NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F034221

Metagenome Family F034221

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034221
Family Type Metagenome
Number of Sequences 175
Average Sequence Length 44 residues
Representative Sequence AVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETELATERR
Number of Associated Samples 138
Number of Associated Scaffolds 175

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.29 %
% of genes near scaffold ends (potentially truncated) 96.00 %
% of genes from short scaffolds (< 2000 bps) 94.86 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.429 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(38.857 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(62.286 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.03%    β-sheet: 0.00%    Coil/Unstructured: 61.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 175 Family Scaffolds
PF13795HupE_UreJ_2 41.71
PF00215OMPdecase 0.57
PF07730HisKA_3 0.57
PF00593TonB_dep_Rec 0.57
PF04433SWIRM 0.57
PF01464SLT 0.57
PF07638Sigma70_ECF 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 175 Family Scaffolds
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.57
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.57
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.57
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.57
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.43 %
UnclassifiedrootN/A32.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309009|GPKNP_F5JHDJD02GVYJQNot Available510Open in IMG/M
3300000955|JGI1027J12803_103845692All Organisms → cellular organisms → Bacteria → Proteobacteria673Open in IMG/M
3300000956|JGI10216J12902_103075277All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300000956|JGI10216J12902_108544588All Organisms → cellular organisms → Bacteria → Proteobacteria818Open in IMG/M
3300002244|JGI24742J22300_10102804Not Available554Open in IMG/M
3300002568|C688J35102_118374185Not Available553Open in IMG/M
3300004114|Ga0062593_101483212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium730Open in IMG/M
3300004156|Ga0062589_101456402All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300004156|Ga0062589_101760617All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300004463|Ga0063356_104463621All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300004480|Ga0062592_101555535All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300004480|Ga0062592_102420844Not Available527Open in IMG/M
3300004480|Ga0062592_102452608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti524Open in IMG/M
3300005175|Ga0066673_10473859All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300005288|Ga0065714_10460573All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300005289|Ga0065704_10060962Not Available624Open in IMG/M
3300005289|Ga0065704_10828729Not Available508Open in IMG/M
3300005294|Ga0065705_10048784All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300005294|Ga0065705_11021812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium541Open in IMG/M
3300005295|Ga0065707_10008578All Organisms → cellular organisms → Bacteria2648Open in IMG/M
3300005328|Ga0070676_10538877All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300005330|Ga0070690_100404112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium1004Open in IMG/M
3300005335|Ga0070666_11382142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales526Open in IMG/M
3300005336|Ga0070680_100461175All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300005338|Ga0068868_101465903All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Congregibacter → Congregibacter litoralis638Open in IMG/M
3300005338|Ga0068868_101537554All Organisms → cellular organisms → Bacteria → Proteobacteria624Open in IMG/M
3300005338|Ga0068868_101596002All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300005353|Ga0070669_101632011Not Available561Open in IMG/M
3300005354|Ga0070675_100805649All Organisms → cellular organisms → Bacteria → Proteobacteria859Open in IMG/M
3300005364|Ga0070673_100082401All Organisms → cellular organisms → Bacteria → Proteobacteria2611Open in IMG/M
