Metagenome / Metatranscriptome Family F033808

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F033808
Family Type	Metagenome / Metatranscriptome
Number of Sequences	176
Average Sequence Length	36 residues
Representative Sequence	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR
Number of Associated Samples	98
Number of Associated Scaffolds	176

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	90.91 %
% of genes near scaffold ends (potentially truncated)	10.23 %
% of genes from short scaffolds (< 2000 bps)	63.07 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (79.545 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (15.341 % of family members)
Environment Ontology (ENVO)	Unclassified (57.386 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (67.614 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 176 Family Scaffolds
PF07235	DUF1427	34.09
PF00154	RecA	13.07
PF01923	Cob_adeno_trans	9.66
PF12705	PDDEXK_1	6.82
PF02075	RuvC	2.27
PF00011	HSP20	1.70
PF03819	MazG	1.70
PF14579	HHH_6	1.14
PF00565	SNase	0.57
PF01930	Cas_Cas4	0.57
PF05257	CHAP	0.57
PF08241	Methyltransf_11	0.57
PF03796	DnaB_C	0.57
PF01135	PCMT	0.57
PF00436	SSB	0.57
PF04488	Gly_transf_sug	0.57
PF05050	Methyltransf_21	0.57
PF10145	PhageMin_Tail	0.57
PF13662	Toprim_4	0.57

COG ID	Name	Functional Category	% Frequency in 176 Family Scaffolds
COG4317	Xanthosine utilization system component, XapX domain	Nucleotide transport and metabolism [F]	34.09
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	13.07
COG0817	Holliday junction resolvasome RuvABC endonuclease subunit RuvC	Replication, recombination and repair [L]	2.27
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	1.70
COG0305	Replicative DNA helicase	Replication, recombination and repair [L]	0.57
COG0629	Single-stranded DNA-binding protein	Replication, recombination and repair [L]	0.57
COG1066	DNA repair protein RadA/Sms, contains AAA+ ATPase domain	Replication, recombination and repair [L]	0.57
COG1468	CRISPR/Cas system-associated exonuclease Cas4, RecB family	Defense mechanisms [V]	0.57
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.57
COG2518	Protein-L-isoaspartate O-methyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.57
COG2519	tRNA A58 N-methylase Trm61	Translation, ribosomal structure and biogenesis [J]	0.57
COG2965	Primosomal replication protein N	Replication, recombination and repair [L]	0.57
COG3774	Mannosyltransferase OCH1 or related enzyme	Cell wall/membrane/envelope biogenesis [M]	0.57
COG4122	tRNA 5-hydroxyU34 O-methylase TrmR/YrrM	Translation, ribosomal structure and biogenesis [J]	0.57

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	86.93 %
Unclassified	root	N/A	13.07 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	85.80 %
Unclassified	root	N/A	13.07 %
cellular organisms	root	All Organisms → cellular organisms	1.14 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	79.55 %
Unclassified	root	N/A	13.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.68 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.14 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	79.55 %
Unclassified	root	N/A	13.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.68 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.57 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	79.55 %
Unclassified	root	N/A	13.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.68 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.57 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	79.55 %
Unclassified	root	N/A	13.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.68 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.57 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	46.59 %
Unclassified	root	N/A	13.07 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.68 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.57 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	46.59 %
Unclassified	root	N/A	13.07 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.68 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.57 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	46.59 %
Unclassified	root	N/A	13.07 %
Samistivirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.68 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.57 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	46.59 %
Unclassified	root	N/A	13.07 %
Streptomyces virus Jay2Jay	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.68 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.57 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	46.59 %
Unclassified	root	N/A	13.07 %
Streptomyces phage Jay2Jay	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	9.09 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.68 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.57 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000736\|JGI12547J11936_1005283	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	3513	Open in IMG/M
3300000756\|JGI12421J11937_10083170	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	919	Open in IMG/M
3300001282\|B570J14230_10191652	Not Available	567	Open in IMG/M
3300002161\|JGI24766J26685_10000008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	46845	Open in IMG/M
3300005517\|Ga0070374_10149819	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1210	Open in IMG/M
3300005527\|Ga0068876_10029064	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3449	Open in IMG/M
