NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034370

Metagenome / Metatranscriptome Family F034370

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034370
Family Type Metagenome / Metatranscriptome
Number of Sequences 175
Average Sequence Length 42 residues
Representative Sequence ARALFQDNPLAAFEGRPLPHVPEVEDEWPPPRRKRFFFF
Number of Associated Samples 144
Number of Associated Scaffolds 175

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.57 %
% of genes near scaffold ends (potentially truncated) 98.29 %
% of genes from short scaffolds (< 2000 bps) 89.71 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.143 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(24.000 % of family members)
Environment Ontology (ENVO) Unclassified
(29.714 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.857 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.93%    β-sheet: 0.00%    Coil/Unstructured: 85.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 175 Family Scaffolds
PF02698DUF218 64.00
PF01370Epimerase 12.57
PF16363GDP_Man_Dehyd 4.00
PF03721UDPG_MGDP_dh_N 2.29
PF02687FtsX 1.14
PF03720UDPG_MGDP_dh_C 1.14
PF12704MacB_PCD 1.14
PF11412DsbC 0.57
PF01841Transglut_core 0.57
PF02350Epimerase_2 0.57
PF01740STAS 0.57
PF00953Glycos_transf_4 0.57
PF01491Frataxin_Cyay 0.57
PF01258zf-dskA_traR 0.57
PF00486Trans_reg_C 0.57
PF07883Cupin_2 0.57
PF13414TPR_11 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 175 Family Scaffolds
COG1434Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 familyCell wall/membrane/envelope biogenesis [M] 64.00
COG2949Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycinCell wall/membrane/envelope biogenesis [M] 64.00
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 2.29
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 2.29
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 2.29
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 2.29
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 2.29
COG0381UDP-N-acetylglucosamine 2-epimeraseCell wall/membrane/envelope biogenesis [M] 0.57
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 0.57
COG0707UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferaseCell wall/membrane/envelope biogenesis [M] 0.57
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 0.57
COG1965Fe-S cluster assembly protein CyaY, frataxin homologInorganic ion transport and metabolism [P] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.14 %
UnclassifiedrootN/A6.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002916|JGI25389J43894_1048687All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300002917|JGI25616J43925_10369322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300004080|Ga0062385_10659448All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300004092|Ga0062389_103190476All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300004092|Ga0062389_104380566All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300004635|Ga0062388_101776831All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005166|Ga0066674_10553896All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005167|Ga0066672_10025251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3173Open in IMG/M
3300005167|Ga0066672_10752212All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300005176|Ga0066679_11048631All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005446|Ga0066686_10037629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2878Open in IMG/M
3300005536|Ga0070697_100655801All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300005537|Ga0070730_10568985Not Available725Open in IMG/M
3300005553|Ga0066695_10420197All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300005554|Ga0066661_10207322All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300005556|Ga0066707_10035883All Organisms → cellular organisms → Bacteria → Acidobacteria2786Open in IMG/M
3300005568|Ga0066703_10181456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1273Open in IMG/M
3300005569|Ga0066705_10420419All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium837Open in IMG/M