3300005364|Ga0070673_101142018All Organisms → cellular organisms → Bacteria → Proteobacteria729Open in IMG/M
3300005434|Ga0070709_10816528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium733Open in IMG/M
3300005439|Ga0070711_101186495All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300005441|Ga0070700_100882656All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300005444|Ga0070694_101613441All Organisms → cellular organisms → Bacteria → Proteobacteria551Open in IMG/M
3300005455|Ga0070663_102070951All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005457|Ga0070662_100269261All Organisms → cellular organisms → Bacteria → Proteobacteria1375Open in IMG/M
3300005457|Ga0070662_101948876Not Available508Open in IMG/M
3300005458|Ga0070681_11108210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales713Open in IMG/M
3300005459|Ga0068867_100454892All Organisms → cellular organisms → Bacteria → Proteobacteria1092Open in IMG/M
3300005543|Ga0070672_101363427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium634Open in IMG/M
3300005544|Ga0070686_101768194All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300005618|Ga0068864_100020377All Organisms → cellular organisms → Bacteria → Proteobacteria5547Open in IMG/M
3300005618|Ga0068864_101052378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium808Open in IMG/M
3300005618|Ga0068864_102147811Not Available565Open in IMG/M
3300005843|Ga0068860_101743271All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300006237|Ga0097621_101603495All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300006237|Ga0097621_102345251Not Available511Open in IMG/M
3300006358|Ga0068871_100543103All Organisms → cellular organisms → Bacteria → Proteobacteria1052Open in IMG/M
3300006358|Ga0068871_102373575All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300006844|Ga0075428_100005034All Organisms → cellular organisms → Bacteria14689Open in IMG/M
3300006846|Ga0075430_100183774All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300006847|Ga0075431_101127550All Organisms → cellular organisms → Bacteria → Proteobacteria748Open in IMG/M
3300006871|Ga0075434_102474334All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300006881|Ga0068865_101379225All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300006931|Ga0097620_101509591All Organisms → cellular organisms → Bacteria → Proteobacteria742Open in IMG/M
3300006969|Ga0075419_10920244All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300009094|Ga0111539_12371260Not Available616Open in IMG/M
3300009100|Ga0075418_11112289All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300009148|Ga0105243_11446483Not Available709Open in IMG/M
3300009148|Ga0105243_12464283Not Available559Open in IMG/M
3300009156|Ga0111538_10168031All Organisms → cellular organisms → Bacteria2785Open in IMG/M
3300009177|Ga0105248_12227970All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300009545|Ga0105237_11699986All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300009551|Ga0105238_11196006All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300009553|Ga0105249_13001927Not Available542Open in IMG/M
3300009610|Ga0105340_1140790All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300009610|Ga0105340_1514300Not Available535Open in IMG/M
3300010036|Ga0126305_10050856All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-222349Open in IMG/M
3300010036|Ga0126305_10752572All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300010373|Ga0134128_12363611Not Available586Open in IMG/M
3300011430|Ga0137423_1251597Not Available523Open in IMG/M
3300011441|Ga0137452_1043939All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300011443|Ga0137457_1316974Not Available532Open in IMG/M
3300012480|Ga0157346_1032385Not Available515Open in IMG/M
3300012488|Ga0157343_1033716Not Available528Open in IMG/M
3300012494|Ga0157341_1024354Not Available617Open in IMG/M
3300012503|Ga0157313_1034337Not Available592Open in IMG/M
3300012892|Ga0157294_10103322All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300012897|Ga0157285_10140586All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300012900|Ga0157292_10061657All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300012914|Ga0157297_10255586Not Available637Open in IMG/M