3300005527\|Ga0068876_10037691	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2989	Open in IMG/M
3300005527\|Ga0068876_10071026	All Organisms → cellular organisms → Bacteria	2098	Open in IMG/M
3300005527\|Ga0068876_10077107	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2003	Open in IMG/M
3300005527\|Ga0068876_10119868	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1560	Open in IMG/M
3300005527\|Ga0068876_10129112	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1494	Open in IMG/M
3300005527\|Ga0068876_10202222	Not Available	1152	Open in IMG/M
3300005527\|Ga0068876_10764665	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	512	Open in IMG/M
3300005528\|Ga0068872_10182417	All Organisms → Viruses → Predicted Viral	1206	Open in IMG/M
3300005528\|Ga0068872_10411657	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	735	Open in IMG/M
3300005580\|Ga0049083_10170085	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	745	Open in IMG/M
3300005581\|Ga0049081_10185056	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	752	Open in IMG/M
3300005584\|Ga0049082_10000347	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	12779	Open in IMG/M
3300005662\|Ga0078894_10018668	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5573	Open in IMG/M
3300005662\|Ga0078894_10188656	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1864	Open in IMG/M
3300005662\|Ga0078894_10210821	All Organisms → Viruses → Predicted Viral	1759	Open in IMG/M
3300005662\|Ga0078894_10747944	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	859	Open in IMG/M
3300005662\|Ga0078894_10986663	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	726	Open in IMG/M
3300005662\|Ga0078894_11004881	Not Available	717	Open in IMG/M
3300005662\|Ga0078894_11213760	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	638	Open in IMG/M
3300005805\|Ga0079957_1034807	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3279	Open in IMG/M
3300006005\|Ga0073910_1016373	Not Available	520	Open in IMG/M
3300006484\|Ga0070744_10000976	Not Available	8474	Open in IMG/M
3300006484\|Ga0070744_10012372	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2531	Open in IMG/M
3300006639\|Ga0079301_1120602	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	791	Open in IMG/M
3300007545\|Ga0102873_1154274	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	692	Open in IMG/M
3300007559\|Ga0102828_1051961	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	954	Open in IMG/M
3300007559\|Ga0102828_1179205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538	Open in IMG/M
3300007590\|Ga0102917_1136089	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	864	Open in IMG/M
3300007593\|Ga0102918_1128571	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	760	Open in IMG/M
3300007597\|Ga0102919_1043856	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1393	Open in IMG/M
3300008052\|Ga0102893_1170200	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	634	Open in IMG/M
3300008055\|Ga0108970_10898716	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3068	Open in IMG/M
3300008107\|Ga0114340_1002746	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10130	Open in IMG/M
3300008107\|Ga0114340_1005474	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	7364	Open in IMG/M
3300008107\|Ga0114340_1033081	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2356	Open in IMG/M
3300008107\|Ga0114340_1063095	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1584	Open in IMG/M
3300008107\|Ga0114340_1100374	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1159	Open in IMG/M
3300008107\|Ga0114340_1105957	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1723	Open in IMG/M
3300008107\|Ga0114340_1139256	Not Available	911	Open in IMG/M
3300008107\|Ga0114340_1178113	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1266	Open in IMG/M
3300008108\|Ga0114341_10128097	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1504	Open in IMG/M
3300008110\|Ga0114343_1063038	All Organisms → Viruses → Predicted Viral	1387	Open in IMG/M
3300008114\|Ga0114347_1042551	All Organisms → Viruses → Predicted Viral	1979	Open in IMG/M
3300008116\|Ga0114350_1079027	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1098	Open in IMG/M
3300008116\|Ga0114350_1154772	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	633	Open in IMG/M
3300008120\|Ga0114355_1137780	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	888	Open in IMG/M
3300008120\|Ga0114355_1190604	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	675	Open in IMG/M
3300008259\|Ga0114841_1047019	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2119	Open in IMG/M
3300008262\|Ga0114337_1125607	All Organisms → Viruses → Predicted Viral	1152	Open in IMG/M
3300008953\|Ga0104241_1000714	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2662	Open in IMG/M
3300008962\|Ga0104242_1008525	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1821	Open in IMG/M
3300008962\|Ga0104242_1054123	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	675	Open in IMG/M
3300008996\|Ga0102831_1004704	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5193	Open in IMG/M
3300009159\|Ga0114978_10129326	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1642	Open in IMG/M
3300009159\|Ga0114978_10168760	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1399	Open in IMG/M
3300009159\|Ga0114978_10635619	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	614	Open in IMG/M
