |
Ga0222714_104039041 | 3300021961 | Estuarine Water | MPNWVYNTLTIQGPKEEIDYIKDRLNSPFTLAQETFGMGDISSSGFP |
Ga0222713_1003076711 | 3300021962 | Estuarine Water | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETYGMGDISLSGF |
Ga0222712_100276231 | 3300021963 | Estuarine Water | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETYGMGDISLSGFPTKIEQV |
Ga0222712_100474088 | 3300021963 | Estuarine Water | MPNWCYNTLTIQGPKSEVDYIKDRLNSPFTLAQETYGMGDISSSG |
Ga0222712_100759191 | 3300021963 | Estuarine Water | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQET |
Ga0222712_104916323 | 3300021963 | Estuarine Water | MPNWVYNTLTIQGPKDQVDSIKDRLGKPFTISVETHGMGDISANGFPMKSKQVTYS |
Ga0214917_100076131 | 3300022752 | Freshwater | MPNWVYNTVTIQGPKEEIDYIKDRLNRPFTLAQETYGMGDISLSGFPTKIQ |
Ga0214921_100145791 | 3300023174 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETF |
Ga0214921_100580319 | 3300023174 | Freshwater | MPNWVYNTLTIQGPKDEIDMIKDRLNRPFTLAQETF |
Ga0255147_10174671 | 3300024289 | Freshwater | MPNWVYNTLTIQGPKEEIDMIKDRLNRPFTLAQETFG |
Ga0244775_115503581 | 3300024346 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDI |
Ga0255165_10268571 | 3300024357 | Freshwater | MPNWVYNTVTIQGPKSEIDYIKDRLNRPFTLAQETFGMGDISLS |
Ga0255164_10058971 | 3300024495 | Freshwater | MPNWVYNTVTIQGPKSEIDYIKDRLNRPFTLAQETFGMGDISLSGFPTKIE |
Ga0255168_10750011 | 3300024506 | Freshwater | MPNWVYNTVTIQGPKEEIDYIKDRLNRPFTLAQETFG |
Ga0255155_10799132 | 3300026455 | Freshwater | MPNWVYNTVTIQGPKQEIDYIKDRLNRPFTLAQETFGM |
Ga0255160_10253943 | 3300026457 | Freshwater | MPNWVYNTVTIQGPKEEIDYIKDRLNRPFTLAQETYGMGDISLSGFPTKIEQV |
Ga0256334_11603681 | 3300026566 | Freshwater | MPNWVYNTLTIQGPKSEIDMIKDRLNKPFTLAQETFGMGDISSS |
Ga0255074_10211922 | 3300027121 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISTMGFPTKI |
Ga0255106_10266421 | 3300027125 | Freshwater | MPNWCYNTLTIQGPKSEVDYIKDRLNAPFTLAQETHGMGDISTMGFPTKIKLVEY |
Ga0255066_10026401 | 3300027131 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISLSG |
Ga0255073_10460181 | 3300027135 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKSFTLAQENHGMGDINAN |
Ga0208677_10244761 | 3300027216 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISTMGFP |
Ga0208928_10192381 | 3300027217 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISTM |
Ga0208165_10157291 | 3300027218 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISSS |
Ga0208557_10110491 | 3300027221 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGM |
Ga0208169_10394272 | 3300027223 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISSSGFPTK |
Ga0208929_10313551 | 3300027227 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISS |
Ga0208026_10554002 | 3300027236 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISSSGFPTKI |
Ga0208931_10037971 | 3300027246 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISSSGFPT |
Ga0208933_10761551 | 3300027261 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISLSGFPTK |
Ga0255127_10651251 | 3300027301 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNSPFTLAQETYGM |
Ga0208432_10808031 | 3300027380 | Deep Subsurface | MPNWCYNTLTIQGPKSEVDYIKDRLNKPFTLAQETFGMGDI |
Ga0208311_10122761 | 3300027387 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISSSGF |
Ga0255072_10460502 | 3300027508 | Freshwater | MPNWVYNTLTIQGPKSEVDYIKDKLNAPFTLAQETHGMGDINPNGFP |
Ga0255072_10933671 | 3300027508 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDIS |
Ga0209552_10754361 | 3300027563 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDINANGFP |
Ga0255079_10129066 | 3300027601 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQET |
Ga0255079_10817011 | 3300027601 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKSFTLAQENHGMGDIN |
Ga0208133_11350832 | 3300027631 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETYGMGDIS |
Ga0209356_100389018 | 3300027644 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFVLAQETFGMG |
Ga0209356_10914831 | 3300027644 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDINPNGF |
Ga0209443_10212151 | 3300027707 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDINANG |
Ga0209599_100850662 | 3300027710 | Deep Subsurface | MPNWVYNTLTIQGPKEQVDSIKDRLNAPFTLAQETFGMGDIS |
Ga0209499_12879883 | 3300027712 | Freshwater Lake | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFGMG |
Ga0208304_102275302 | 3300027751 | Estuarine | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQENHGMGDINPNGFPTKIKE |
Ga0209596_12801992 | 3300027754 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGD |
Ga0209500_103329531 | 3300027782 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFGMGDIST |
Ga0209246_101933382 | 3300027785 | Freshwater Lake | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAIETHGMGDINAN |
Ga0209229_100839111 | 3300027805 | Freshwater And Sediment | MPNWCYNTLTIQGPKEEIDSIKERLNRPFTLAQETFGMGDISS |
Ga0209229_101409553 | 3300027805 | Freshwater And Sediment | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDI |
Ga0209229_103376811 | 3300027805 | Freshwater And Sediment | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISLSGFP |
Ga0209550_101634936 | 3300027892 | Freshwater Lake | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQENHGMGDINPHGFPTKIKLVE |
Ga0209298_100439316 | 3300027973 | Freshwater Lake | MPNWCYNTLTIQGPKSEIDMIKDRLNKPFTLAQENHGMGDITPHGFP |
Ga0209702_103653483 | 3300027976 | Freshwater | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDIS |
Ga0247723_10027891 | 3300028025 | Deep Subsurface Sediment | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFVLAQETYGMGDI |
Ga0247723_10405725 | 3300028025 | Deep Subsurface Sediment | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDI |
Ga0247723_10909752 | 3300028025 | Deep Subsurface Sediment | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGM |
Ga0256335_12022611 | 3300028112 | Freshwater | MPNWVYNTVTIQGPKSEIDYIKDRLNRPFTLAQETFGMGDISLSGF |
Ga0315907_107895051 | 3300031758 | Freshwater | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFVLAQETYGMGDIS |
Ga0315907_110520193 | 3300031758 | Freshwater | MPNWCYNTLTIQGPKSEIDMIKDRLNRPFTLAQENHGMGDITPNGFPT |
Ga0315899_112808932 | 3300031784 | Freshwater | MPNWVYNTLTIQGPKSEIDYIKDRLNRPFTLAQETFGMGDISLSGFPTKI |
Ga0315908_101608906 | 3300031786 | Freshwater | MPNWVYNTLTIQGPKSEIDSIKDRLNKPFTLAQETFGM |
Ga0315900_101836846 | 3300031787 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNSPFTLAQETYGMGDISTMGF |
Ga0315909_101768821 | 3300031857 | Freshwater | MPNWVYNTLTIQGPKEEIDSIKERLNRPFTLAQETFGMGDISSSGFPTKITQVT |
Ga0315901_1001081733 | 3300031963 | Freshwater | MPNWCYNTLTIQGPKEEIDSIKDRLNRPFTLAQETYGM |
Ga0315901_100967818 | 3300031963 | Freshwater | MPNWCYNTLTIQGPKAEVDMIKDRLNKPFTLAQETYGMGDISSSGFPTKIQQ |
Ga0315901_105576832 | 3300031963 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISTMG |
Ga0315901_111337021 | 3300031963 | Freshwater | MPNWVYNTLTIQGPKGEIDSIKDRLNKPFTLAIETHGMGDINPNGFPTKFK |
Ga0315906_100473741 | 3300032050 | Freshwater | MPNWCYNTLTIQGPKSEIDYIKDRLNSPFTLAQETFGMGDINAHG |
Ga0315906_103715621 | 3300032050 | Freshwater | MPNWVYNTLTIQGPKAEIDSIKDRLNKPFTLAIETHGMG |
Ga0315906_110471681 | 3300032050 | Freshwater | MPNWCYNTLTIQGPKAEVDMIKDRLNKPFTLAQETYGMGDISTMGFPT |
Ga0315905_111455842 | 3300032092 | Freshwater | MPNWCYNTLTIQGPKSEIDYIKDRLNAPFTLAQETYGMGDI |
Ga0315903_101147051 | 3300032116 | Freshwater | MPNWVYNTVTIQGPKEEIDYIKDRLNRPFTLAQETFGMGDISLSGFP |
Ga0315903_105707102 | 3300032116 | Freshwater | MPNWVYNTVTIQGPKSEIDYIKDRLNRPFTLAQETYGMGDISTMGFPTKIE |
Ga0334980_0060272_3_128 | 3300033816 | Freshwater | MPNWCYNTLTIQGPKAEIDYIKDKLNAPFTLAQETFGMGDIS |
Ga0334977_0026661_3165_3281 | 3300033978 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFGMG |
Ga0334985_0208185_3_149 | 3300034018 | Freshwater | MPNWCYNTLTIQGPKDEIDSIKERLNRPFTLAQETYGMGDINAHGFPTK |
Ga0335004_0076774_2147_2281 | 3300034021 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETHGMGDINAHG |
Ga0334995_0189347_1311_1442 | 3300034062 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFGMGDISTM |
Ga0335019_0043944_2_133 | 3300034066 | Freshwater | MPNWCYNTLTIQGPKSEVDYIKDKLNAPFTLAQETFGMGDISTM |
Ga0335020_0258563_745_858 | 3300034082 | Freshwater | MPNWVYNTLTIQGPKEQVDSIKDRLNAPFTLAQETFGM |
Ga0335031_0733851_3_167 | 3300034104 | Freshwater | MPNWVYNTLTIQGPKDEVDSIKERLNRPFTLAQETFGMGDISLMGFPTKIEQVTY |
Ga0335036_0017501_2_112 | 3300034106 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETFG |
Ga0335051_0256543_3_143 | 3300034109 | Freshwater | MPNWVYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISSMGFP |
Ga0335051_0370583_1_111 | 3300034109 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYG |
Ga0335066_0049850_2_139 | 3300034112 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISTMGF |
Ga0335049_0111107_3_164 | 3300034272 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNAPFTLAQETFGMGDISTMGFPTKIEQVS |
Ga0335049_0226123_2_133 | 3300034272 | Freshwater | MPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDISSM |
⦗Top⦘ |