3300012955|Ga0164298_10443458All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300012957|Ga0164303_10340109All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300012957|Ga0164303_10340385All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300012957|Ga0164303_10933089All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300012960|Ga0164301_10798878All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300012961|Ga0164302_10249997All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300012986|Ga0164304_10278849All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300012986|Ga0164304_11347427Not Available583Open in IMG/M
3300012989|Ga0164305_10699002All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300012989|Ga0164305_11735662Not Available561Open in IMG/M
3300013296|Ga0157374_10068069All Organisms → cellular organisms → Bacteria → Proteobacteria3349Open in IMG/M
3300013297|Ga0157378_13191993Not Available509Open in IMG/M
3300013306|Ga0163162_12465791Not Available598Open in IMG/M
3300013308|Ga0157375_10925255All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300013500|Ga0120195_1001179All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300014745|Ga0157377_10662845All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300014968|Ga0157379_12388802Not Available527Open in IMG/M
3300014969|Ga0157376_11059912All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300015077|Ga0173483_10248441All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300015372|Ga0132256_100208541All Organisms → cellular organisms → Bacteria2004Open in IMG/M
3300015373|Ga0132257_101841050All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300015373|Ga0132257_101977974All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300015373|Ga0132257_102294001All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300015373|Ga0132257_102432019All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300015374|Ga0132255_103043468All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300015374|Ga0132255_103406498All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300015374|Ga0132255_103889628All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300015374|Ga0132255_105325969Not Available544Open in IMG/M
3300015374|Ga0132255_105618119Not Available531Open in IMG/M
3300018084|Ga0184629_10305723All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300018469|Ga0190270_10452786All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300018469|Ga0190270_13422931Not Available503Open in IMG/M
3300018476|Ga0190274_12852882Not Available579Open in IMG/M
3300018481|Ga0190271_10452571All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300018481|Ga0190271_12797768Not Available586Open in IMG/M
3300018481|Ga0190271_12977564Not Available568Open in IMG/M
3300019361|Ga0173482_10058562All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300019362|Ga0173479_10504968All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300023064|Ga0247801_1077451Not Available539Open in IMG/M
3300023066|Ga0247793_1057741All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300025290|Ga0207673_1056049Not Available560Open in IMG/M
3300025900|Ga0207710_10501049All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300025903|Ga0207680_11177471Not Available547Open in IMG/M
3300025903|Ga0207680_11329646Not Available511Open in IMG/M
3300025907|Ga0207645_10522591Not Available804Open in IMG/M
3300025916|Ga0207663_10476163All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300025924|Ga0207694_11489096Not Available571Open in IMG/M
3300025925|Ga0207650_10307115All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300025933|Ga0207706_11125886All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300025933|Ga0207706_11376571Not Available580Open in IMG/M
3300025935|Ga0207709_10240607All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300025938|Ga0207704_11853124Not Available519Open in IMG/M
3300025940|Ga0207691_10521091All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300025940|Ga0207691_11554439Not Available539Open in IMG/M