3300009183\|Ga0114974_10003457	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	11890	Open in IMG/M
3300009183\|Ga0114974_10006440	Not Available	8676	Open in IMG/M
3300009183\|Ga0114974_10541565	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	648	Open in IMG/M
3300009183\|Ga0114974_10787302	Not Available	511	Open in IMG/M
3300010354\|Ga0129333_10688613	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	880	Open in IMG/M
3300011116\|Ga0151516_10663	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	15963	Open in IMG/M
3300012012\|Ga0153799_1000162	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	23531	Open in IMG/M
3300012017\|Ga0153801_1031444	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	938	Open in IMG/M
3300012666\|Ga0157498_1022136	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	989	Open in IMG/M
3300012779\|Ga0138284_1349353	Not Available	561	Open in IMG/M
3300013004\|Ga0164293_10656056	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	676	Open in IMG/M
3300013087\|Ga0163212_1085585	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1022	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10446127	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	722	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10059717	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3179	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10367150	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	906	Open in IMG/M
3300013295\|Ga0170791_11427432	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1306	Open in IMG/M
3300013372\|Ga0177922_10251216	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	763	Open in IMG/M
3300013372\|Ga0177922_10574871	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1022	Open in IMG/M
3300013372\|Ga0177922_11108788	Not Available	845	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10123326	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	1786	Open in IMG/M
3300017723\|Ga0181362_1059539	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	785	Open in IMG/M
3300017788\|Ga0169931_10026531	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	7068	Open in IMG/M
3300017788\|Ga0169931_10176361	All Organisms → Viruses → Predicted Viral	1867	Open in IMG/M
3300019146\|Ga0188881_10037715	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	600	Open in IMG/M
3300019146\|Ga0188881_10044992	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	548	Open in IMG/M
3300019784\|Ga0181359_1041412	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	1784	Open in IMG/M
3300019784\|Ga0181359_1204924	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	632	Open in IMG/M
3300020048\|Ga0207193_1035772	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5580	Open in IMG/M
3300020048\|Ga0207193_1057221	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	3982	Open in IMG/M
3300020074\|Ga0194113_10027824	Not Available	5995	Open in IMG/M
3300020074\|Ga0194113_10049588	Not Available	4089	Open in IMG/M
3300020074\|Ga0194113_10089840	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	2737	Open in IMG/M
3300020074\|Ga0194113_10099005	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	2563	Open in IMG/M
3300020074\|Ga0194113_11101340	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	524	Open in IMG/M
3300020084\|Ga0194110_10301059	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1133	Open in IMG/M
3300020141\|Ga0211732_1013266	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	512	Open in IMG/M
3300020141\|Ga0211732_1231842	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1325	Open in IMG/M
3300020141\|Ga0211732_1284207	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4543	Open in IMG/M
3300020151\|Ga0211736_10136019	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	674	Open in IMG/M
3300020151\|Ga0211736_10136504	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2116	Open in IMG/M
3300020151\|Ga0211736_10586991	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	592	Open in IMG/M
3300020151\|Ga0211736_10966384	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6088	Open in IMG/M
3300020159\|Ga0211734_10139596	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	895	Open in IMG/M
3300020159\|Ga0211734_10322587	Not Available	612	Open in IMG/M
3300020161\|Ga0211726_10096231	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2290	Open in IMG/M
3300020161\|Ga0211726_10385521	Not Available	17182	Open in IMG/M
3300020179\|Ga0194134_10017405	All Organisms → Viruses → Predicted Viral	4957	Open in IMG/M
3300020190\|Ga0194118_10178704	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1224	Open in IMG/M
3300020196\|Ga0194124_10206066	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1009	Open in IMG/M
3300020198\|Ga0194120_10454039	Not Available	589	Open in IMG/M
3300020222\|Ga0194125_10140618	All Organisms → Viruses → Predicted Viral	1865	Open in IMG/M
3300020519\|Ga0208223_1000366	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	11363	Open in IMG/M
3300020519\|Ga0208223_1015125	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1145	Open in IMG/M
3300020533\|Ga0208364_1001165	Not Available	5399	Open in IMG/M
3300020572\|Ga0207909_1008242	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	2158	Open in IMG/M
3300021376\|Ga0194130_10066038	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2491	Open in IMG/M
3300021961\|Ga0222714_10009917	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	8303	Open in IMG/M