3300005591|Ga0070761_11035763All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300005602|Ga0070762_10196033All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300005602|Ga0070762_10396654All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300005602|Ga0070762_10968372Not Available582Open in IMG/M
3300005764|Ga0066903_100864301All Organisms → cellular organisms → Bacteria → Acidobacteria1630Open in IMG/M
3300006031|Ga0066651_10760210All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300006163|Ga0070715_10237342All Organisms → cellular organisms → Bacteria → Acidobacteria946Open in IMG/M
3300006174|Ga0075014_100686698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae594Open in IMG/M
3300006804|Ga0079221_10117042All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300006804|Ga0079221_11304100All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300006871|Ga0075434_101835136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300006914|Ga0075436_100796947All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300006914|Ga0075436_101074816All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300007265|Ga0099794_10590561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300009038|Ga0099829_10156893All Organisms → cellular organisms → Bacteria1820Open in IMG/M
3300009088|Ga0099830_11244945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300009088|Ga0099830_11467040All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300009089|Ga0099828_10476518All Organisms → cellular organisms → Bacteria → Acidobacteria1126Open in IMG/M
3300009090|Ga0099827_10886648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium773Open in IMG/M
3300009137|Ga0066709_100907461All Organisms → cellular organisms → Bacteria → Acidobacteria1284Open in IMG/M
3300009698|Ga0116216_10327071All Organisms → cellular organisms → Bacteria → Acidobacteria933Open in IMG/M
3300010343|Ga0074044_10606312All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300010343|Ga0074044_11029045All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300010343|Ga0074044_11046893All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300010358|Ga0126370_10338037All Organisms → cellular organisms → Bacteria → Acidobacteria1211Open in IMG/M
3300010358|Ga0126370_11276691All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300010359|Ga0126376_10556358All Organisms → cellular organisms → Bacteria → Acidobacteria1075Open in IMG/M
3300010360|Ga0126372_12341314Not Available584Open in IMG/M
3300010379|Ga0136449_103328543All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300011269|Ga0137392_10029083All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3986Open in IMG/M
3300011269|Ga0137392_11594531All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300011270|Ga0137391_10156285All Organisms → cellular organisms → Bacteria → Acidobacteria1987Open in IMG/M
3300011271|Ga0137393_11577635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300012096|Ga0137389_10022465All Organisms → cellular organisms → Bacteria → Acidobacteria4458Open in IMG/M
3300012096|Ga0137389_10080372All Organisms → cellular organisms → Bacteria → Acidobacteria2545Open in IMG/M
3300012096|Ga0137389_10627115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300012202|Ga0137363_10613939All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium918Open in IMG/M
3300012203|Ga0137399_10301119All Organisms → cellular organisms → Bacteria → Acidobacteria1324Open in IMG/M
3300012205|Ga0137362_11144363All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300012206|Ga0137380_10001047All Organisms → cellular organisms → Bacteria21954Open in IMG/M
3300012206|Ga0137380_10640927All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium926Open in IMG/M
3300012208|Ga0137376_10471440All Organisms → cellular organisms → Bacteria → Acidobacteria1090Open in IMG/M
3300012209|Ga0137379_10973172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300012356|Ga0137371_10882530All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300012363|Ga0137390_10498121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1192Open in IMG/M
3300012363|Ga0137390_11062004All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300012917|Ga0137395_10235864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1282Open in IMG/M