3300025961|Ga0207712_10624752All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300025986|Ga0207658_10540405All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300025986|Ga0207658_10771172All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300026067|Ga0207678_11282256All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300026075|Ga0207708_10951103All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300026089|Ga0207648_10651692All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300026538|Ga0209056_10485138All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300026841|Ga0207490_1002378All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300026960|Ga0207582_1031927Not Available507Open in IMG/M
3300027471|Ga0209995_1055271All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium674Open in IMG/M
3300027526|Ga0209968_1045310All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300027543|Ga0209999_1070720All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300027552|Ga0209982_1049188Not Available679Open in IMG/M
3300027665|Ga0209983_1106775All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300027821|Ga0209811_10083565All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300027873|Ga0209814_10152172All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300027880|Ga0209481_10679241Not Available535Open in IMG/M
3300027909|Ga0209382_11918401Not Available572Open in IMG/M
3300031226|Ga0307497_10370916All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300031366|Ga0307506_10471537Not Available527Open in IMG/M
3300031562|Ga0310886_10765359Not Available606Open in IMG/M
3300031847|Ga0310907_10187496All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300031847|Ga0310907_10700985Not Available560Open in IMG/M
3300031854|Ga0310904_10016283All Organisms → cellular organisms → Bacteria3159Open in IMG/M
3300031858|Ga0310892_10622295All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300031858|Ga0310892_11200818Not Available540Open in IMG/M
3300031901|Ga0307406_10229126All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300031908|Ga0310900_11852452Not Available514Open in IMG/M
3300031940|Ga0310901_10213973All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300031943|Ga0310885_10078588All Organisms → cellular organisms → Bacteria → Proteobacteria1449Open in IMG/M
3300032005|Ga0307411_11457119Not Available628Open in IMG/M
3300032012|Ga0310902_11009201Not Available578Open in IMG/M
3300032017|Ga0310899_10464567Not Available616Open in IMG/M
3300032075|Ga0310890_10534142All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300032122|Ga0310895_10460477All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300032179|Ga0310889_10108170All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300032180|Ga0307471_104177203Not Available510Open in IMG/M
3300033551|Ga0247830_11554961Not Available529Open in IMG/M
3300034417|Ga0364941_012583All Organisms → cellular organisms → Bacteria1618Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.29%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.43%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.43%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.29%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.29%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.71%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.14%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.14%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.14%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.14%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.14%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.14%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.57%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.57%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.57%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309009Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012480Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610Host-AssociatedOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013500Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026841Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A3a-10 (SPAdes)EnvironmentalOpen in IMG/M