3300021961\|Ga0222714_10033771	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3761	Open in IMG/M
3300021961\|Ga0222714_10276320	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	931	Open in IMG/M
3300021962\|Ga0222713_10009045	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9113	Open in IMG/M
3300021962\|Ga0222713_10012879	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7390	Open in IMG/M
3300021962\|Ga0222713_10081486	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	2364	Open in IMG/M
3300021962\|Ga0222713_10093353	All Organisms → Viruses → Predicted Viral	2172	Open in IMG/M
3300021962\|Ga0222713_10137851	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	1700	Open in IMG/M
3300021962\|Ga0222713_10297793	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1029	Open in IMG/M
3300021963\|Ga0222712_10198404	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1316	Open in IMG/M
3300021963\|Ga0222712_10213000	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1257	Open in IMG/M
3300021963\|Ga0222712_10216106	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	1245	Open in IMG/M
3300021963\|Ga0222712_10226890	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1207	Open in IMG/M
3300021963\|Ga0222712_10654096	Not Available	599	Open in IMG/M
3300021963\|Ga0222712_10692323	Not Available	575	Open in IMG/M
3300022752\|Ga0214917_10076837	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay	2064	Open in IMG/M
3300023174\|Ga0214921_10013094	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	9793	Open in IMG/M
3300023174\|Ga0214921_10020790	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7008	Open in IMG/M
3300023174\|Ga0214921_10084107	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay	2494	Open in IMG/M
3300023174\|Ga0214921_10578311	Not Available	509	Open in IMG/M
3300024289\|Ga0255147_1002477	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4472	Open in IMG/M
3300024346\|Ga0244775_10069684	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay	3017	Open in IMG/M
3300024346\|Ga0244775_10206395	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1647	Open in IMG/M
3300024346\|Ga0244775_10247159	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay	1487	Open in IMG/M
3300027142\|Ga0255065_1087715	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	522	Open in IMG/M
3300027499\|Ga0208788_1124023	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	589	Open in IMG/M
3300027586\|Ga0208966_1000016	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	64675	Open in IMG/M
3300027659\|Ga0208975_1005815	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	4512	Open in IMG/M
3300027720\|Ga0209617_10175530	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	834	Open in IMG/M
3300027759\|Ga0209296_1000586	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	31699	Open in IMG/M
3300027759\|Ga0209296_1004956	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	8610	Open in IMG/M
3300027759\|Ga0209296_1293906	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	648	Open in IMG/M
3300027769\|Ga0209770_10081824	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1344	Open in IMG/M
3300027793\|Ga0209972_10020553	All Organisms → Viruses	4053	Open in IMG/M
3300027793\|Ga0209972_10086629	All Organisms → Viruses → Predicted Viral	1601	Open in IMG/M
3300027793\|Ga0209972_10105868	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1405	Open in IMG/M
3300027805\|Ga0209229_10000004	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	91329	Open in IMG/M
(restricted) 3300027970\|Ga0247837_1285726	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	630	Open in IMG/M
3300028025\|Ga0247723_1001664	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	12647	Open in IMG/M
3300028025\|Ga0247723_1031753	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	1654	Open in IMG/M
3300028025\|Ga0247723_1033092	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1607	Open in IMG/M
3300028025\|Ga0247723_1097059	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	749	Open in IMG/M
3300031758\|Ga0315907_10146773	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	2000	Open in IMG/M
3300031758\|Ga0315907_10520492	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	937	Open in IMG/M
3300031758\|Ga0315907_10998622	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	604	Open in IMG/M
3300031784\|Ga0315899_11180394	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	665	Open in IMG/M
3300031857\|Ga0315909_10312435	Not Available	1168	Open in IMG/M
3300031857\|Ga0315909_10492209	Not Available	849	Open in IMG/M
3300031951\|Ga0315904_10040392	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5316	Open in IMG/M
3300031951\|Ga0315904_10693206	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	858	Open in IMG/M
3300032050\|Ga0315906_11151251	Not Available	567	Open in IMG/M
3300033816\|Ga0334980_0370730	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	546	Open in IMG/M
3300034063\|Ga0335000_0048435	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3054	Open in IMG/M
3300034073\|Ga0310130_0001350	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13580	Open in IMG/M
3300034093\|Ga0335012_0083624	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay	1800	Open in IMG/M
3300034101\|Ga0335027_0040908	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay	3809	Open in IMG/M