3300012917|Ga0137395_10678537All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300012918|Ga0137396_10806356All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300012924|Ga0137413_10643802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300012925|Ga0137419_10090547All Organisms → cellular organisms → Bacteria → Acidobacteria2093Open in IMG/M
3300012925|Ga0137419_10952999All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012925|Ga0137419_11795912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300012972|Ga0134077_10083746All Organisms → cellular organisms → Bacteria → Acidobacteria1217Open in IMG/M
3300014654|Ga0181525_10132336All Organisms → cellular organisms → Bacteria → Acidobacteria1371Open in IMG/M
3300015053|Ga0137405_1264392All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1356Open in IMG/M
3300015054|Ga0137420_1363256All Organisms → cellular organisms → Bacteria2019Open in IMG/M
3300015241|Ga0137418_10098303All Organisms → cellular organisms → Bacteria → Acidobacteria2636Open in IMG/M
3300015242|Ga0137412_10615683All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300016294|Ga0182041_11716214All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300016319|Ga0182033_10333816All Organisms → cellular organisms → Bacteria → Acidobacteria1262Open in IMG/M
3300016341|Ga0182035_11276842All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300016445|Ga0182038_10451244All Organisms → cellular organisms → Bacteria → Acidobacteria1088Open in IMG/M
3300017926|Ga0187807_1253812Not Available577Open in IMG/M
3300017966|Ga0187776_10149288All Organisms → cellular organisms → Bacteria → Acidobacteria1436Open in IMG/M
3300017999|Ga0187767_10085405Not Available852Open in IMG/M
3300018012|Ga0187810_10446120Not Available548Open in IMG/M
3300018433|Ga0066667_11963934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300018468|Ga0066662_10184459All Organisms → cellular organisms → Bacteria → Acidobacteria1628Open in IMG/M
3300019882|Ga0193713_1019188All Organisms → cellular organisms → Bacteria2034Open in IMG/M
3300019888|Ga0193751_1008161All Organisms → cellular organisms → Bacteria5643Open in IMG/M
3300020199|Ga0179592_10248976All Organisms → cellular organisms → Bacteria → Acidobacteria798Open in IMG/M
3300020579|Ga0210407_10046138All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3248Open in IMG/M
3300020579|Ga0210407_10379959All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300020580|Ga0210403_10745442All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300020580|Ga0210403_10885589All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300020580|Ga0210403_11451471All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300020581|Ga0210399_10726840All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300020583|Ga0210401_11509022All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300021046|Ga0215015_10514276All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300021086|Ga0179596_10230712All Organisms → cellular organisms → Bacteria → Acidobacteria909Open in IMG/M
3300021086|Ga0179596_10484935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300021168|Ga0210406_10158114All Organisms → cellular organisms → Bacteria → Acidobacteria1900Open in IMG/M
3300021168|Ga0210406_10702307Not Available779Open in IMG/M
3300021170|Ga0210400_10319807All Organisms → cellular organisms → Bacteria → Acidobacteria1275Open in IMG/M
3300021170|Ga0210400_10373229All Organisms → cellular organisms → Bacteria → Acidobacteria1176Open in IMG/M
3300021401|Ga0210393_10015197All Organisms → cellular organisms → Bacteria5954Open in IMG/M
3300021401|Ga0210393_10659952All Organisms → cellular organisms → Bacteria → Acidobacteria853Open in IMG/M
3300021405|Ga0210387_10272546Not Available1484Open in IMG/M
3300021433|Ga0210391_11348594All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300021475|Ga0210392_11110469All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300021476|Ga0187846_10450764Not Available527Open in IMG/M
3300021477|Ga0210398_11467431All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300021477|Ga0210398_11505948All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300021478|Ga0210402_11484894All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300021559|Ga0210409_10998859All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300024251|Ga0247679_1057280Not Available653Open in IMG/M