3300026960Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027471Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027552Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKNP_047941902070309009SoilVRDHVVREWENERRQRARNDAYTRMRGEYQVSIETELATQRR
JGI1027J12803_10384569213300000955SoilPQLAAVRDHVVREWENERRQRARNDAYAKMRGGYEVSIEAKPSMELR*
JGI10216J12902_10307527723300000956SoilAVRDQVIREWENDRRQRARVEAYARMRKGYDVSIDATLPGPQQ*
JGI10216J12902_10854458823300000956SoilLADVHDVVVREWENERRQRARNDAYARMRGAYEVTIDTEPQTGRP*
JGI24742J22300_1010280423300002244Corn, Switchgrass And Miscanthus RhizosphereHVVREWENERRQRARTDAYARMRGEYEISMVANAPAEQP*
C688J35102_11837418513300002568SoilPAVAPQLPAVRDQVVREWENERRQRARNDAYTKMRGDYQVSVETELATERR*
Ga0062593_10148321223300004114SoilPQLAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR*
Ga0062589_10145640213300004156SoilTPAKAPALAAVHDQVVREWENDRRQRARHEAYTRMRSGYEIRLEARPPAEPR*
Ga0062589_10176061723300004156SoilTPRLADVRDQVVREWENERRRRARDESYTKMRAGYSVSIDATLPAQP*
Ga0063356_10446362113300004463Arabidopsis Thaliana RhizosphereAVRDHVVREWENDRRQRARNDAYTKMRREYQVSIETKPAAGRR*
Ga0062592_10155553523300004480SoilRDHVLREWENERRLRARTDAYARMRAGYQISIETKPAPERP*
Ga0062592_10242084413300004480SoilRDQVVREWENERRRRARDESYTKMRAGYSVSIDATLPAQP*
Ga0062592_10245260813300004480SoilAVRDQVVREWENERRQRARTDAYAKMRGEYEVSIEAKPAERP*
Ga0066673_1047385913300005175SoilVRDHVAREWENERRQRARNDAYARMRGEYTVSIETGPKTATARR*
Ga0065714_1046057313300005288Miscanthus RhizosphereQLAAVRDQVVREWENERRQRARNDAYARMRGEYQVSVETTKATAGR*
Ga0065704_1006096213300005289Switchgrass RhizospherePAAAPQLAAVRDHVVREWENERRQRARTDAYTKMRGGYQVSIETTLVATRR*
Ga0065704_1082872923300005289Switchgrass RhizospherePQLAAVRDHVVREWENERRQRARNEAYARMRERYEVSIAATAPTEQP*
Ga0065705_1004878433300005294Switchgrass RhizospherePVVAPQLAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR*
Ga0065705_1102181213300005294Switchgrass RhizosphereSDRTPAVAQQLAAVRDHVMREWENERRQRARTDAYAKMRGEYEVSIEAKPTERP*
Ga0065707_1000857833300005295Switchgrass RhizosphereVRDHVVREWENERRQRARNDAYTKMRGEYAVSIETKVPTERR*
Ga0070676_1053887723300005328Miscanthus RhizosphereVRDHVVREWENERRQRARTDAYARMRGEYEISMVANAPAEQP*
Ga0070690_10040411223300005330Switchgrass RhizosphereVAPQLAAVRDHVVREWENERRERARTDAYTTMRREYAVSIEAKPTERP*
Ga0070666_1138214223300005335Switchgrass RhizosphereLAAVRDQVVREWEHERRLHARNDAYARMRGRYTVSIETKPPTQRP*
Ga0070680_10046117513300005336Corn RhizosphereQVVREWENDRRLRARADAYGRMRREYEVSIEAALPAGRP*
Ga0068868_10146590323300005338Miscanthus RhizosphereSDRTPAAAPPLAAVHDAVAREWENERRQRARQDAYARARSEYQVSIEGKAMTAQP*
Ga0068868_10153755413300005338Miscanthus RhizosphereAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETELATERR*
Ga0068868_10159600223300005338Miscanthus RhizospherePALAAVHDQVVREWENDRRQRARHDAYTRMRSGYEIRIEAKPPTEPR*
Ga0070669_10163201113300005353Switchgrass RhizosphereAAVRDHVVREWENERRQRARHDAYTKMRSEYQVSIETELATTRR*
Ga0070675_10080564923300005354Miscanthus RhizosphereRDQVVREWENDRRQRARNDAYARMRGRYDVSIEAPASRP*
Ga0070673_10008240133300005364Switchgrass RhizosphereLAAVRDHVVREWENERRQRARNEAYARMRERYEVSIAATAPTEQP*
Ga0070673_10114201813300005364Switchgrass RhizosphereAAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETKPATKRR*
Ga0070709_1081652813300005434Corn, Switchgrass And Miscanthus RhizosphereAPQLAAVRDHVVREWENERRQRARRDAYTKMRGEYRVSIETELATERR*
Ga0070711_10118649513300005439Corn, Switchgrass And Miscanthus RhizosphereQLNAVRDHVVREWENERRQRARNDAYVKMRGEYTVRIETKPPTERP*
Ga0070700_10088265613300005441Corn, Switchgrass And Miscanthus RhizosphereQVVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR*
Ga0070694_10161344113300005444Corn, Switchgrass And Miscanthus RhizosphereLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR*
Ga0070663_10207095113300005455Corn RhizosphereSDRTHAVMPQLTAVRDQVEREWENERRQRARNDAYTKMRGEYQVTIEPKPLTDAR*
Ga0070662_10026926123300005457Corn RhizosphereRDQVVREWEHERRLHARNDAYARMRGRYTVSIETKPPTQRP*
Ga0070662_10194887613300005457Corn RhizosphereHVVREWENDRRQRARNDAYAKMRGAYQVSIETGLATTRR*
Ga0070681_1110821023300005458Corn RhizosphereRVVREWENERRQRARDDAYARMRGEYTVSIETKPPTRRP*