3300034116\|Ga0335068_0006809	Not Available	7433	Open in IMG/M
3300034272\|Ga0335049_0562459	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	714	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.43%
Host-Associated	Host-Associated	0.57%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	94.89%
Terrestrial	Environmental → Terrestrial	4.55%
Plants	Host-Associated → Plants	0.57%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	78.41%
Marine	Environmental → Aquatic → Marine	16.48%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	3.98%
Soil	Environmental → Terrestrial → Soil	0.57%
Leaf	Host-Associated → Plants → Leaf	0.57%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	48.30%
Lentic	Environmental → Aquatic → Freshwater → Lentic	23.86%
Unclassified	Environmental → Aquatic → Marine → Unclassified	11.36%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	5.11%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	4.55%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	3.98%
River	Environmental → Aquatic → Freshwater → River	1.14%
Coastal	Environmental → Aquatic → Marine → Coastal	0.57%
Sand	Environmental → Terrestrial → Soil → Sand	0.57%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	47.16%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	19.32%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	11.36%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	5.11%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	4.55%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	3.98%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	3.98%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.14%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.14%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.57%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.57%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.57%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	15.34%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	11.93%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	11.36%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	9.66%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	8.52%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	6.82%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	6.25%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	5.11%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	4.55%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.84%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.84%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.84%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	2.27%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment	1.14%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.14%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	1.14%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.14%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.14%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.57%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.57%
Freshwater, Surface Ice	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice	0.57%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.57%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.57%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.57%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.57%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000736	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011	Environmental	Open in IMG/M
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006005	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300007545	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007590	Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02	Environmental	Open in IMG/M
3300007593	Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3	Environmental	Open in IMG/M
3300007597	Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02	Environmental	Open in IMG/M
3300008052	Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300008262	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA	Environmental	Open in IMG/M
3300008953	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4	Environmental	Open in IMG/M
3300008962	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300011116	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012666	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2	Environmental	Open in IMG/M
3300012779	Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013087	Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental	Open in IMG/M
3300019146	Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020084	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020179	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m	Environmental	Open in IMG/M
3300020190	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface	Environmental	Open in IMG/M
3300020196	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m	Environmental	Open in IMG/M
3300020198	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m	Environmental	Open in IMG/M
3300020222	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m	Environmental	Open in IMG/M
3300020519	Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020533	Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020572	Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021376	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024289	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300027142	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h	Environmental	Open in IMG/M