3300024331|Ga0247668_1019947All Organisms → cellular organisms → Bacteria → Acidobacteria1386Open in IMG/M
3300025898|Ga0207692_11002773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300025905|Ga0207685_10238560All Organisms → cellular organisms → Bacteria → Acidobacteria873Open in IMG/M
3300025929|Ga0207664_10467142All Organisms → cellular organisms → Bacteria → Acidobacteria1127Open in IMG/M
3300026035|Ga0207703_12257873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300026281|Ga0209863_10027866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_51718Open in IMG/M
3300026333|Ga0209158_1172688All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300026359|Ga0257163_1004357All Organisms → cellular organisms → Bacteria → Acidobacteria1981Open in IMG/M
3300026530|Ga0209807_1198114All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300027313|Ga0207780_1051148All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300027587|Ga0209220_1107222All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300027635|Ga0209625_1101123All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300027643|Ga0209076_1042006All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1289Open in IMG/M
3300027671|Ga0209588_1270006All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300027678|Ga0209011_1102210All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300027698|Ga0209446_1083107All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300027725|Ga0209178_1176881All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300027737|Ga0209038_10138017All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300027783|Ga0209448_10040128All Organisms → cellular organisms → Bacteria → Acidobacteria1573Open in IMG/M
3300027842|Ga0209580_10209271All Organisms → cellular organisms → Bacteria → Acidobacteria968Open in IMG/M
3300027853|Ga0209274_10686048All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300027857|Ga0209166_10000852All Organisms → cellular organisms → Bacteria28747Open in IMG/M
3300027862|Ga0209701_10305265All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium913Open in IMG/M
3300027882|Ga0209590_10601415All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300027911|Ga0209698_10481900All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300028023|Ga0265357_1006420All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300028381|Ga0268264_11033290All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300028906|Ga0308309_10022359All Organisms → cellular organisms → Bacteria4197Open in IMG/M
3300029636|Ga0222749_10765484All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300029882|Ga0311368_11010039All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300030841|Ga0075384_11177253All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300030916|Ga0075386_11495210All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300030991|Ga0073994_12267141All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300030991|Ga0073994_12311596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1219Open in IMG/M
3300030991|Ga0073994_12373932All Organisms → cellular organisms → Bacteria → Acidobacteria843Open in IMG/M
3300031057|Ga0170834_100406084All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300031128|Ga0170823_17125244All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300031715|Ga0307476_11206279All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300031720|Ga0307469_12305713All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300031740|Ga0307468_100486077All Organisms → cellular organisms → Bacteria → Acidobacteria974Open in IMG/M
3300031753|Ga0307477_11128773All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300031819|Ga0318568_10667746All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300031831|Ga0318564_10326326All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300031896|Ga0318551_10551919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300031896|Ga0318551_10809213All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300031897|Ga0318520_10220579All Organisms → cellular organisms → Bacteria → Acidobacteria1124Open in IMG/M
3300031910|Ga0306923_10407191All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300031954|Ga0306926_12346181Not Available590Open in IMG/M
3300031962|Ga0307479_10233715All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1813Open in IMG/M
3300031962|Ga0307479_11021378All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300031962|Ga0307479_11704078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300032025|Ga0318507_10282793All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300032059|Ga0318533_11293818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300032076|Ga0306924_10166907All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2524Open in IMG/M
3300032180|Ga0307471_100265304All Organisms → cellular organisms → Bacteria → Acidobacteria1781Open in IMG/M
3300032205|Ga0307472_101589470All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300032805|Ga0335078_10462330All Organisms → cellular organisms → Bacteria → Acidobacteria1643Open in IMG/M
3300032892|Ga0335081_10738672All Organisms → cellular organisms → Bacteria → Acidobacteria1187Open in IMG/M
3300032954|Ga0335083_10519761All Organisms → cellular organisms → Bacteria → Acidobacteria993Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil24.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.43%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.14%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.71%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.71%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.14%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.14%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.14%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.14%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.14%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.14%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.57%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.57%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.57%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.57%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026359Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-AEnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25389J43894_104868723300002916Grasslands SoilKARALFQDNPLAAFEGRPLPHIPEIEDESPPPRRKRFFFF*
JGI25616J43925_1036932213300002917Grasslands SoilKFGAEKARALFVENPLAAFEGQPLPHVPEIVEPPPRKKRFFFF*
Ga0062385_1065944813300004080Bog Forest SoilARALFLENPMAAFEGRELPHVPQLPDEIDPPRRKRFFFF*
Ga0062389_10319047623300004092Bog Forest SoilFGKEKAEALFEENPLAAFEGQELPHVPEIPDESDEPRKKKFFFF*
Ga0062389_10438056623300004092Bog Forest SoilFGEEKARALFVENPMAAFEGRDLPHVPEVRDEIEIPRRKRFFFF*
Ga0062388_10177683123300004635Bog Forest SoilYDAVEAQFGKEKAEALFKENPLAAFEGQQLPHVPEVLDESNEPRKKRFFFF*
Ga0066674_1055389613300005166SoilEKARALFHDNPLAAFEGQPLPHVPEIEDALRPRRKRFFFF*
Ga0066672_1002525143300005167SoilRFGEEKARAPFQENPGAAFEGRELPHIPEVEEVWPSRRKRFFSL*
Ga0066672_1075221213300005167SoilEEKARSLFVENPGAAFEGRDLPHVPEVEEAVAPQRRKRFFFF*
Ga0066679_1104863123300005176SoilEKVAHRFGEEKARALFQENPQAAFEGRDLPHIPELPEGAAPRRRKRFFFF*
Ga0066686_1003762913300005446SoilDRFGQEKARALFQDNPLAAFEGRELPHVPEVEDELPPPRRKRFFFF*
Ga0070697_10065580113300005536Corn, Switchgrass And Miscanthus RhizosphereHDVVAEQFGDEKARALFFDNPMAAFEGRDLPHVPEIPDDKVSSRRKRFLFF*
Ga0070730_1056898523300005537Surface SoilVENPLAAFEGRALPYTPEVADERPVKRRKRFFFF*
Ga0066695_1042019713300005553SoilVVHQFGEEKARALFQDNPLAAFEGRGLPHIPEIEDELPPPRRKRFFFF*
Ga0066661_1020732233300005554SoilARALFQDNPLAAFEGRPLPHIPEVEDELPSPRRKRFFFF*
Ga0066707_1003588343300005556SoilMAQALFVDNPLAAIEGRNLPFVPKVADERPTKPRKRFFFF*
Ga0066703_1018145613300005568SoilALFVTNPLAAFEGRPLPHVPEIVEEQAKKKWFLFF*
Ga0066705_1042041913300005569SoilALFQDNPLAAFEGRPLPHIPEVEDELPSPRRKRFFFF*
Ga0070761_1103576313300005591SoilRALFVENPMAAFEGRELPHVPQPPDEIEPPRRKRFFFF*
Ga0070762_1019603333300005602SoilAVREQFGEEKAQALFVENPMAAFEGRDLPHVPRLPDVFKVPRRKRFFFF*
Ga0070762_1039665413300005602SoilEENALALFVDNPLAAFEGRELPHVPELRDGIDPPRRKRFFFF*
Ga0070762_1096837213300005602SoilALFFDNPMAAFEGRELPHVPEVAPDRKPGQKRKRFWFF*
Ga0066903_10086430133300005764Tropical Forest SoilKAEALFVENPLAVLEGRALPHLPEIVEEQAKKKRFLFF*
Ga0066651_1076021023300006031SoilLFHDNPLAAFEGRPLPHVPEIEDVLPPRRKRFFFF*
Ga0070715_1023734213300006163Corn, Switchgrass And Miscanthus RhizosphereETAQALFVDNPLAAFEGRNLPYVPEVADKRPAKPRKRFFFF*
Ga0075014_10068669823300006174WatershedsDRFGQEKARALFQDNPLAAFEGRELPHVPELEDETPPPRRKRFFFF*
Ga0079221_1011704213300006804Agricultural SoilVENPRAAFEGRDLPHVPEVEEPVAQPRRKRFFFF*
Ga0079221_1130410023300006804Agricultural SoilALFVENPGAAFEGRDLPHVPEVEEPVAARRRKRFFFF*
Ga0075434_10183513623300006871Populus RhizosphereQEKAEALFVENPLAAFEGRGLPHVPEVDGAELKRKKRFLFF*
Ga0075436_10079694713300006914Populus RhizosphereALFVENPLAAFEGRGLPHVPEISGVELKRKKRFLFF*
Ga0075436_10107481613300006914Populus RhizosphereQGLFVDNPLAAFEGRTLPYVPEVTDELPTKRRKRFFFF*
Ga0099794_1059056123300007265Vadose Zone SoilARSLFLDNPLAAFEGRELPHVPEIQETPPRKRKRFFFF*
Ga0099829_1015689333300009038Vadose Zone SoilEMVVDQFGEEKARALFLDNPLAAYEGQKLPHVPEVDDDTPPHRKRFFFF*
Ga0099830_1124494523300009088Vadose Zone SoilQEKARALFQDNPLAAFEGRELPHVPEVEDELPPPRRKRFFFF*
Ga0099830_1146704023300009088Vadose Zone SoilRALFQDNPLAAFEGRPLPHVPEVEAELAPPRRKRFFFF*
Ga0099828_1047651833300009089Vadose Zone SoilVREQFGEKKARALFVENPMAAFEGRDLPHVPEIPDEQISPRRKRFFFF*
Ga0099827_1088664813300009090Vadose Zone SoilVVVDRFGQEKAHALFRDNPLAAFEGRQLPHVPEVDELPPPRRKRFFFF*
Ga0066709_10090746123300009137Grasslands SoilAHPLFVDNPLAALEGRNLPFVPKVADERPTKPRKRFFFF*
Ga0116216_1032707113300009698Peatlands SoilQENPFAAFEGRELPHVPELEDESPPPRRKRFFFF*
Ga0074044_1060631213300010343Bog Forest SoilMRGRPLRLQPAFDLVREEYGAEMARGLFVENPMAAFEGRELPYVPQPPEEKDLPRRKRFFFF*
Ga0074044_1102904513300010343Bog Forest SoilALFVENPLAAFEGRDLPHVPELQDEIEVPRRKRFFFF*
Ga0074044_1104689313300010343Bog Forest SoilGKEKAEALFVENPLAAFEGQELPHVPEVASESSEPRKKRFFFF*
Ga0126370_1033803713300010358Tropical Forest SoilRLQTAFDVVADRYGVETARALFVENPGAAFEGRELPHVPDVADAIAQPRRKRFLFF*
Ga0126370_1127669113300010358Tropical Forest SoilAYDLVADRYSWETARALFVENPGAAFEGRDLPYVPDVEEPVAPRRRKRFFFF*
Ga0126376_1055635813300010359Tropical Forest SoilFGAVKADALFMENPLAAFEGQPLPYVPEIQDEHPKKKRFIFF*
Ga0126372_1234131413300010360Tropical Forest SoilTAKALFVINPLAAFEGRALPYVPEVADEHPSKRRKRFFFF*
Ga0136449_10332854323300010379Peatlands SoilGEEKARALFVENPRAAFEGWDLPHVPQLPDEFPMPRRKRFFFF*
Ga0137392_1002908373300011269Vadose Zone SoilARALFQDNPLAAFEGRPLPHVPEVEDEWPPPRRKRFFFF*
Ga0137392_1159453113300011269Vadose Zone SoilARALFQDNPLAAFEGRELPHVPEVKDELPPRRKRFFFF*
Ga0137391_1015628513300011270Vadose Zone SoilKQFGEEKARALFTDNPLAAFEGRDLPHVPEIPDERVPPRRKRFLFF*
Ga0137393_1157763513300011271Vadose Zone SoilFVENPRAAFEGRDLPHIPEVEEATAPPGRKRFFFF*
Ga0137389_1002246513300012096Vadose Zone SoilFQDNPLAAFEGRQLPHIPEVEDELPRPRRKHFFFF*
Ga0137389_1008037243300012096Vadose Zone SoilEQFGDEKARDLFLENPLAAFEGRDLPYVPEIPDAKISPRRRRFFFF*
Ga0137389_1062711523300012096Vadose Zone SoilCLQPAYDAVVDRFGQEKARALFQDNPLSAFEGRELPHVPEVEDELPPRRKRFFFF*
Ga0137388_1145616113300012189Vadose Zone SoilRPLRLQSAFDVVAGQFGQEKARALFLDNPLAAYEGRELPHVPEFEVSPPRKKRFFFF*
Ga0137363_1061393923300012202Vadose Zone SoilARALFHDNPLAAFEGRELPHVPEVEDELPLPRRKRFFFF*
Ga0137399_1030111913300012203Vadose Zone SoilRALFLDNPLAAFDGGELPHVPEVQDESSPPRRKRFFFF*
Ga0137362_1114436313300012205Vadose Zone SoilRALFLDNPLAAFEGRDLPHVPELQDESSLTRKKRFFFF*
Ga0137380_10001047193300012206Vadose Zone SoilFGEEKARALFQENPQAAFEGRDLPHIPELPEGAAPRRRKRFFFF*
Ga0137380_1064092713300012206Vadose Zone SoilRALFLENPLAAFEGRELPHVPEVEQELPSARRKRFFFF*
Ga0137376_1047144013300012208Vadose Zone SoilEKARALFIDNPLAAFEGRDLPHVPDIPDERVPPRRKKFLFF*
Ga0137379_1097317213300012209Vadose Zone SoilARALFLENPLAAFEGRELPHVPEVEQELPSARRKRFFFF*
Ga0137371_1088253013300012356Vadose Zone SoilFGEEKAEALFVTNPLAAFEGRSLPHVPEIVEEQARKKWFLFF*
Ga0137390_1049812133300012363Vadose Zone SoilARALFQENPLAAFEGRELPHVPEVENELLPRRRKRFFFF*
Ga0137390_1106200413300012363Vadose Zone SoilAEKARALFVENPLAAFEGQPLPHVPEIVEPPPRKKRFFFF*
Ga0137395_1023586423300012917Vadose Zone SoilFGQEKARALFHDNPLAAFEGRELPHVPEVEDELPLPRRKRFFFF*
Ga0137395_1067853723300012917Vadose Zone SoilLFVENPLAAFEGRPLPHVPEVFEEQVKKKRFIFF*
Ga0137396_1080635623300012918Vadose Zone SoilEFGPEKARALFLDNPLAAFEGRDLPHVPELQDESSPTRKKRFFFF*
Ga0137413_1064380213300012924Vadose Zone SoilRFGQEKARALFHDNPLAAFEGRELPHVPEVEDELPLPRRKRFFFF*
Ga0137419_1009054713300012925Vadose Zone SoilKARALFLDNPLAAFEGRDLPHVPELQDESSPTRKKRFLFF*
Ga0137419_1095299913300012925Vadose Zone SoilLFLDNPLAAFDGGELPHVPEVQDESSLPRRKRFFFF*
Ga0137419_1179591213300012925Vadose Zone SoilVDQFGEETARALFHDNPLAAFEGRPLPHVPEVEDASPPRRKRFFFF*
Ga0134077_1008374633300012972Grasslands SoilFQENPQAAFEGRDLPHIPELPEGAAPRRRKRFFFF*
Ga0181525_1013233613300014654BogANKFNTETAEALFVSNPRAAFEGQELPHVPEVAEESPEPRKKRFLFF*
Ga0137405_126439213300015053Vadose Zone SoilGVVRDKTNPLAAFEGRPLPHVPEIVEEQARKKWFLFF*
Ga0137420_136325613300015054Vadose Zone SoilLQPAYDAVSKQFGEEKARALFIDNPLAAFEGRDLPHVRIFPTKGSATPKKFLFF*
Ga0137418_1009830343300015241Vadose Zone SoilLFQDNALAAFERQPLPHISDVQYELPRPRRKRFFFF*
Ga0137412_1061568323300015242Vadose Zone SoilLFIDNPLAAFEGRDLPHVPDIPDERVPPRRKKFLFF*
Ga0182041_1171621413300016294SoilLLLENPLAAFEGRPLPHVPELSVPERKKWKRFLFF
Ga0182033_1033381613300016319SoilARALLLENPLAAFEGRPLPHVPELAPIPAPRKRKRFLFF
Ga0182035_1127684213300016341SoilEAEALFADNPLAAFEGRALPHVPEILAERAKKRRFLFFRRS
Ga0182038_1045124413300016445SoilLLLENPLAAFEGRPLPHVPELAPIPAPRKRKRFLFF
Ga0187807_125381223300017926Freshwater SedimentRRGPEAARALFHDNPLAAWEGEPLPWVPEPETAPSPERSRRRFFFF
Ga0187776_1014928813300017966Tropical PeatlandAKALLIDNPLAAFEGRALPHVPEIAPDPLPQKRRRFFFF
Ga0187767_1008540513300017999Tropical PeatlandARALFVENPLAAFDGRPLPHAPPVVEAGPRRKRFFFF
Ga0187810_1044612023300018012Freshwater SedimentEEKARSLFVDNPLAAFDGRSLPHVPEVPDDLTRPRRKRFFFF
Ga0066667_1196393413300018433Grasslands SoilDVVLDQFGEEKARALFHDNPLAAFEGQPLPHVPEIEDALPPRRKRFFFF
Ga0066662_1018445933300018468Grasslands SoilLFLENPLAAFEGRDLPHVPEVEEEAPSPKRKRFLFF
Ga0193713_101918813300019882SoilKARALFVENPLAAFEGRELPHVPELEKEAPVRKKKFFLF
Ga0193751_100816163300019888SoilVKKAFGEGKARALFIDNPKAAFEGRDLPHVPELQDERAQSPRKRFLFF
Ga0179592_1024897623300020199Vadose Zone SoilALFVENPLAAFEGRPLPHVPEVFEEQVKKKRFIFF
Ga0210407_1004613813300020579SoilKARLLFLDNPLAALEGRELPHVPEIQETPSPKRRKRFFFF
Ga0210407_1037995933300020579SoilKQFGEGKALALFVENPMAALEGRDLPHVPELPDEVDLPRRKRFFFF
Ga0210403_1074544223300020580SoilLFVGNPMAAFEGSDLPYVPELRDEMDPPRRKRFFFF
Ga0210403_1088558923300020580SoilEKVRALFLDNPLAAFEGRELPHVPEIEEENPPRRKRFFFF
Ga0210403_1145147123300020580SoilQALLVDNPLAAFEGRPLPHLPEVAPAYVTPKRKRFLFF
Ga0210399_1072684013300020581SoilGAVEKEFGEEKARALFIDNPKAAFEGRDLPHVPELEDERAQPAKKRFLFF
Ga0210401_1150902213300020583SoilKARALFLDNPLAAFEGRELPYVPEIEEEKPPRRKRFFFF
Ga0215015_1051427623300021046SoilRRPLRLQAAYDVVREQFGEKKARALFVENPMAAFEGRDLPHVPEIPDEQVSPRRKRFFFF
Ga0179596_1023071223300021086Vadose Zone SoilKARALFIDNPLAAFEGRDLPHVPDIPDERVPPRRKKFLFF
Ga0179596_1048493523300021086Vadose Zone SoilALFRDNPLAAFEGRQLPHVPEIEDESPPPRRKRFFFF
Ga0210406_1015811413300021168SoilVQEQFGEEKSRALFVENPMAALEGRDLPHVPEVHDEREIPRRKRFFFF
Ga0210406_1070230723300021168SoilFDNPMAAFEGRELPHVPEVAPDRKPGQKRKRFWFF
Ga0210400_1031980713300021170SoilKAHALFIDNPKAAFEGRDLPHVPELQDERVQSPRKRFLFF
Ga0210400_1037322933300021170SoilKARALFVENPLAAFEGRDLPHVPEIPDEKASPRRKKFLFF
Ga0210393_1001519713300021401SoilLFVENPMAAFEGRDLPHVPEVHDEREIPRRKRFFFF
Ga0210393_1065995213300021401SoilQFGEAKALALFVENPMAAFEGRNLPHVPELPDEVDLPRRKRFFFF
Ga0210387_1027254613300021405SoilRALFVDNPMAAFEGRDLPHVPEIAPDGKPKQRKRFWFF
Ga0210391_1134859413300021433SoilPAFDFVRGQFGEEKARALFTENPRAAYEGRDLPHVPQLPDEFELPRRKRFFFF
Ga0210392_1111046923300021475SoilRGLFVDNPLAAFEGRELPFVREVEDEAAQPLRKRFFFF
Ga0187846_1045076413300021476BiofilmPAFDAVCAKFGEEKARALFIANPMAAFEGCPLPHVPDVQDPIQWTRRKRFFFF
Ga0210398_1146743123300021477SoilKPAYDVVCEQFGADKARALFVENPMAAFEGRELPHVPELPDEFTPPRRKRFLFF
Ga0210398_1150594813300021477SoilLFVENPMAAFEGRDLPHVPELADEADLPRRKRFFFF
Ga0210402_1148489423300021478SoilEQFGEEKARALFIDNPLAAFEGRDLPHVPDIPDERVPPRRKRFLFF
Ga0210409_1099885913300021559SoilAQALFVENPIAAFEGRDLPHVPEFTPPEKKENAARRKRFWFF
Ga0247679_105728023300024251SoilAQFGGETAQALFVDNPLAAFEGRNLPFVPEVADERPAKPRKRFFFF
Ga0247668_101994733300024331SoilDEMAEALFVENPLAAFEGRALPHVPEIVEEEPKKKRFLFF
Ga0207692_1100277323300025898Corn, Switchgrass And Miscanthus RhizosphereGPEKAEALFVSNPLAAFEGRPLPHVPEITAEQIKKKRFFFF
Ga0207685_1023856023300025905Corn, Switchgrass And Miscanthus RhizosphereETAQALFVDNPLAAFEGRNLPYVPEVADKRPAKPRKRFFFF
Ga0207664_1046714213300025929Agricultural SoilQALFVDNPLAAFEGRDLPYIPEIPDEKVSPRRKRFFFF
Ga0207703_1225787313300026035Switchgrass RhizosphereGQEKAEALFVENPLAAFEGRGLPHVPEVDGAELKRKKRFLFF
Ga0209863_1002786633300026281Prmafrost SoilFGKGKARALFVDNPRAAFEGRDLPHVPELEDERVRQPRKRFLFF
Ga0209158_117268823300026333SoilRFGQEKARALFQDNPLAAFEGRELPHVPEVEDELPPPRRKRFFFF
Ga0257163_100435733300026359SoilEKARALFIENPLAAFEGRDLPHVPEIPDEKVPPRRKKFLFF
Ga0209807_119811423300026530SoilDQFGEEKARALFHDNPLAAFEGQPLPHVPEIEDALPPRRKRFFFF
Ga0207780_105114813300027313Tropical Forest SoilQALFVENPMAAFEGLPLPHIPEILQETRLEKRKRFFFF
Ga0209220_110722213300027587Forest SoilKARALFWENPLAAFEGRELPHVPEVEEEVLPPRRKRFFFF
Ga0209625_110112313300027635Forest SoilRAAFEVVAKAFGEDKGRALFVDNPKAAFEGRDLPHVPELQDERVQSPRKRFLFF
Ga0209076_104200633300027643Vadose Zone SoilARALFQDNPLAAFEGQQLPHIPEVEDELPPPRRKRFFFF
Ga0209588_127000613300027671Vadose Zone SoilVSKQFGGEKARALFVENPLAAFEGRDLPHVPEIPEGKASPRRKKFLFF
Ga0209011_110221013300027678Forest SoilALFVDNPKAAFDGRDLPHVPELEDETAQPRRKRFLFF
Ga0209446_108310723300027698Bog Forest SoilAYDVVLEQLGEGKARALFVENPMAAFEGRDLPHVPELPDENALPKRKRFFFF
Ga0209178_117688123300027725Agricultural SoilQFGEEKARALFLENPMAAFEGRALPHVPELPDHIGVPRRKRFFFF
Ga0209038_1013801713300027737Bog Forest SoilALFVDNPMAAFEGRDLPYFPELPDEFNRPRRKRFFFF
Ga0209448_1004012813300027783Bog Forest SoilLKLRAAYDVVLEQLGEGKARALFVENPMAAFEGRDLPHVPELPDENALPKRKRFFFF
Ga0209580_1020927113300027842Surface SoilENPMAAFEGRDLPHLPQLPDETDVPRRKRFFFFWSL
Ga0209274_1068604813300027853SoilRALFVENPMAAFEGRELPHVPQPPDEIEPPRRKRFFFF
Ga0209166_1000085213300027857Surface SoilADRFGEEKARALFVENPGAAFEGRDLPHVPEVEEPVAQPKRRRFFFF
Ga0209701_1030526523300027862Vadose Zone SoilRALFQDNPLAAFEGRPLPHVPEVEAELAPPRRKRFFFF
Ga0209590_1060141523300027882Vadose Zone SoilLFQDNPLAAFEGRQLPHVPEVDELPPPRRKRFFFF
Ga0209698_1048190013300027911WatershedsNTRGRPLKLQPAYDVVGRKFGEEKARALFVENPMAAFEGRSLPQVPDVPDDITRPRRKRFFFF
Ga0265357_100642013300028023RhizosphereFDVVCEQFGEDKARALFVDNPMAAFEGRDLPHVPELPDEFTPPRRKRFFFF
Ga0268264_1103329023300028381Switchgrass RhizosphereKAEALFVENPLAAFEGRGLPHMPEISATSLKRKRFLFF
Ga0308309_1002235913300028906SoilEEVARALFVDNPMAAFEGRDLPHVPGVRDKIDVPRRKRFFFF
Ga0222749_1076548413300029636SoilEEKARALFIENPLAAFEGRDLPHVPDIPDERVPPRRKRFLFF
Ga0311368_1101003923300029882PalsaAKFNRETAEALFVSNPRAAFEGQELPHVPELAEESPGPRKKRFLFF
Ga0075384_1117725313300030841SoilPAFEVVAKAFGEEKARALFVDNPKAAFEGRDLPHVPELQDERVQSPRKRFLFF
Ga0075386_1149521013300030916SoilKEFGKQKAQALFVDNPRAAFEGLDLPHVPELEEEPEHRKKRFLFF
Ga0073994_1226714113300030991SoilEDKARALFIDNPKAAFEGRDLPHVPELQDERVQSPRKRFLFF
Ga0073994_1231159613300030991SoilKARALFQDNPLAAFEGRELPHIPEVEDELPPPRRKRFFFF
Ga0073994_1237393213300030991SoilEDKARALFIDNPKAAFEGLDLPHVPELQDERVQSPRKRFLFF
Ga0170834_10040608423300031057Forest SoilARALFVENPMAAFEGRDLPHVPQLPETTGGPRRKRFFFF
Ga0170823_1712524423300031128Forest SoilLFHDNPLAAFEGRELPHVPEVEDELPPPRRRRFFFF
Ga0307476_1120627913300031715Hardwood Forest SoilDKSRALFVENPMAAFEGRDLPHVPDVRDEREIPRRKRFFFF
Ga0307469_1230571313300031720Hardwood Forest SoilRRRPLRLQAAHDVVAEQFGDEKARALFFDNPMAAFEGRDLPHVPEIPDDKVSSRRKRFLL
Ga0307468_10048607713300031740Hardwood Forest SoilREQLGEEKARALFVENPMAALEGRDLPHVPQLPETTGAPRRKRFFFF
Ga0307477_1112877313300031753Hardwood Forest SoilALFLENPLAAFEGRDLPYVPEIPEENTSPRRKRFFFF
Ga0318568_1066774623300031819SoilKAEALLVDNPLAAFEGHGLPHIPEVSDRPKKKRFLFF
Ga0318564_1032632623300031831SoilALLLENPLAAFEGRPLPHVPELSVPERKKWKRFLFF
Ga0318551_1055191923300031896SoilEKAEALFVENPLAAFEGRALPHVPEIREAPVKKKRFLFF
Ga0318551_1080921313300031896SoilRALLLENPLAAFEGRPLPHVPERAPIPAPRKRKRFLFF
Ga0318520_1022057933300031897SoilGKAEALFVDNPLAAFEGHGLPHIPEVSDPPKKKRFLFF
Ga0306923_1040719113300031910SoilARALLLENPLAAFEGRPLPHVPELVPIPAPRKRKRFLFF
Ga0306926_1234618123300031954SoilKTAQALFVDNPLAAFEGRTLPYMPEAAERPAGRRKRFFFF
Ga0307479_1023371513300031962Hardwood Forest SoilVVVDQFGEETARALFHDNPLAAFEGRPLPCVPEIEDALPVPRRKRFFFF
Ga0307479_1102137823300031962Hardwood Forest SoilRDLFLENPLAAFEGRDLPYVPEIPDAKISPRRRRFFFF
Ga0307479_1170407823300031962Hardwood Forest SoilVRQFGEEKARALFQDNPLAAFEGRALPHIPEIEDELPPPRRKRFFFF
Ga0318507_1028279313300032025SoilGKAEALLVDNPLAAFEGHGLPHIPEVSDRPKKKRFLFF
Ga0318533_1129381813300032059SoilFVENPLAVLEGRALPHVPEIREARAKKKRFRFFWA
Ga0306924_1016690743300032076SoilRALLLEYPLAAFEGRPLPHVPELSVPERKKWKRFLFF
Ga0307471_10026530413300032180Hardwood Forest SoilAFDLVREQFGEEKARALFVENPMAAFEGRDLPHVPQLPETTGAPRRKRFFFF
Ga0307472_10158947013300032205Hardwood Forest SoilYDVVVDQFGREKARALFVDNPLAAFEGGELPHVPEVEDKSSAPRKKRFFFF
Ga0335078_1046233013300032805SoilMGEETAKALFLENPRAALEGLDLPYVPELTSESAGPRRKRFFFF
Ga0335081_1073867233300032892SoilPAYEVIREQVGEQTARALLLENPKAALEGRDLPYVPDLSDTADAAPRKRFFFF
Ga0335083_1051976113300032954SoilGEEVAQALFVDNPLAAFEGRTLPYVPQVADSKEIKPRKRFFFF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.