Ga0068867_10045489223300005459Miscanthus RhizosphereVRDHVVREWENERRQRARTDAYAKMRGAYEISLEAKPTERP*
Ga0070672_10136342713300005543Miscanthus RhizosphereAVPPQLAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR*
Ga0070686_10176819413300005544Switchgrass RhizospherePAVAPELAAVRNQVVREWENDRRQRARNDAYARMRGGYDVRIEAPARR*
Ga0068864_10002037713300005618Switchgrass RhizosphereVRDHVVREWENERRQRARNEAYARMREGYEVSIAATAPTEQP*
Ga0068864_10105237823300005618Switchgrass RhizosphereAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETKLATEQR*
Ga0068864_10214781123300005618Switchgrass RhizosphereDAVAREWENERRQRARQDAYARARSEYQVSIEGKAMTAQP*
Ga0068860_10174327113300005843Switchgrass RhizosphereEWENDRRQRARNDAYTKMRSEYQVSIETKLATERR*
Ga0097621_10160349523300006237Miscanthus RhizosphereVVREWENERRQRARNEAYAKMRDGYAVGIEAKTAAERR*
Ga0097621_10234525113300006237Miscanthus RhizosphereREWENERRQRARNDAYAKMRGGYEVRVETTTPSEGR*
Ga0068871_10054310323300006358Miscanthus RhizosphereVRDHVVREWENERRQRARNDAYAKMRGGYEVRVETTTPSEGR*
Ga0068871_10237357523300006358Miscanthus RhizosphereVVRDQVVREWENERRQRARNDAYTKMRGEYIVSIESEPPIERP*
Ga0075428_100005034153300006844Populus RhizosphereAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETMLATERR*
Ga0075430_10018377433300006846Populus RhizosphereVRDHVVREWENERRQRARNDAYTTMRGEYQVSIETKLATEQQ*
Ga0075431_10112755023300006847Populus RhizospherePQLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETMLATERR*
Ga0075434_10247433413300006871Populus RhizosphereAVRDQVVREWENDRRQRARNDAYAKMRGEYQVSNETKLATEPR*
Ga0068865_10137922513300006881Miscanthus RhizosphereVVREWENDRRQRARNDAYTKMRGEYIVSIESEPPIERP*
Ga0097620_10150959113300006931Switchgrass RhizosphereRDHVVREWENERRQRARNDAYTKMRGEYQVSIETKLATEQR*
Ga0075419_1092024423300006969Populus RhizosphereVVREWENERRQRARNDAYTKMRGEYQVSIETTLATERR*
Ga0111539_1237126013300009094Populus RhizospherePQLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETKLATEQR*
Ga0075418_1111228923300009100Populus RhizosphereAVRDQVVREWENERRQRARNDAYTKMRRGYEVSIEAKPSTERR*
Ga0105243_1144648313300009148Miscanthus RhizosphereLAAVRDQVVREWESDRRQRARNDAYAKMRSGYEIRIEAESSAERR*
Ga0105243_1246428313300009148Miscanthus RhizosphereAAPQLAAVRDHVVREWENERRQRARNDAYTKVRGEYQVSLETDLATERR*
Ga0111538_1016803113300009156Populus RhizosphereDHVVREWENERRQRARNDAYARMRGEYEVSMEAKAPAERP*
Ga0105248_1222797013300009177Switchgrass RhizosphereLADVHDQVVREWENDRRQRARNDAYTKMRAEYQVSIETDLPAEQR*
Ga0105237_1169998613300009545Corn RhizosphereEWENERRLRARNDAYTRMRGDYQVSIETAQATKRQ*
Ga0105238_1119600613300009551Corn RhizosphereRDQVVREWENERRQRSRNEAYAKMRREYQVSIETELTTQRR*
Ga0105249_1300192723300009553Switchgrass RhizosphereERIPAVAPQLAAVRDHVVREWENERRQRARNDAYARMRDGYEVSILATAPPEQP*
Ga0105340_114079023300009610SoilEWENERRQRARTDAYAKMRGEYEVSIETKPTERP*
Ga0105340_151430023300009610SoilQLTAVRDQVVREWENERRQRARNDAYTNMRGEYQVDIETEPATERR*
Ga0126305_1005085653300010036Serpentine SoilLAAVRDRVVREWENDRRLRARTAAYARMRAGYEISIETKSPADRP*
Ga0126305_1075257213300010036Serpentine SoilAAPQLAAVRDHVVREWENERRQRARNDAYTNMRGEYQVSIETKLATERR*
Ga0134128_1236361123300010373Terrestrial SoilDQVVREWENERRQRARNDAYTKMRGEYTVSIETKPPTERP*
Ga0137423_125159713300011430SoilAAPPLAAVRDYVMREWENERRQRARTDAYAKMRGGYEVSIEAKTPAERR*
Ga0137452_104393933300011441SoilPLAAVRDYVMREWENERRQRARTDAYAKMRGGYEVSIEAKTPAERR*
Ga0137457_131697413300011443SoilAAAPPLAAVRDYVMREWENERRQRARTDAYAKMRGGYEVSIEAKTPAERR*
Ga0157346_103238523300012480Arabidopsis RhizosphereWENDRRQRARTDAYAKMRGDYQVSIETTLAAERR*
Ga0157343_103371613300012488Arabidopsis RhizosphereTPAVAPELAAVRDQVVREWENDRRQRARNDAYTKMRGAYHVSIETKLATARR*
Ga0157341_102435413300012494Arabidopsis RhizosphereAVAPQLAAVRDQVVREWENERRLRARTDAYARMRGEYEVSVEARPTTERP*
Ga0157313_103433723300012503Arabidopsis RhizosphereAVRDQVVREWENERRRRARNDAYARMRGEYQVGIETTLATQRR*
Ga0157294_1010332223300012892SoilVREWENERRQRARNDAYTKMRGGYQVSIETKLATERR*
Ga0157285_1014058623300012897SoilDHVVREWENERRQRARTDAYRKMRGEYQVSIETGPATERR*
Ga0157292_1006165723300012900SoilAVRDHVVREWENDRRQRARNDAYTKLRGEYQVSIETKPATERR*
Ga0157297_1025558623300012914SoilVRDQVVREWENERRQRARTDAYAKMRGEYQVDIEMKLPTQRR*
Ga0164298_1044345813300012955SoilWENDRRQRARNDAYTKLRGEYDVSIETRPATAQR*
Ga0164303_1034010913300012957SoilAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETEPATERR*