3300027499	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027586	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027720	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027970 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12547J11936_10052838	3300000736	Freshwater And Sediment	MELFLICGIAIGFLVGYPLGLFINKLDKDIKNDAR*
JGI12421J11937_100831702	3300000756	Freshwater And Sediment	MEMFLLCGIAIGFLIGYPMGLFIDKLDKRIKNGGR*
B570J14230_101916521	3300001282	Freshwater	VCIMELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
JGI24766J26685_1000000820	3300002161	Freshwater And Sediment	MEIFLLGMMIGFAVGYPMGLFVDKLDKKEKAKNGGR*
Ga0070374_101498195	3300005517	Freshwater Lake	MELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG*
Ga0068876_100290643	3300005527	Freshwater Lake	MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKHGGR*
Ga0068876_100376917	3300005527	Freshwater Lake	MEMFLIAGIAIGFLIGYPFGLFIDKLDKKEKAKNVN*
Ga0068876_100710266	3300005527	Freshwater Lake	MEVFILGAMLGFIIGYPMGLFIDKLDKRERTKNGR*
Ga0068876_100771072	3300005527	Freshwater Lake	MEMFLIAGIAIGFLIGYPLGLFVDKLDKREKAKNGGR*
Ga0068876_101198682	3300005527	Freshwater Lake	MEIFLLGIMIGFAVGYPMGLFIDKLDKREKAKNGGR*
Ga0068876_101291124	3300005527	Freshwater Lake	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKSGGR*
Ga0068876_102022222	3300005527	Freshwater Lake	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR*
Ga0068876_107646653	3300005527	Freshwater Lake	MEMFLLCGIAIGFLIGYPLGLFIDKLDKREKAKNGGR*
Ga0068872_101824174	3300005528	Freshwater Lake	MEMFLLGMMIGFIVGYPTGLFIDKLDKREKAKSGGR*
Ga0068872_104116572	3300005528	Freshwater Lake	MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0049083_101700853	3300005580	Freshwater Lentic	MEMFFFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR*
Ga0049081_101850563	3300005581	Freshwater Lentic	MEMFLIAGISIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0049082_1000034716	3300005584	Freshwater Lentic	MEIFLFSGIAIGFLIGYPIGLFIDNLNKKENKKNGR*
Ga0078894_100186687	3300005662	Freshwater Lake	MNMFLLGLGIGFVIGYAMGLFIDKLDKREKAKNGGR*
Ga0078894_101886566	3300005662	Freshwater Lake	MEMFIMGIMIGFIVGYPTGLFIDKLDKREKAKSGGR*
Ga0078894_102108212	3300005662	Freshwater Lake	MEMFLLGMMIGFIIGYPVGLFIDKLDKRERAKNGR*
Ga0078894_107479443	3300005662	Freshwater Lake	ELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
Ga0078894_109866632	3300005662	Freshwater Lake	VIEVLLIGIMIGFIAGYPMGLFIDRLDKKEKAKNGGR*
Ga0078894_110048811	3300005662	Freshwater Lake	MEMFLLCGIAIGFLIGYPLGLFIDKLDKREKAKNVN*
Ga0078894_112137602	3300005662	Freshwater Lake	VEIFLISGIAIGFLIGYPLGLFIDKLDKKEKDKNGGR*
Ga0079957_10348076	3300005805	Lake	MTTLTIFILGSMVGFVVGYGFGLFIDKLDKKEKEKNGGR*
Ga0073910_10163731	3300006005	Sand	MEIFLFSGIAIGFLIGYPIGLFIDSLNKKENKKNGR*
Ga0070744_100009762	3300006484	Estuarine	MEMFLLGMMLGFIIGYPVGLFIDKLDKRERAKNGR*
Ga0070744_100123723	3300006484	Estuarine	MEMFFLCGIAVGFLIGYPMGLFIDKLDNRIKNGGR*
Ga0079301_11206021	3300006639	Deep Subsurface	MEMFLIAGIAIGFLIGYPLGLFIDKLDKRERAKNGGR*
Ga0102873_11542742	3300007545	Estuarine	MEMFLICGIAIGFLIGYPLGLFIDKWDKRIKNDRG*
Ga0102828_10519613	3300007559	Estuarine	MEMFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG*
Ga0102828_11792053	3300007559	Estuarine	MEMFLLGMMLGFIIGYPVGLVRDKLDKRERAKNGR*
Ga0102917_11360894	3300007590	Estuarine	MTTFLFGLLIGFAFGYPMGLFIDYLDKKEKRKQRVD
Ga0102918_11285713	3300007593	Estuarine	RKVCIMELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG*
Ga0102919_10438565	3300007597	Estuarine	MELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG*
Ga0102893_11702003	3300008052	Estuarine	CIMELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG*
Ga0108970_108987165	3300008055	Estuary	MDILLLGIMIGFAIGYPMGLFIDKLDKREKAKHGG*
Ga0114340_10027466	3300008107	Freshwater, Plankton	MEMFLIAGIAIGFLIGYPFGLFIDKLDKKEKAKNGGR*
Ga0114340_100547413	3300008107	Freshwater, Plankton	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKHGGR*
Ga0114340_10330812	3300008107	Freshwater, Plankton	MEMFLIAGIAIGFLFGYPLGLFIDKLDKKEKAKNVN*
Ga0114340_10630956	3300008107	Freshwater, Plankton	MEIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKNGGR*
Ga0114340_11003744	3300008107	Freshwater, Plankton	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNVN*
Ga0114340_11059575	3300008107	Freshwater, Plankton	MEMFLIAGIAIGFLIGYPLGLFIDKLDKRERAKNGR*
Ga0114340_11392563	3300008107	Freshwater, Plankton	MEMFLIAGTAIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0114340_11781135	3300008107	Freshwater, Plankton	MEVFILGIMLGFVVGYPTGLFIDKLDKREKAKSGGR*
Ga0114341_101280976	3300008108	Freshwater, Plankton	MDLFILGILIGFALGYPLGLFIDKLDKKEKAKNGGR*
Ga0114343_10630381	3300008110	Freshwater, Plankton	MEIFILGAMLGFIIGYPMGLFIDKLDKRERTKNGR*
Ga0114347_10425513	3300008114	Freshwater, Plankton	MEIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKHGGR*
Ga0114350_10790274	3300008116	Freshwater, Plankton	MDIMSLFLIGAGIGFIVGYATGLFIDKLDKREKAKNAERA*
Ga0114350_11547722	3300008116	Freshwater, Plankton	MEMFFVCGIAVGFFIGYPFGLFINNLDKKEKAKNGGR*
Ga0114355_11377801	3300008120	Freshwater, Plankton	MDIMSLFLIGAGIGFIVGYATGLFIDKLDKREKAKNA
Ga0114355_11906043	3300008120	Freshwater, Plankton	MDIFILGIMIGFVIGYPMGLFIDKLDKREKAKNGGR*
Ga0114841_10470195	3300008259	Freshwater, Plankton	MEMFLIAGITIGFLIGYPLGLFIDKLDKREKAKNGGR*
Ga0114337_11256071	3300008262	Freshwater, Plankton	SWKAFIMEIFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
Ga0104241_10007142	3300008953	Freshwater	MDLFILGILIGFALGYPLGLFIDKLDKREKAKNGGR*
Ga0104242_10085253	3300008962	Freshwater	MEAIFLMEMFLICGIAIGFLIGYPLGLFIDQIDKRIKNDRG*
Ga0104242_10541232	3300008962	Freshwater	MEMFLLCGIAIGFLVGYPLGLFIDKLDKDIKNDRR*
Ga0102831_10047049	3300008996	Estuarine	MEMFLICGMAIGFLVGYPLGLFINKLDKDIKNDAR*
Ga0114978_101293265	3300009159	Freshwater Lake	MELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
Ga0114978_101687603	3300009159	Freshwater Lake	MEMFLLCGMAIGFLVGYPLGLFIDKLDKDIKNDRR*
Ga0114978_106356193	3300009159	Freshwater Lake	MEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG*
Ga0114974_100034577	3300009183	Freshwater Lake	MEMFFICGIAVGFLIGYPMGLFIDKLDKRIKNGGR*
Ga0114974_1000644012	3300009183	Freshwater Lake	MEIFLFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR*
Ga0114974_105415651	3300009183	Freshwater Lake	MEMFFVCGIAVGFLIGYPFGLFINNLDKKEKAKNGGR*
Ga0114974_107873022	3300009183	Freshwater Lake	MEMFLLCGIAIGFLIGYPMGLFINKLDKRIKNGGR*
Ga0129333_106886132	3300010354	Freshwater To Marine Saline Gradient	MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKVKNGGR*
Ga0151516_1066321	3300011116	Freshwater	MEMFFLCGIALGFLIGYPLGLFIDKLDKRTKNGGR*
Ga0153799_100016227	3300012012	Freshwater	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNVGR*
Ga0153801_10314445	3300012017	Freshwater	MEMFLIAGTAIGFLIGYPLGLFIDKLDKREKAKNVGR*
Ga0157498_10221364	3300012666	Freshwater, Surface Ice	MEIFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
Ga0138284_13493533	3300012779	Freshwater Lake	MSMFFICGVAVGFLIGYPMGLFIDKLDKRIKNGGR*
Ga0164293_106560563	3300013004	Freshwater	MNMFLLGLGIGFVIGYAMGLFIDKLDKRERAKNDTR*
Ga0163212_10855852	3300013087	Freshwater	MTTMAIFLMGIGIGFVIGYPVGLFIDKLDKREKKKNDGR*
(restricted) Ga0172367_104461272	3300013126	Freshwater	MEMFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNDKR*
(restricted) Ga0172373_100597175	3300013131	Freshwater	MEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGRR*
(restricted) Ga0172373_103671502	3300013131	Freshwater	MEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0170791_114274322	3300013295	Freshwater	MEMFLLCGIAVGFLIGYPMGLFIDKLDKRIKNGGR*
Ga0177922_102512163	3300013372	Freshwater	MEMFFLCGIAIGFLIGYPLGLFIDKLDKREKAKNGGR*
Ga0177922_105748712	3300013372	Freshwater	MEMFLFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR*
Ga0177922_111087883	3300013372	Freshwater	SEVYIMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR*
(restricted) Ga0172376_101233266	3300014720	Freshwater	MDIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0181362_10595394	3300017723	Freshwater Lake	MEMFFLCGIAVGFLIRYPMGLFIDKLDKRIKNGGR
Ga0169931_100265319	3300017788	Freshwater	MEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR
Ga0169931_101763615	3300017788	Freshwater	MEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGRR
Ga0188881_100377154	3300019146	Freshwater Lake	MEMFLLGMMIGFIVGYPTGLFIDKLDKREKAKSGGR
Ga0188881_100449922	3300019146	Freshwater Lake	MEIFLISGIAIGFLIGYPLGLFIDKLDKREKAKNVN
Ga0181359_10414123	3300019784	Freshwater Lake	MEMFFFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR
Ga0181359_12049241	3300019784	Freshwater Lake	MELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG
Ga0207193_10357729	3300020048	Freshwater Lake Sediment	MEMFLLGMMLGFIIGYPVGLFIDKLDKRERAKNGR
Ga0207193_10572215	3300020048	Freshwater Lake Sediment	MEIFLLGMMLGFVVGYPIGLFIDKLDKRERAKNGRR
Ga0194113_100278248	3300020074	Freshwater Lake	METMFIFLTGICIGFVIGYPFGLFIDKLDKREKRKNGGR
Ga0194113_100495886	3300020074	Freshwater Lake	MEATFIFLTGIGIGFVIGYPVGLFIDKLDKKIKSRT
Ga0194113_100898405	3300020074	Freshwater Lake	METMFIFLAGIGVGFVIGYPVGLFIDKLDKREKRKNGG
Ga0194113_100990053	3300020074	Freshwater Lake	METMFIFLTGIGIGFVIGYPVGLFIDKLDKREKKKNDGR
Ga0194113_111013401	3300020074	Freshwater Lake	METMFIFLAGIGVGFVMGYPVGLFIDKLDKREKRKNGG
Ga0194110_103010595	3300020084	Freshwater Lake	METMFIFLAGIGIGFVIGYPVGLFIDKLDKREKRKNGGR
Ga0211732_10132662	3300020141	Freshwater	MEMFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG
Ga0211732_12318426	3300020141	Freshwater	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR
Ga0211732_12842075	3300020141	Freshwater	MEMFLLSGIAIGFLVGYPLGLFIDKLDKRIKNDRG
Ga0211736_101360193	3300020151	Freshwater	MEMFFLCGIAIGFLIGYPLGLFIDKLDKKEKAKNVN
Ga0211736_101365046	3300020151	Freshwater	MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNVK
Ga0211736_105869914	3300020151	Freshwater	MEMFLIAGISIGFLIGYPLGLFIDKLDKREKAKNGGR
Ga0211736_109663848	3300020151	Freshwater	MEMFLFSGIAIGFLIGYPFGLFIDKLDKKEKAKNGGR
Ga0211734_101395961	3300020159	Freshwater	MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNVN
Ga0211734_103225872	3300020159	Freshwater	MEVILLMEMFFLCGIAIGFLIGYPLGLFIDQIDKRIKNNGR
Ga0211726_100962312	3300020161	Freshwater	MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR
Ga0211726_103855219	3300020161	Freshwater	MEMFFLCGIAIGFLIGYPLGLFIDQIDKRIKNNGR
Ga0194134_100174058	3300020179	Freshwater Lake	METMFIFLAGIGVGFVMGYPVGLFIDKLDKREKRKNGGR
Ga0194118_101787045	3300020190	Freshwater Lake	MFIFLAGIGIGFVIGYPVGLFIDKLDKREKRKNGGR
Ga0194124_102060665	3300020196	Freshwater Lake	METMLIFLTGICIGFVIGYPFGLFIDKLDKREKRKNF
Ga0194120_104540393	3300020198	Freshwater Lake	MFIFLTGIGIGFVIGYPVGLFIDKLDKREKRKNGGR
Ga0194125_101406186	3300020222	Freshwater Lake	MFIFLAGIGVGFVMGYPVGLFIDKLDKREKRKNGGR
Ga0208223_10003665	3300020519	Freshwater	MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKVKHGGR
Ga0208223_10151256	3300020519	Freshwater	VEIFLISGIAIGFLIGYPLGLFINKLDKKEKDKNGGR