Ga0164303_1034038523300012957SoilLAAVRDQVVREWEHARRQRARNEAYAKMRGEYPVSVGTELAPERR*
Ga0164303_1093308923300012957SoilVREWENDRRQRARRDAYTKMRGEYRVSVETELATERR*
Ga0164301_1079887823300012960SoilVPAAAPQLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSRETKRATERR*
Ga0164302_1024999723300012961SoilEWENERRQRARDDTYMKMRGEYQVTIEPEPATKRR*
Ga0164304_1027884913300012986SoilLAAVRDHVVREWENERRQRARNDAYAKMRGEYQVSIETKLTTERR*
Ga0164304_1134742713300012986SoilAPQLAAVRDHVVREWENERRQRARNDAYTKIRGEYQISIETKPATERR*
Ga0164305_1069900223300012989SoilQVVREWENDRRQRARNDAYAKMRSGYEIRIEAESSAERR*
Ga0164305_1173566223300012989SoilPQLAAVRDHVVREWENERRQRARNDAYTKMRGEYTVSIEPELATERR*
Ga0157374_1006806913300013296Miscanthus RhizosphereVREWENDRRQRARNDAYARMRGRYDVSIEAPASRP*
Ga0157378_1319199323300013297Miscanthus RhizosphereEWENERRQRARNDAYTKMRGGYQVSVETELATERR*
Ga0163162_1246579123300013306Switchgrass RhizosphereVREWENERRQRARNDAYTKMRSEYDVAVETKPTTMLPTARP*
Ga0157375_1092525513300013308Miscanthus RhizosphereLAAVRDHVVREWENDRRQRARNDAYAKMRGDYQVSIETKLATERR*
Ga0120195_100117923300013500TerrestrialVRDQVVREWENERRQRARNDAYAKMRGEYQVTIETKLATERR*
Ga0157377_1066284523300014745Miscanthus RhizosphereVRDHVVREWENERRERARTDAYTTMRREYEVSIEAKPTERP*
Ga0157379_1238880223300014968Switchgrass RhizosphereWENDRRQRARNDAYTKMRGEYIVSIESEPPIERP*
Ga0157376_1105991223300014969Miscanthus RhizosphereAAVRGQVVREWENDRRQRARDDAYTKMRGEYQVSVETEPATGRR*
Ga0173483_1024844123300015077SoilVVREWENERRQRARSDAYAKMRGECQVSIETELATERR*
Ga0132256_10020854133300015372Arabidopsis RhizosphereLAAVRDQVVREWENARRQRARSEAYTKMQGGYRVSIETGLATKRR*
Ga0132257_10184105023300015373Arabidopsis RhizosphereLAAVRDHVVREWENDRRQRARTDAYAKMRGDYQVSIETTLAAERR*
Ga0132257_10197797413300015373Arabidopsis RhizosphereVAPQLTAVRDHVVREWENERRQRARNDAYARMRGEYEVSMDAKVPAEQP*
Ga0132257_10229400113300015373Arabidopsis RhizospherePQLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETTLATERR*
Ga0132257_10243201913300015373Arabidopsis RhizosphereAVRDAVAREWENERRQRARQSAYAQMRGEYEVSIEAKSTTALP*
Ga0132255_10304346823300015374Arabidopsis RhizosphereVRDQVVREWESDRRQRVRNDAYAKMRGEYEVRIEVKPSMDLR*
Ga0132255_10340649813300015374Arabidopsis RhizosphereQLAAVRDHVVREWENERRQRARNEAYTKMRGEYQVSIETKLAMERR*
Ga0132255_10388962823300015374Arabidopsis RhizosphereRDQVAREWENDRRQRARNDAYAKMRGEYQVSIETTPATERR*
Ga0132255_10532596913300015374Arabidopsis RhizosphereHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR*
Ga0132255_10561811913300015374Arabidopsis RhizosphereVREWENDRRQRARNEAYEKMRSDYQVRIETTPATQQQ*
Ga0184629_1030572313300018084Groundwater SedimentDQVVREWENDRRLRARTDAYGRMRREYEVSIEAALPAGRP
Ga0190270_1045278623300018469SoilPQLAAVRDQVVREWENERRQRARHDAYTKMRSEYQVSIETELAAKRR
Ga0190270_1342293113300018469SoilLAAVRDHVVREWENERRQRARNDAYAKMRGGYEVSIEANPSMELR
Ga0190274_1285288213300018476SoilVAPQLAAVRDHVMREWENERRQRARSDAYTKMRGEYTVSIETKPPTERP
Ga0190271_1045257113300018481SoilREWENERRQRARADSYARMRADYEISIEATMPKERD
Ga0190271_1279776823300018481SoilLAAVRDHVMREWENERRQRARNDAYAKMRGRYEVSIEAKTPAKRR
Ga0190271_1297756413300018481SoilDLAAVRDHVVREWENERRVRARIEAYARMRARYEVSIETTLAADR
Ga0173482_1005856213300019361SoilTPAVAPQLAAVRDHVVREWENERRQRARSDAYAKMRGEYQVSIETELATERR
Ga0173479_1050496823300019362SoilRDNVVREWESERRERARDDAYTRMRGEYQISIETEAATKRR
Ga0247801_107745123300023064SoilTPAVAPQLTAMRDQVVREWENERRQRARNDAYTKMRGGYQVSIETKLATERR
Ga0247793_105774113300023066SoilLTAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETKLATERR
Ga0207673_105604913300025290Corn, Switchgrass And Miscanthus RhizospherePAVAPQLAAVRDHVVREWENERRQRARNEAYARMRERYEVSIAATAPTEQP
Ga0207710_1050104923300025900Switchgrass RhizosphereDQVVREWENERRQRARDDTYMKMRGEYQVTIEPEPATKRR
Ga0207680_1117747113300025903Switchgrass RhizospherePALAAVREQVAREWENDRRQRARADAYARMRGEYEVSLEATRPTERR
Ga0207680_1132964623300025903Switchgrass RhizosphereQLAAVRDQVVREWENERRQRARNDAYARMRGEYQVSVETTKATAGR
Ga0207645_1052259113300025907Miscanthus RhizosphereDHVVREWENERRQRARHDAYTRMRSEYQVSLETELAAKRR
Ga0207663_1047616313300025916Corn, Switchgrass And Miscanthus RhizosphereQLNAVRDHVVREWENERRQRARNDAYVKMRGEYTVRIETKPPTERP
Ga0207694_1148909613300025924Corn RhizosphereVHDAVVREWENERRQQARQDAYARMRGEYQVSIEARPMTAQP
Ga0207650_1030711533300025925Switchgrass RhizospherePPQLAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR
Ga0207706_1112588613300025933Corn RhizosphereHLAAVRDQVVREWEHERRLHARNDAYARMRGRYTVSIETKPPTQRP
Ga0207706_1137657123300025933Corn RhizospherePLAPVREQVAREWENERRQRARTDSYARMRADYEVSIEATMPKEQR
Ga0207709_1024060733300025935Miscanthus RhizosphereLAAVRDQVVREWESDRRQRARNDAYAKMRSGYEIRIEAESSAERR
Ga0207704_1185312413300025938Miscanthus RhizosphereVVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR
Ga0207691_1052109123300025940Miscanthus RhizosphereAAVHDAVAREWENERRQRARQDAYARARGEYQVSIEAKPMTAQP
Ga0207691_1155443923300025940Miscanthus RhizosphereVREWENERRQRARNDAYSKMREHYAISIEAELPTPAR
Ga0207712_1062475213300025961Switchgrass RhizosphereERIPAVAPQLAAVRDHVVREWENERRQRARNDAYARMRDGYEVSILATAPPEQP
Ga0207658_1054040513300025986Switchgrass RhizosphereKAPALAAVHDQVVREWENDRRQRARHDAYTRMRSGYEIRIEAKPPTEPR
Ga0207658_1077117213300025986Switchgrass RhizosphereDQVVREWENDRRQRARNDAYAKMRSGYEIRIEAESSAERR
Ga0207678_1128225623300026067Corn RhizosphereTPAVMPQLTAVRDQVEREWENERRQRARNDAYTKMRGEYQVSIEPKLAADAR
Ga0207708_1095110313300026075Corn, Switchgrass And Miscanthus RhizosphereVVREWENERRQRARNDAYAKMRADYQVSIKTDPAAERR
Ga0207648_1065169213300026089Miscanthus RhizosphereREWENERRQRARQDAYARARGEYQVSIEAKPMTAQP
Ga0209056_1048513813300026538SoilVREWENERRRRARNDAYTKMRGEYQVSIEAKTPTERP
Ga0207490_100237813300026841SoilLAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR
Ga0207582_103192713300026960SoilVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR
Ga0209995_105527113300027471Arabidopsis Thaliana RhizosphereAPQLAAVRDRVVREWENERRQRARNDAYTKMRGEYQVSIETKLATERR
Ga0209968_104531013300027526Arabidopsis Thaliana RhizosphereAPQLAAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETTPATERR
Ga0209999_107072013300027543Arabidopsis Thaliana RhizosphereQLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETALPTERR
Ga0209982_104918823300027552Arabidopsis Thaliana RhizosphereVRDQVVREWENERRQRARNDAYARMRGEYEVSMDAKVPAEQP
Ga0209983_110677513300027665Arabidopsis Thaliana RhizosphereLRDHVVREWENERRQRARNDAYTKMRGEYLVSIETELATERR
Ga0209811_1008356513300027821Surface SoilPAVAPQLTAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR
Ga0209814_1015217213300027873Populus RhizosphereHVVREWENERRQRARNDAYARMRDGYEVSIEATAPTEQP
Ga0209481_1067924123300027880Populus RhizosphereAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETTLATERR
Ga0209382_1191840113300027909Populus RhizosphereRDHVVREWENERRQRARNDAYRKMRGEYQVSIETKPTTERR
Ga0307497_1037091623300031226SoilDHLVREWENERRQRARNDAYTKMRGEYQVSIETKLATKRR
Ga0307506_1047153723300031366SoilALAPQLADVQGQVAREWENERRQHARNEAYTRMRRGYEVAIETKLQADRP
Ga0310886_1076535923300031562SoilIPAVAPQLAAVRDHVVREWENERRQRARNDAYARMRDGYEVSILATAPPEQP
Ga0310907_1018749623300031847SoilLAAVRDQVVREWENERRQRARTDAYAKMRGEYEVSIEAKPAERP
Ga0310907_1070098523300031847SoilAPQLAAVRDHVVREWENERRQRARNDAYAKMRGGYEVSIEAKAPAEGR
Ga0310904_1001628313300031854SoilPQLTAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR
Ga0310892_1062229513300031858SoilLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETTLATERR
Ga0310892_1120081813300031858SoilRDQVVREWENERRQRARNEAYAKMRGEYQVSIETELATERR
Ga0307406_1022912633300031901RhizosphereVRDHVVREWENERRQRARNDAYTTMRGEYQVSIETNLATERR
Ga0310900_1185245223300031908SoilQVVREWENDRRQRARNDAYTKMRGEYRVSIETKPAAER
Ga0310901_1021397313300031940SoilDHVVREWENDRRQRARNDAYAKMRGDYQVSIETTLAAERR
Ga0310885_1007858813300031943SoilVVREWENERRQRARNDAYTKMRGDYQVSIETKLATERR
Ga0307411_1145711923300032005RhizosphereQLAAVRGHVVREWENERRRRARDEAYTRMRNDYQVNIETESATKPAAEPR
Ga0310902_1100920123300032012SoilDHVLREWENERRQRARNDAYAKMRGAYHVSIETEPATERR
Ga0310899_1046456723300032017SoilLSDVRDQVVREWENDRRRQARDDSYANMRRGYVVSIGATLPVEQQ
Ga0310890_1053414223300032075SoilAVVPQLTAVRDQVVREWENERRQRARNEAYAKMRGEYQVSVGTELATERR
Ga0310895_1046047723300032122SoilVRDHVVREWENERRQRARNDAYARMRDGYEVSILATAPPEQP
Ga0310889_1010817023300032179SoilVVREWENDRRLRARADAYGRMRREYEVSIEAALPAGRP
Ga0307471_10417720313300032180Hardwood Forest SoilRDQVVREWENERRQRARNDAYARMRRAYDVTIDTGTRTGRP
Ga0247830_1155496113300033551SoilREWENERRQHARTDSYARMRADYEVSIEATMPKEPR
Ga0364941_012583_1490_16183300034417SedimentAVRDQVVREWENERRQRARNEAYARMRAGYDVSIDTKPLIRP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.