Ga0208364_10011652	3300020533	Freshwater	MEMFLIAGIAIGFVIGYPLGLFIDKLDKKEKAKHGGR
Ga0207909_10082424	3300020572	Freshwater	VELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR
Ga0194130_100660385	3300021376	Freshwater Lake	TMLIFLTGICIGFVIGYPFGLFIDKLDKREKRKNGGR
Ga0222714_100099173	3300021961	Estuarine Water	MDLFILGILIGFALGYPLGLFIDKLDKKEKAKNGGR
Ga0222714_100337717	3300021961	Estuarine Water	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKSGGR
Ga0222714_102763203	3300021961	Estuarine Water	MEMFLVSGIAIGFLIGYPLGLFVDKLDKRIKDDRR
Ga0222713_1000904517	3300021962	Estuarine Water	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKDGGR
Ga0222713_100128797	3300021962	Estuarine Water	MDIFILGILVGFAFGYPMGLFIDKLDKREKAKNGGR
Ga0222713_100814863	3300021962	Estuarine Water	MEMFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR
Ga0222713_100933534	3300021962	Estuarine Water	MEVFILGIMLGFVVGYPTGLFIDKLDKREKAKSGGR
Ga0222713_101378513	3300021962	Estuarine Water	MEVFLLGMMIGFAVGYPMGLFIDKLDKREKVKSGGR
Ga0222713_102977933	3300021962	Estuarine Water	MEMFLICGIAIGFLIGYPLGLFIDKWDKRIKNDRG
Ga0222712_101984041	3300021963	Estuarine Water	MDLFILGILIGFACGYPIGLFIDKLDKKEKAKNGGR
Ga0222712_102130006	3300021963	Estuarine Water	MTTLTIFILGSMVGFVVGYGFGLFIDKLDKKEKEKNGGR
Ga0222712_102161063	3300021963	Estuarine Water	YCSKVYLMEIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKNGGR
Ga0222712_102268903	3300021963	Estuarine Water	MEMFLICGMAIGFLVGYPLGLFINKLDKDIKNDAR
Ga0222712_106540962	3300021963	Estuarine Water	MEMFLLCGMAIGFLVGYPLGLFIDKLDKDIKNDRR
Ga0222712_106923231	3300021963	Estuarine Water	IMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR
Ga0214917_100768374	3300022752	Freshwater	MEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDAR
Ga0214921_100130943	3300023174	Freshwater	MEMFLLCGIAIGFLVGYPLGLFIDKLDKDIKNDRR
Ga0214921_1002079016	3300023174	Freshwater	MEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG
Ga0214921_100841075	3300023174	Freshwater	MEMFLICGIAIGFLIGYPLGLFIDQIDKRIKNDRG
Ga0214921_105783112	3300023174	Freshwater	MEMFLICGIAIGFLVGYPLGLFIDKIDKDIKNGRR
Ga0255147_10024775	3300024289	Freshwater	MTMLAVFLLGIGVGFLIGYPFGLFINYLDKKEKSKNGR
Ga0244775_100696843	3300024346	Estuarine	MEMFFLCGIAVGFLIGYPMGLFIDKLDNRIKNGGR
Ga0244775_102063952	3300024346	Estuarine	MELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG
Ga0244775_102471596	3300024346	Estuarine	MEVFILGAMLGFIIGYPMGLFIDKLDKRERTKNGR
Ga0255065_10877152	3300027142	Freshwater	MEMFLISGIAIGFVIGYPLGLFIDKLDKKEKAKHGGR
Ga0208788_11240232	3300027499	Deep Subsurface	MEMFLIAGIAIGFLIGYPLGLFIDKLDKRERAKNGGR
Ga0208966_100001665	3300027586	Freshwater Lentic	MEIFLFSGIAIGFLIGYPIGLFIDNLNKKENKKNGR
Ga0208975_10058159	3300027659	Freshwater Lentic	MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGG
Ga0209617_101755302	3300027720	Freshwater And Sediment	MEMFLLCGIAIGFLIGYPMGLFIDKLDKRIKNGGR
Ga0209296_100058612	3300027759	Freshwater Lake	MEMFFICGVAVGFLIGYPMGLFIDKLDKRIKNGGR
Ga0209296_10049562	3300027759	Freshwater Lake	MEIFLFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR
Ga0209296_12939061	3300027759	Freshwater Lake	MEMFFVCGIAVGFLIGYPFGLFINNLDKKEKAKNGGR
Ga0209770_100818242	3300027769	Freshwater Lake	MEMFLLGMMIGFIIGYPVGLFIDKLDKRERAKNGR
Ga0209972_100205533	3300027793	Freshwater Lake	MEVFILGAMLGFIIGYPMGLFIDKLDNRERTKNGR
Ga0209972_100866294	3300027793	Freshwater Lake	MEMLLLGMMIGFIVGYPTGLFIDKLDKREKAKSGGR
Ga0209972_101058685	3300027793	Freshwater Lake	MEMFLIAGTAIGFLIGYPLGLFIDKLDKKEKAKNGGR
Ga0209229_1000000492	3300027805	Freshwater And Sediment	MEIFLLGMMIGFAVGYPMGLFVDKLDKKEKAKNGGR
(restricted) Ga0247837_12857263	3300027970	Freshwater	MEMFFLCGIAVGFLIGYPLGLFIDKLDKREKAKNGGR
Ga0247723_100166417	3300028025	Deep Subsurface Sediment	MSMFLLGIMLGFVVGYAMGLFIDKLDKRERNKNGRR
Ga0247723_10317532	3300028025	Deep Subsurface Sediment	MEMFLIAGIAIGFLIGYPLGLFVDKLDKREKAKNGGR
Ga0247723_10330923	3300028025	Deep Subsurface Sediment	MEMFLFCGIAIGFLIGYPFGLFIDNLDKKEKAKNAIK
Ga0247723_10970593	3300028025	Deep Subsurface Sediment	MEIFLIAGIAIGFLIGYPLGLFIDKLDKREKAKDGGR
Ga0315907_101467734	3300031758	Freshwater	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNVN
Ga0315907_105204924	3300031758	Freshwater	MEMFLIAGIAIGFLFGYPLGLFIDKLDKKEKAKNVN
Ga0315907_109986222	3300031758	Freshwater	MEMFFVCGIAVGFFIGYPFGLFINNLDKKEKAKNGGR
Ga0315899_111803943	3300031784	Freshwater	VCIMNMFLLGLGIGFVIGYAMGLFIDKLDKREKAKNGGR
Ga0315909_103124353	3300031857	Freshwater	MNEMFLVSGIAIGFIIGYPFGLFIDKLDKKEKAKNGGR
Ga0315909_104922093	3300031857	Freshwater	IFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKNGGR
Ga0315904_100403925	3300031951	Freshwater	MDIMSLFLIGAGIGFIVGYATGLFIDKLDKKEKAKNAERA
Ga0315904_106932063	3300031951	Freshwater	MNVTLLITGIAIGFVMGYPFGLFINKLDKKEKAKNGGR
Ga0315906_111512511	3300032050	Freshwater	YLMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR
Ga0334980_0370730_381_494	3300033816	Freshwater	VEIFLISGIAIGFLIGYPLGLFIDKLDKKEKDKNGGR
Ga0335000_0048435_697_810	3300034063	Freshwater	MEMFLLCGIAIGFLIGYPLGLFVNKLDKREKAKNGGR
Ga0310130_0001350_6314_6424	3300034073	Fracking Water	MELFMLGMTIGLAFGYSLGLFIDKLDKKEKAKNVGR
Ga0335012_0083624_485_595	3300034093	Freshwater	MNMFLLGLGIGFVIGYAMGLFIDKLDKRERAKNDTR
Ga0335027_0040908_1229_1342	3300034101	Freshwater	VEIFLISGIAIGFLIGYPLGLFIDKLDKKERDKNGGR
Ga0335068_0006809_6922_7035	3300034116	Freshwater	MEMFLIAGIAIGFLIGYPLGLFIDKLDKKERAKNGGR
Ga0335049_0562459_547_660	3300034272	Freshwater	MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKDKNGGR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters