NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033438

Metagenome / Metatranscriptome Family F033438

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033438
Family Type Metagenome / Metatranscriptome
Number of Sequences 177
Average Sequence Length 134 residues
Representative Sequence MDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Number of Associated Samples 129
Number of Associated Scaffolds 177

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.57 %
% of genes near scaffold ends (potentially truncated) 61.58 %
% of genes from short scaffolds (< 2000 bps) 98.87 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.305 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(24.294 % of family members)
Environment Ontology (ENVO) Unclassified
(76.271 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(67.232 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.59%    β-sheet: 10.14%    Coil/Unstructured: 45.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 177 Family Scaffolds
PF09278MerR-DNA-bind 0.56
PF03931Skp1_POZ 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 177 Family Scaffolds
COG0789DNA-binding transcriptional regulator, MerR familyTranscription [K] 0.56

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.31 %
UnclassifiedrootN/A1.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006424|Ga0075497_1520982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300007231|Ga0075469_10166150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300007554|Ga0102820_1129972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300009022|Ga0103706_10165171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300009193|Ga0115551_1388184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300009434|Ga0115562_1150983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani866Open in IMG/M
3300009434|Ga0115562_1254639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300009436|Ga0115008_11093684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300009436|Ga0115008_11153549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300009445|Ga0115553_1250852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani692Open in IMG/M
3300009495|Ga0115571_1178003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani879Open in IMG/M
3300009495|Ga0115571_1201491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300009497|Ga0115569_10256683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300009507|Ga0115572_10773740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300009544|Ga0115006_10840809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani810Open in IMG/M
3300009606|Ga0115102_10218609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300009606|Ga0115102_10653487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani676Open in IMG/M
3300009608|Ga0115100_10910858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300009677|Ga0115104_11138562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300009679|Ga0115105_10552718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300010985|Ga0138326_10243882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300010987|Ga0138324_10577363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300012412|Ga0138266_1193995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300012416|Ga0138259_1504845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300012419|Ga0138260_10103580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300012419|Ga0138260_10217264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300012419|Ga0138260_11015101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300012504|Ga0129347_1124797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300012518|Ga0129349_1381433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300012520|Ga0129344_1072272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300012523|Ga0129350_1007782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300012528|Ga0129352_10290411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300012767|Ga0138267_1183201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300012782|Ga0138268_1391741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300012782|Ga0138268_1598519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300012954|Ga0163111_11041552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300012954|Ga0163111_11232459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300012954|Ga0163111_11239457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani729Open in IMG/M
3300012954|Ga0163111_11629543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300012963|Ga0129340_1166778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300018418|Ga0181567_10851239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300018426|Ga0181566_10548088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani808Open in IMG/M
3300018428|Ga0181568_11249742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300018599|Ga0188834_1021411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300018617|Ga0193133_1019713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300018714|Ga0193349_1034943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani712Open in IMG/M
3300018730|Ga0192967_1033632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani851Open in IMG/M
3300018742|Ga0193138_1048935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300018745|Ga0193000_1048553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300018745|Ga0193000_1066697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300018765|Ga0193031_1054764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300018765|Ga0193031_1080197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300018832|Ga0194240_1020880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani615Open in IMG/M
3300018842|Ga0193219_1056382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani604Open in IMG/M
3300018874|Ga0192977_1073959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300018905|Ga0193028_1075968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani665Open in IMG/M
3300018932|Ga0192820_10109994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300018932|Ga0192820_10148444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300018967|Ga0193178_10063189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300018989|Ga0193030_10139340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani778Open in IMG/M
3300018989|Ga0193030_10141161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani774Open in IMG/M
3300018989|Ga0193030_10156056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300018989|Ga0193030_10185253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300018989|Ga0193030_10209435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300018989|Ga0193030_10214078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300019010|Ga0193044_10228293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300019032|Ga0192869_10233528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300019032|Ga0192869_10297074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300019032|Ga0192869_10364528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300019036|Ga0192945_10194730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300019036|Ga0192945_10233157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300019045|Ga0193336_10424712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300019045|Ga0193336_10634618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300019050|Ga0192966_10165681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani788Open in IMG/M
3300019051|Ga0192826_10329605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300019051|Ga0192826_10362171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300019081|Ga0188838_107641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300019081|Ga0188838_107643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300019081|Ga0188838_108211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300019102|Ga0194243_1008384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300019129|Ga0193436_1062507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300019262|Ga0182066_1376460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300019266|Ga0182061_1677114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300019272|Ga0182059_1046744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300019276|Ga0182067_1163502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300020014|Ga0182044_1230501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300020207|Ga0181570_10513296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300021336|Ga0210307_1166017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300021353|Ga0206693_1062154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300021902|Ga0063086_1030537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300021912|Ga0063133_1039346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300021921|Ga0063870_1046007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300021922|Ga0063869_1079317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300021922|Ga0063869_1083365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300021924|Ga0063085_1033790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300021924|Ga0063085_1071675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300021924|Ga0063085_1074064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300021930|Ga0063145_1110559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300021939|Ga0063095_1083878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300021939|Ga0063095_1103693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300023175|Ga0255777_10462051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300025620|Ga0209405_1107426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani788Open in IMG/M
3300025620|Ga0209405_1160853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300025626|Ga0209716_1094008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani866Open in IMG/M
3300025636|Ga0209136_1177012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300025699|Ga0209715_1206559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300025869|Ga0209308_10319560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300025897|Ga0209425_10299970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani806Open in IMG/M
3300026448|Ga0247594_1086160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300026495|Ga0247571_1161658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300027248|Ga0208176_1038492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300027810|Ga0209302_10348097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300027833|Ga0209092_10302239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani866Open in IMG/M
3300028137|Ga0256412_1223279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300028137|Ga0256412_1276970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300028137|Ga0256412_1300832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300028282|Ga0256413_1281938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300028290|Ga0247572_1147792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300030709|Ga0307400_10433304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani834Open in IMG/M
3300030709|Ga0307400_10868761Not Available555Open in IMG/M
3300030720|Ga0308139_1072125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300030723|Ga0308129_1035532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300030725|Ga0308128_1040523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300030781|Ga0073982_11523267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300030856|Ga0073990_10003225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300031032|Ga0073980_11390373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300031062|Ga0073989_13061041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300031062|Ga0073989_13452480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300031062|Ga0073989_13468581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300031621|Ga0302114_10204770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani827Open in IMG/M
3300031621|Ga0302114_10305719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300031725|Ga0307381_10353150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300031729|Ga0307391_10511752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300032463|Ga0314684_10527227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani692Open in IMG/M
3300032470|Ga0314670_10547860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300032481|Ga0314668_10477388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300032481|Ga0314668_10492222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani628Open in IMG/M
3300032491|Ga0314675_10647293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300032492|Ga0314679_10365465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300032517|Ga0314688_10499097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300032519|Ga0314676_10162579All Organisms → cellular organisms → Eukaryota1220Open in IMG/M
3300032519|Ga0314676_10844499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300032521|Ga0314680_11050631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300032522|Ga0314677_10631847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300032522|Ga0314677_10643130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300032540|Ga0314682_10575555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300032615|Ga0314674_10306291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300032617|Ga0314683_10778605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300032650|Ga0314673_10457180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300032650|Ga0314673_10458976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300032650|Ga0314673_10654135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300032650|Ga0314673_10731724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300032651|Ga0314685_10673977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300032666|Ga0314678_10393697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300032666|Ga0314678_10448777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300032707|Ga0314687_10546754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300032709|Ga0314672_1224847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300032709|Ga0314672_1288264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300032711|Ga0314681_10539477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300032713|Ga0314690_10478100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300032714|Ga0314686_10413359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300032714|Ga0314686_10594759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300032723|Ga0314703_10030668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1842Open in IMG/M
3300032723|Ga0314703_10373639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300032725|Ga0314702_1322325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300032726|Ga0314698_10454107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300032727|Ga0314693_10477637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300032733|Ga0314714_10557202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300032742|Ga0314710_10343229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300032743|Ga0314707_10608472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300032743|Ga0314707_10734839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300032744|Ga0314705_10552844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani615Open in IMG/M
3300032745|Ga0314704_10513100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300032751|Ga0314694_10452809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300032754|Ga0314692_10691648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater24.29%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine22.03%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.64%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.34%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.65%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.52%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.52%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine4.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.26%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.26%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.69%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.56%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.56%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.56%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018714Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001812 (ERX1782478-ERR1711985)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019081Metatranscriptome of marine microbial communities from Baltic Sea - GS676_3p0_dTEnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020207Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027248Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075497_152098213300006424AqueousMSGFGGYHTYMRDTPDRFETEADDTLMKSMYATYATEGEKDHLPTGRFWVTKENAMKACDEVVNTHLHLNKDERKSYLDAQFPSLWTRFDVNEEGKIEIDRMPQLLRSICGSAEACLGL*
Ga0075469_1016615013300007231AqueousGFGGYHTYMRDTPDRFETEADDTLMKSMYATYATEGEKDHLPTGRFWVTKENALKACDEVVNTHLHLGKEEKKAYLDAQFPSLWTRFDVNEEGKIEIDRMPQLLRSICGSAEACLGL*
Ga0102820_112997213300007554EstuarineESNMMVRGDNDGYPANMSGFGGYHTYIRDTPDRFESEADDTLMRSMYDTYATEGKKDGLPTGHFWVTKEDGYKAATEVVGTHLKLKKDALKSYVDEQFPTMWAKYDVNSEGKIEVDRMPVFLKSVCGNAEACFGL*
Ga0103706_1016517113300009022Ocean WaterFALAVFLGCASSVKITTGDFDPTMSGFGGYKTYIRDTPDRFETEADDTLMKSMYKTYAMEGEDKDGLPTGRFWVTKDSAHKACDEVVSTHLRLKGKDKDEYLEAQFPALWTRFDVNEEGKIEIDRMPQLLRSICGNAEACLGL*
Ga0115551_138818413300009193Pelagic MarineADIQQHMMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYATYATEGEKDHLPTGRFWVTKENALKACDEVVNTHLHLNKDERKSYLDAQFPSLWTRFDVNEEGKIEIDRMPQLLRSICGSAEACLGL*
Ga0115562_115098323300009434Pelagic MarineMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAVESEDKDGLPTGRYWVTKEMAKKAAAEVVGTHLRLDKTGEKEYVESQFPALWARFDVNEENKIEIDRMPQLLRSICGNSEACLGL
Ga0115562_125463913300009434Pelagic MarineGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL*
Ga0115008_1109368413300009436MarineMNGFGGYKTYIRDTPDRFETEADDTLMKSMYATYATESEDAAGLPSGHFWVTKANAQKACDEVVNTHLHLSGKEKEAYIASQFPALWARFDVNEEGKIE
Ga0115008_1115354913300009436MarineMKYFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL*
Ga0115553_125085223300009445Pelagic MarineMMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGEDKHGLPTGHFWVTKEDAQKAADEVVGTHLQLKGKDLKAYVDAQFAPAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ*
Ga0115571_117800313300009495Pelagic MarineMMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGETKQGLPTGHFWVTQADAEKAATEVVGTHLQLKKDDLKSYVKAQFPAAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ*
Ga0115571_120149113300009495Pelagic MarineMKYFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL*
Ga0115569_1025668313300009497Pelagic MarineMKYFALAALLGSISAVNIKTVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEAAGLPTGRFYVTKDNAKKACDEVVNTHLRLADKEKAAYIEAQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL*
Ga0115572_1077374013300009507Pelagic MarineMKYFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRM
Ga0115006_1084080923300009544MarineMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAIESEDKDGLPTGRYWVTKEMAKKAATEVVGTHLRLGKDGEKEYVEANFPALWSRFDVNEENKIEIDRMPQLLRSICGNSEACLGL
Ga0115102_1021860913300009606MarineILNMKYFALAALATVASIKMTDYDASMDGFGGYKTYIRDVPDRFETEADDTLMKSMYATYAIESADKDGLPTGRFWVTKASAMKACDEVINTHLRLAGKEKTEYLEAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL*
Ga0115102_1065348713300009606MarineMMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGEDKHGLPTGHFWVTKGDAEKAADEVVGTHLQLKGKDLKAYVAAQFAPAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ*
Ga0115100_1091085813300009608MarineFALAALLAISAVKVNDYDSSMNGFGGYHTYIRDTPDRFETEADDTLMKSMYANYATEGEKDHLPTGRFYVTKENAQKACDEVVGTHLRLAKKEKEEYLASQFPALWQRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL*
Ga0115104_1113856213300009677MarineMKYHALIALLGTALSIKVDTVDFDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAMEGEDKDGLPTGRFWVTKDSAKKACNEVVDTHLRLKGKDKDEYMEAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGLQ*
Ga0115105_1055271813300009679MarineFALAALLGCTMSIKITNGDFDATMDGFGGYKTYIRDVPDRFETEADDTLMKSMYEKYAMEGEDKDGLPTGRFWVTKAMAQKACDEVVNTHLRLKGKDKDSYLEEQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL*
Ga0138326_1024388213300010985MarineLALLALLGSAISVKVTNHNHQGDYDPTMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAMEGEDKDGLPTGRFWVTKDSARKACDEVVSTHLRLKGGDKTDYLEAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGLQ*
Ga0138324_1057736313300010987MarineLALLALLGSAISVKVTNHNHQGDYDPTMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAMEGEDKDGLPTGRFWVTKDSARKACDEVVDTHLRLKGDEKKAYLEAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGLQ*
Ga0138266_119399513300012412Polar MarineKMKFFALAALLGLISAVKINDYDATMSGFGGYHTYIRDTPDRFETEADDTLMKSMYSTYATEVEKDGLPTGRFFVTKDAAKKACDEVVSTHLRLSGKDKEAYLETQFPALWTRFDVNEESKIEVDRMPQLLRSICGNAEACLGL*
Ga0138259_150484513300012416Polar MarineESESECTDSDDSSCASDDDTDVQTGSLDYPANMSGFGGYHTYMRDTPDRFETEADDTLMKSMYTNYATESEAAGLPTGHFYVTKDNAMKACDEVVSTHLRLAKDEKKDYLASQFPSLWSRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL*
Ga0138260_1010358013300012419Polar MarineMKFFALAALVGVISAVKINDYDATMSGFGGYHTYIRDTPDRFETEADDTLMKSMYSTYATEGEKDGLPTGRFFVTKDAAKKACDEVVSTHLRLAGKDKEAYLEAQFPALWTRFDVNEESKIEVDRMPQLLRSICGNAEACLGL*
Ga0138260_1021726413300012419Polar MarineMSGFGGYHTYMRDTPDRFETEADDTLMKSMYTNYATESEAAGLPTGHFFVTKDNAMKACDEVVNTHLRLGKDEKKDYLASQFPTLWSRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL*
Ga0138260_1101510113300012419Polar MarineMDYPAHMSGFGGYHTYMRDTPDRFETEADDSLMKSMYTNYATEGEKAGLPSGHFWVTKSDAERASTEVVGTHLQLKNTELKAYVASEFPTLWTRFDVNEEGKIEVDRMPAFLRSLCGSAEACAGL*
Ga0129347_112479713300012504AqueousMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0129349_138143313300012518AqueousFELILKMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL*
Ga0129344_107227213300012520AqueousLILKMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL*
Ga0129350_100778213300012523AqueousDKYNKFELILKMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL*
Ga0129352_1029041113300012528AqueousMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL*
Ga0138267_118320123300012767Polar MarineLIGLISAVKIDSVDYNADMNGFGGYHTYMRDTPDRFETEADDTLMKSMYATYATEGEKDALPTGRFYVTKENAKKACDEVVSTHLRLSGKEKASYVDAQFPALWSRFDVNEESKIEVDRMPQLLRSICGNAEACLGL*
Ga0138268_139174113300012782Polar MarineDYPAVMSGFGGYHTYMRDTPDRFETEADDTLMKSMYATYATEGEKDALPTGRFYVTKENAKKACDEVVSTHLRLSGKEKASYVDAQFPALWSRFDVNEESKIEVDRMPQLLRSICGNAEACLGL*
Ga0138268_159851923300012782Polar MarineMSGFGGYHTYMRDTPDRFETEADDTLMKSMYTNYATEGEKDALPTGHFYVTKADAMRACDEVVNTHLRLGKTEKKAYMESQFPTLWSRFDVNEEGKIEVDRMPAMLRSICGNAEACFGL*
Ga0163111_1104155213300012954Surface SeawaterMKYFALVALLGANAIKIEDYDATMSGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGETADHLPNGRFYVTKENAQKACDEVVNTHLHLKDKEKADYIAAQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL*
Ga0163111_1123245913300012954Surface SeawaterMKYFALAVFLGCASSVKITTGDFDPTMSGFGGYKTYIRDVPDRFETEADDTLMKSMYNTYAMEGEDANGLPTGRFWVTKDSARKACDEVVDTHLRLHGKEKKEYLEAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL*
Ga0163111_1123945713300012954Surface SeawaterMKYFALAALLGCATSINLKNGDFDWTMDGFGGYKTYIRDVPDRFETEADDTLMKSMYTHYAIEGEDKDGLPTGRFWVTKASAQKACDEVVGTHLRLSGKDKTEYLENQFPALWARFDVNEEGRIEIDRMPQLLRSICGNAEACLGL*
Ga0163111_1162954313300012954Surface SeawaterDSSASDDDTAVQTQTQDFPAHMNGFGGYKTYIRDTPDRFETEADDTLMKSMYATYATESEDAAGLPSGHFWVTKENAKKACDEVVNTHLRLSGPEKEAYIASQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACFGL*
Ga0129340_116677813300012963AqueousLKMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL*
Ga0181567_1085123913300018418Salt MarshMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNSEPCLAL
Ga0181566_1054808813300018426Salt MarshMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNSEACLGL
Ga0181568_1124974213300018428Salt MarshMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDISDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNSEACL
Ga0188834_102141123300018599Freshwater LakeMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNSEACLGL
Ga0193133_101971323300018617MarineWTMDGFGGYKTYIRDVPDRFETEADDTLMKSMYTHYAIEGEDKDGLPTGRFWVTKGSAQKACDEVVATHLRLSGKDKTEYLENQFPALWARFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0193349_103494313300018714MarineMDGFGGYKTYIRDVPDRFETEADDTLMKSMYATYAIEGEDKDGLPTGRYWVTKADAMKAADEVVDTHLRLHKGDKADYLAANFPALWARFDVNEEGKIEIDRMPQLLRSICGNAEACLGL
Ga0192967_103363223300018730MarineMNGFGGYKTYIRDTPDRFETEADDTLMKSMYATYATESEDAAGLPSGHFWVTKANAQKACDEVVNTHLRLSGPEKEAYIAAQFPALWSRFDVNEEGKIEVDRMPAMLRSVCGNAEACFGL
Ga0193138_104893513300018742MarineKYFALAAILGATMSIKVADFDPTMDGFGGYKTYIRDTPDRFETEADDTLMKSMYKTYAMEGEDKDGLPTGRFWVTKDSAHKACDEVVSTHLRLKGKDKDEYLEAQFPALWTRFDVNEEGKIEIDRMPQLLRSICGNAEACLGL
Ga0193000_104855313300018745MarineQVSECTDSSDSSCDDDDAEDVQVADFPAYMDGFGGYKTYIRDVPDRFETEADDTLMKSMYATYAVEGEDKDGLPTGRFWVTKDMAMKACDEVVDTHLRLHKGDKADYLAANFPALWTRFDVNEEGRIEIDRMPQLLRSICGNSEACLGL
Ga0193000_106669713300018745MarineFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAMEGEDKDGLPTGRFWVTKDSAKKACDEVVDTHLRLKGKDKTEYMEAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGLQ
Ga0193031_105476423300018765MarineMSGFGGYKTYIRDTPDRFETEADDTLMKSMYTTYAVEGEDKDGLPTGRYWVTKDMAMKAADEVVDTHLRLHKSEKADYLAANFPALWSRFDVNEEGKIEIDRMP
Ga0193031_108019713300018765MarineDSGDDADIQQQMMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGEDKHGLPTGHFWVTKEDAEKAATEVVGTHLQLKTGDLKAYVAAQFPAAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ
Ga0194240_102088013300018832MarineYFALAALLGCAMSVKITTGDFDPSMDGFGGYKTYIRDTPDRFETEADDTLMKSMYKTYAMEGEDKDGLPTGRFWVTKESARKACDEVVSTHLRLKGKDKEAYLEEQFPALWTRFDVNEESRIEIDRMPQLLRSICGNAEACLGL
Ga0193219_105638213300018842MarineKYFALAALLGSALSVKIHNGDYTADMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKDGLPTGRFWVTKASAQKACDEVVDTHLRLHGKEKTEYLEAQFPALWNRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0192977_107395913300018874MarineMSGFGGYHTYMRDTPDRFETEADDTLMKSMYTNYATEGEKDALPTGHFYVTKADAMRACDEVVNTHLRLGKTEKKAYMESQFPTLWSRFDVNEEGKIEVDRMPAMLRSICGNAEACFGL
Ga0193028_107596823300018905MarineMSGFGGYKTYIRDTPDRFETEADDTLMKSMYTTYAVEGEDKDGLPTGRYWVTKDMAMKAADEVVDTHLRLHKGDKADYLAANFPALWSRFDVNEEGKIEIDRMP
Ga0192820_1010999413300018932MarineKIHNGDYTADMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKDGLPTGRFWVTKASAEKACDEVVDTHLRLHGSEKKDYLAAQFPALWNRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0192820_1014844413300018932MarineININVFLFDKYNKFELILNMKYFALAVFLGCASSVKITTGDFDPTMSGFGGYKTYIRDVPDRFETEADDTLMKSMYNTYAMEGEDKDGLPTGRFWVTKDSARKACDEVVDTHLRLHGKEKTEYLEAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0193178_1006318913300018967MarineMKYFVLAALLGCTMSIKITNGDFDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYSKYAIEGEDKDGLPTGRFWVTKASAQKACDEVVDTHLRLHGKDKESYLAEQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0193030_1013934023300018989MarineMSGFGGYKTYIRDTPDRFETEADDTLMRSMYTTYAVEGEDKDGLPTGRYWVTKDMARKAADEVVDTHLRLHKSEKADYLDANFPALWARFDVNEEGKVEIDRMPQLLRSICGNAESCLGL
Ga0193030_1014116113300018989MarineMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGEDKHGLPTGHFWVTKEDAEKAATEVVGTHLQLKTGDLKAYVAAQFPAAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ
Ga0193030_1015605613300018989MarineMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGEDKHGLPTGHFWVTKEDAEKAATEVVGTHLQLKSGDLKAYVAAQFPAAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ
Ga0193030_1018525313300018989MarineHGDNKFELILNMKYFALAALLGCAMSVKITTGDFDPTMDGFGGYKTYIRDTPDRFETEADDTLMKSMYKTYAMEGEDKDGLPTGRFWVTKASARKACDEVVSTHLRLKGKDKDAYLEEQFPALWTRFDVNEESKIEVDRMPQLLRSICGNAEACLGL
Ga0193030_1020943513300018989MarineMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGEDKNGLPTGHFWVTKGDAEKAASEVVGTHLQLKSADLKGYVEANFPALWSRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQXEQ
Ga0193030_1021407813300018989MarineMKYFALAAILGATMSIKVADFDPTMDGFGGYKTYIRDTPDRFETEADDTLMKSMYKTYAMEGEDKDGLPTGRFWVTKDSAHKACDEVVSTHLRLKGKDKDEYLEAQFPALWTRFDVNEEGKIEIDRMPQLLRSICGNAEACLGL
Ga0193044_1022829313300019010MarineSAVHINTVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEKDNLPTGRFYVTKDSAKKACDEVIDTHLRLHGKEKAAYLEAQFPALWTRFDVNEEGKIEVDRMPQLLRSVCGNAEACLGL
Ga0192869_1023352813300019032MarineMDYPAHMSGFGGYHTYMRDTPDRFETEADVALMKSMYTNYATEGESKDHLPTGHFWVTKADAERAATEVVGTHLQLKDKELKSYVGAEFPTLWKRFDVNEEGKIEVDRMPAFLRSICGNSEACFGL
Ga0192869_1029707423300019032MarineMDGFGGFKTYIRDVPDRFETEADDTLMKSMYATYAVEGEDKDGLPNGRYWVTKENAMKAADEVVDTHLRLHKTEKADYLAANFPALWARFDVNEEGKVEIDRMPQLLRSICGNSEACLGL
Ga0192869_1036452813300019032MarineMNGFGGYHTYMRDTPDRFETEADDTLMKSMYANYATEGEKNGLPSGHFWVTKDDAKKAGTEVVGTHLQLKGKELEAYVNSEFPALWTRFDVNEEGKIEVDRMPAFLRSICGNAEACFGL
Ga0192945_1019473013300019036MarineMGIYNNLVLKKMKYFAIAALVGLISAVKVGDYTADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGQKDDLPTGRFYVTKENAKKACDEVVNTHLHLKAADKESYIAAQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0192945_1023315723300019036MarineMDYPAHMNGFGGYHTYMRDTPDRFETEADDTLMKSMYANYATEGEKNGLPSGHFWVTKDDAKKAGTEVVGTHLQLKAKELESYVNSEFPALWTRFDVNEEGKIEVDRMPSFLRSICGNSEACFGL
Ga0193336_1042471213300019045MarineHGDDNDEDVQLSAHDFPAYMSGFGGYKTYIRDTPDRFETEADDTLMKSMYENYAVEGEDKDGLPTGRYWVTKDQALKAADEVVDTHLRLHKGDKKDYLDANFPALWTRFDVNEEGKIEIDRMP
Ga0193336_1063461813300019045MarineLRDFPAYMSGFGGYKTYIRDTPDRFETEADDTLMRSMYTTYAVEGEDKDGLPTGRYWVTKDQAMKAADEVVDTHLRLHKAEKADYLAANFPALWARFDVNDEGKVEIDRMPQLLRSICGNAESCFGL
Ga0192966_1016568113300019050MarineMDYPAHMNGFGGYHTYMRDTPDRFETEADDTLMKSMYANYATEGEKNGLPSGHFWVTKDDAKKAGNEVVGTHLQLKGKELEAYVNSEFPALWTRFDVNEEGKIEVDRMPSFLRSICGNAEACFGL
Ga0192826_1032960513300019051MarineDSSCDDDDAEDVQVADFPAYMDGFGGYKTYIRDVPDRFETEADDTLMKSMYATYAVEGEDKDGLPNGRYWVTKDMAMKAADEVVDTHLRLHKGDKAAYLEANFPALWARFDVNEEGKIEIDRMPQLLRSICGNSEACLGL
Ga0192826_1036217113300019051MarineHTYIRDTPDRFETEADDTLMKSMYATYATEGESNNLPNGRFYVTKENAQKACDEVVNTHLHLSGKEKEAYIAAQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0188838_10764113300019081Freshwater LakeMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0188838_10764313300019081Freshwater LakeMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0188838_10821123300019081Freshwater LakeMDFPAHMSGLGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGETKQGLPNGHFWVTQADAEKAATEVVGTHLQLKNDDLKSYVKAQFPAAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ
Ga0194243_100838413300019102MarineNMSGFGGYKTYIRDTPDRFETEADDTLMKSMYTTYAVEGEDKDGLPTGRYWVTKDMAMKAADEVVDTHLRLHKGDKADYLAANFPALWSRFDVNEEGKIEIDRMP
Ga0193436_106250713300019129MarineSSCDDDDAEDVQVADFPAYMDGFGGYKTYIRDVPDRFETEADDTLMKSMYATYAVEGEDKDGLPTGRFWVTKDMALKACDEVVDTHLRLHKGDKKDYLDANFPALWTRFDVNEEGRIEIDRMPQLLRSICGNSEACLGL
Ga0182066_137646013300019262Salt MarshEDVQIQSHEYPAYMSGFGGYKTYIRDVPDRFETEADDTLMKSMYETYAVESEDKNGLPTGRFWVTKDSAMKACDEVVDTHLRLHKDAKKEYLDANFPALWARFDVNEEGKIEIDRMPQLLRSICGNAEACLGL
Ga0182061_167711413300019266Salt MarshSDDESNMMVRGDNDGYPAYMSGFGGYHTYIRDTPDRFESEADDTLMRSMYYTYATEGKKDGLPTGHFWVTKEDGYKAATEVVQTHLKLQKDALKSYVDEQFPTMWAKYDVNSEGKIEVDRMPVFLKSICGNAEACFGL
Ga0182059_104674413300019272Salt MarshKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNSEACLGL
Ga0182067_116350213300019276Salt MarshKMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0182044_123050113300020014Salt MarshMSGFGGYHTYIRDTPDRFESEADDTLMRSMYYTYATEGKKDGLPTGHFWVTKEDGYKAATEVVQTHLKLQKDALKSYVDEQFPTMWAKYDVNSEGKIEVDRMPVFLKSICGNAEACFGL
Ga0181570_1051329613300020207Salt MarshIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNSEACLGL
Ga0210307_116601713300021336EstuarineESEADDTLMRSMYYTYATEGKKDGLPTGHFWVTKEDGYKAATEVVGTHLKLKGKELKSYVDEQFPTMWAKYDVNSEGKVEVDRMPVFLKSVCGNAEACFGL
Ga0206693_106215413300021353SeawaterMKYFALAALLAISAVKVNDYDSSMNGFGGYHTYIRDTPDRFETEADDTLMKSMYANYATEGEKDHLPTGRFYVTKENAQKACDEVVGTHLRLAKKEKEEYLASQFPALWQRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0063086_103053723300021902MarineMNGFGGYKTYIRDTPDRFETEADDTLMKSMYATYATESEDAAGLPSGHFWVTKANAQKACDEVVNTHLHLSGKEKEAYIASQFPALWARFDVNEEGKIEVDRMPAMLRSVCGNAEACFGL
Ga0063133_103934613300021912MarineSCSDGEEEDVQLRDFPANMSGFGGYKTYIRDTPDRFETEADDTLMKSMYTTYAVEGEDKDGLPTGRYWVTKDMAMKAADEVVDTHLRLHKGDKADYLAANFPALWSRFDVNEEGKIEIDRMP
Ga0063870_104600713300021921MarineKYFALAALLGSISAVNIKTVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEAAGLPTGRFYVTKDNAKKACDEVVNTHLRLADKEKAAYIEAQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0063869_107931713300021922MarineAVNIKTVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEAAGLPTGRFYVTKDNAKKACDEVVNTHLRLADKEKAAYIEAQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0063869_108336513300021922MarineFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0063085_103379013300021924MarineFGGYKTYIRDVPDRFETEADDTLMRSMYETYAIESEDKDGLPTGRYWVTKEMAKKAAAEVVGTHLRLDKTGEKEYVESQFPALWARFDVNEENKIEIDRMPQLLRSICGNSEACLGL
Ga0063085_107167513300021924MarineKYFAIAALLGLSSAIKSVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEAAGLPTGRFYVTKANAQKACDEVVNTHLHLSGKEKDSYIAAQFPALWTRFDVNEEGKIEVDRMPQLLRSVCGNAEACLGL
Ga0063085_107406423300021924MarineMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGETKQGLPTGHFWVTQADAEKAATEVVGTHLQLKKDDLKSYVKAQFPAAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ
Ga0063145_111055913300021930MarineFVLAALLGCTMSIKITNADFDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYSKYAIEGEDKDGLPTGRFWVTKASAQKACDEVVDTHLRLKSKDKESYLAEQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0063095_108387823300021939MarineMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAIESEDKDGLPTGRYWVTKEMAKKAAAEVVGTHLRLDKTGEKEYVESQFPALWARFDVNEENKIEIDRMPQLLRSICGNSEACLGL
Ga0063095_110369313300021939MarineAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDGEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0255777_1046205113300023175Salt MarshMKTFALAALLGSALSVKIQTVDYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYKTYAIEGEDKNGLPTGRFWVTKDSAKKACDEVVDTHLRLHGKDKEEYLAAQFPALWTRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0209405_110742613300025620Pelagic MarineMKYFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0209405_116085323300025620Pelagic MarineMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAVESEDKDGLPTGRYWVTKEMAKKAAAEVVGTHLRLDKTGEKEYVESQFPALWARFDVNEENKIEI
Ga0209716_109400823300025626Pelagic MarineMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAVESEDKDGLPTGRYWVTKEMAKKAAAEVVGTHLRLGKDGEKEYVEANFPALWSRFDVNEENKIEIDRMPQLLRSICGNSEACLGL
Ga0209136_117701213300025636MarineHTYIRDTPDRFESEADDTLMRSMYYTYATEGKKDGLPTGHFWVTKEDGYKAATEVVGTHLKLKGKELKSYVDEQFPTMWAKYDVNSEGKVEVDRMPVFLKSVCGNAEACFGL
Ga0209715_120655913300025699Pelagic MarineMKYFALAALLGSISAVNIKTVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEAAGLPTGRFYVTKDNAKKACDEVVNTHLRLADKEKAAYIEAQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0209308_1031956023300025869Pelagic MarineMKDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGEDKHGLPTGHFWVTKEDAEKAASEVVGTHLQLKDKDLKAYVTAQFSPAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ
Ga0209425_1029997023300025897Pelagic MarineMMVRGDDGYPANMSGFGGYHTYIRDTPDRFESEADDTLMRSMYYTYATEGKKDGLPTGHFWVTKEDGYKAATEVVGTHLKLKKDALKSYVDEQFPTMWAKYDVNSEGKIEVDRMPVFLKSVCGNAEACFGL
Ga0247594_108616013300026448SeawaterLGASAIKVEDYDANMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGESKDNLPTGRFYVTKENAQKACDEVVNTHLHLKEKEKADYIAAQFPALWARFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0247571_114377513300026495SeawaterDDTLMRSMYKTYATEGEDKHGLPTGHFWVTKEDAEKAASEVVGTHLQLKGKDLKEYVAAQFPPAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ
Ga0247571_116165813300026495SeawaterVGLISAVKVGDYTADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGESKDNLPTGRFYVTKENAQKACDEVVNTHLHLKEKEKADYIAAQFPALWARFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0208176_103849213300027248EstuarineSSSDDESNMMVRGDNDGYPANMSGFGGYHTYIRDTPDRFESEADDTLMRSMYYTYATEGKKDGLPTGHFWVTKEDGYKAATEVVGTHLKLKGKELKSYVDEQFPTMWAKYDVNSEGKVEVDRMPVFLKSVCGNAEACFGL
Ga0209302_1034809723300027810MarineMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAIESEDKDGLPTGRYWVTKEMAKKAAAEVVGTHLHLKGKDAEGYVNGIFPALWNRYDVNEDGKIEIDRAPVFLRQVCGSAEACVAL
Ga0209092_1030223923300027833MarineMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAIESEDKDGLPTGRYWVTKEMAKKAAAEVVGTHLRLGKDGEKEYVEANFPALWSRFDVNEENKIEIDRMPQLLRSICGNSEACLGL
Ga0256412_122327913300028137SeawaterMDYPAHMNGFGGYHTYMRDTPDRFETEADDTLMKSMYANYATEGEKNGLPSGHFWVTKDDAKKAGTEVVGTHLQLKGKELEAYVNSEFPALWTRFDVNEEGKIEVDRMPAFLRSICGNAEACFGL
Ga0256412_127697013300028137SeawaterSSDSSCDYDDAEEVQLHSGDFPANMSGFGGYKTYIRDTPDRFETEADDTLMKSMYTNYAIEGEDKNGLPTGRYWVTKADAMRAADEVVDTHLRLKKTDKADYLAANFPALWARFDVNEEGKVEIDRMPQLLRSICGNAEACLGL
Ga0256412_130083213300028137SeawaterMKYFAIAALVGLISAVKVGDYTADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGESKDNLPTGRFYVTKENAQKACDEVVNTHLHLKDKEKADYIAAQFPALWARFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0256413_128193813300028282SeawaterKMKYFALAALLAISAVKVNDYDSSMNGFGGYHTYIRDTPDRFETEADDTLMKSMYANYATEGEKDHLPTGRFYVTKENAQKACDEVVGTHLRLAKKEKEEYLASQFPALWQRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0247572_114779213300028290SeawaterMKYFAIAALVGLISAVKVGDYTADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGESKDHLPTGRFYVTKENAQKACDEVVNTHLHLKDKEKAEYIAAQFPALWARFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0307400_1043330423300030709MarineMDYPAVMSGFGGYHTYMRDTPDRFETEADDTLMKSMYASYATEGEKNGLPNGHFWVTKEDAEKAGTEVVGTHLQLKGKELKSYVDSEFPNLWKKFDINEEGKIEVDRMPSFLRSICGNAEACFGL
Ga0307400_1086876113300030709MarineKYFALAALIGLISAVKIDSVDYNADMNGFGGYHTYMRDTPDRFETEADDTLMKSMYATYATEGEKDALPTGRFYVTKENAKKACDEVVSTHLRLSGKEKASYVDAQFPALWSRFDVNEESKIEVDRMPQLLRSICGNAEACLGL
Ga0308139_107212513300030720MarineISAINIKTVDYDADMNGFGGYHTYVRDTPDRFETEADDTLMKSMYATYATEGKVDDLPNGRFYVTKDNAKKACDEVIDTHLRLHGKEKASYIESQFPALWSRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0308129_103553213300030723MarineYFALAALATVASIKMTDYDATMDGFGGYKTYIRDVPDRFETEADDTLMKSMYATYAIESADKDGLPTGRFWVTKASAMKACDEVINTHLRLAGKEKTSYLEAQFPALWDRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0308128_104052313300030725MarineMKYFALAALATVASIKMTDYDATMDGFGGYKTYIRDVPDRFETEADDTLMKSMYATYAIESADKDGLPTGRFWVTKASAMKACDEVINTHLRLAGPEKASYLEAQFPALWDRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0073982_1152326713300030781MarineMDGFGGYKTYIRDVPDRFETEADDTLMKSMYATYAVEGEDKDGLPTGRFWVTKADALKACDEVVDTHLRLHKGDKKDYLDANFPALWTRFDVNEEGKIEIDRMPQLLRSICGNAEACLGL
Ga0073990_1000322513300030856MarineQCTDSSDSSCDDDEAEDVQIGSHDFPAYMSGFGGYKTYIRDTPDRFETEADDTLMKSMYTTYAVEGEDSAGLPNGRYWVTKDSALKACDEVVDTHLRLHKGDKAAYLEANFPALWARFDVNEEGKIEIDRMPQLLRSICGNSEACLGL
Ga0073980_1139037313300031032MarineNFKNMKYFALAAFLGCAMSINIRTGDFDPTMDGFGGYKTYIRDVPDRFETEADDTLMKSMYTNYAMEGEDKDGLPNGRFWVTKASAQKACDEVVSTHLRLGKTEKADYLAAQFPALWARFDVNEEGKIEIDRMPQLLRSICGNAEACLGL
Ga0073989_1306104123300031062MarineMSGFGGYKTYIRDTPDRFETEADDTLMKSMYNTYAVEGEDSAGLPNGRYWVTKDMALKAADEVVDTHLRLHKGDKKDYLDANFPALWARFDVNEEGKIEIDRMP
Ga0073989_1345248023300031062MarineMNGFGGYKTYIRDTPDRFETEADDTLMKSMYATYATESEDGAGLPSGHFWVTKENAMKACDEVVDTHLHLHKEEKAAYLAANFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACFGL
Ga0073989_1346858123300031062MarineMMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMRSMYKTYATEGEDKNGLPTGHFWVTKADAEKAATEVVNTHLQLKSNDLKEYVGSQFPALWARYDVNEEGKIEVDRMPAFLR
Ga0302114_1020477013300031621MarineMKYFALAALATVASIKMTDYDATMDGFGGYKTYIRDVPDRFETEADDTLMKSMYATYAIESADKDGLPTGRFWVTKASAMKACDEVINTHLRLAGKEKTSYLEAQFPALWDRFDVNEEGRIEIDRMPQLLRSICGNAEACLGL
Ga0302114_1030571913300031621MarineSDSSSSSDDDADVQQQMMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGEDKHGLPTGHYWVTQADAEKAATEVVNTHLQLKNADLKAYVKSQFPAAWTRYDVNEEGKIEIDRMPAFLRSICGNAEACAGLQ
Ga0307381_1035315013300031725MarineILNMKYFAIAAILGSAMSVQIHSNSHTNDFDASMDGFGGYKTYIRDTPDRFETEADDTLMRSMYKTYAIEGEDKDGLPTGRFWVTKDSAKKACDEVVATHLRLTGKDKTEYLEAQFPALWTRFDVNEESRIEIDRMPQLLRSICGNAEACLGLQ
Ga0307391_1051175223300031729MarineMNGFGGYKTYIRDTPDRFETEADDTLMKSMYATYATESEDAAGLPSGHFWVTKANAQKACDEVVNTHLRLSGKEKEAYIAAQFPALWTRFDVNEEGKIEIDRMPAMLR
Ga0314684_1052722713300032463SeawaterMKYFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314670_1054786013300032470SeawaterLNMKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314668_1047738813300032481SeawaterKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314668_1049222213300032481SeawaterMKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314675_1064729313300032491SeawaterLGSISAVNIKTVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEAAGLPTGRFYVTKDNAKKACDEVVNTHLRLADKEKAAYIEAQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL
Ga0314679_1036546513300032492SeawaterAQTVFARSCALKSSERFRVSSATASKSLVEKYFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314688_1049909713300032517SeawaterFDKYNKFELILNMKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314676_1016257923300032519SeawaterMMDFPAHMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGETKQGLPTGHFWVTQADAEKAATEVVGTHLQLKKDDLKSYVKAQFPAAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGLQ
Ga0314676_1084449913300032519SeawaterIDHAGYDASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314680_1105063113300032521SeawaterGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314677_1063184713300032522SeawaterAELQTMTHAMDYPAHMSGFGGYHTYMRDTPDRFETEADDTLMKSMYTNYATEGEKDGLPSGHFWVTKADAERAGVEVVGTHLQLKGAELKAYVASEFPALWTRFDVNEEGKIEVDRMPSFLRSICGNAEACAGLQ
Ga0314677_1064313013300032522SeawaterGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314682_1057555513300032540SeawaterKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314674_1030629113300032615SeawaterFLKTQIKFILYNINVVWFDKYNKFELILNMKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314671_1064297913300032616SeawaterESSGSESDGEGESSSSDEEGDEAEIQTLTHSMDYPAHMNGFGGYHTYMRDTPDRFETEADDTLMKSMYATYATESEDAAGLPSGHFWVTKANAQKACDEVVNTHLHLSGKEKEAYIASQFPALWARFDVNEEGKIEVDRMPAMLRSVCGNAEACFGL
Ga0314683_1077860513300032617SeawaterSESESESDSDSSSDSDDGAELQTMTHSMDYPAHMSGFGGYHTYMRDTPDRFETEADDTLMKSMYTNYATEGEKDGLPSGHFWVTKADAERAGTEVVGTHLQLKGAELKAYVASEFPALWTRFDVNEEGKIEVDRMPSFLRSICGNAEACAGLQ
Ga0314673_1045718013300032650SeawaterILNMKYFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314673_1045897613300032650SeawaterVWFDKYNKFELILNMKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314673_1065413513300032650SeawaterMFAHSMDYPAHMNGFGGYHTYMRDTPDRFETEADDTLMKSMYANYATEGEKNGLPSGHFWVTKDDAKRAGTEVAGTHLQLKGKELEGYVNAEFPALWTRFDVNEEGKIEVDRMP
Ga0314673_1073172413300032650SeawaterLSSAIKSVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEAAGLPTGRFYVTKANAQKACDEVVNTHLHLSGKEKDSYIAAQFPALWTRFDVNEEGKIEVDRMPQLLRSVCGNAEACLGL
Ga0314685_1067397713300032651SeawaterMNGFGGYKTYIRDTPDRFETEADDTLMKSMYTNYATEGEKDGLPSGHFWVTKADAERAGTEVVGTHLQLKGAELKAYVASEFPALWTRFDVNEEGKIEVDRMPSFLRSICGNAEACAGLQ
Ga0314678_1039369713300032666SeawaterLILNMKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314678_1044877713300032666SeawaterPAHMSGFGGYHTYMRDTPDRFETEADDTLMKSMYTNYATEGEKDGLPSGHFWVTKADAERAGVEVVGTHLQLKGAELKAYVASEFPALWTRFDVNEEGKIEVDRMPSFLRSICGNAEACAGLQ
Ga0314687_1054675413300032707SeawaterKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314672_122484713300032709SeawaterMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAVESEDKNGLPTGRYWVTKEMAKKAAAEVVGTHLRLGKDGEKEYVEANFPALWSRFDVNEENKIEIDRMPQLLRSICGNSEACLGL
Ga0314672_128826413300032709SeawaterKYFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314681_1053947713300032711SeawaterFELILNMKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314690_1047810013300032713SeawaterLYNINVVWFDKYNKFELILNMKYFTLAALATVASINIDHAGYDASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314686_1041335913300032714SeawaterMSGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAIESEDKNGLPTGRYWVTKEMAKKAAAEVVGTHLRLGKDGEKEYVEANFPALWSRFDVNEENKIEIDRMPQLLRSICGNSEACLGL
Ga0314686_1059475913300032714SeawaterFALAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314703_1003066823300032723SeawaterMSGFGGYKTYMRDTPDRFETEADDTLMKSMYKTYATEGETKQGLPTGHFWVTQADAEKAATEVVGTHLQLKKDDLKSYVKAQFPAAWTRYDVNEEGKIEVDRMPAFLRSICGNAEACAGL
Ga0314703_1037363913300032723SeawaterASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314702_132232513300032725SeawaterASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314698_1045410713300032726SeawaterLNMKYFALAALATVASVNIDHAGYSASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314693_1047763713300032727SeawaterFILYNINVVWFDKYNKFELILNMKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314714_1055720213300032733SeawaterLILNMKYFTLAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314710_1034322913300032742SeawaterLAALATVASINIDHAGYDASMDGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314707_1060847213300032743SeawaterGFGGYKTYIRDVPDRFETEADDTLMRSMYETYAMESADKDGLPTGRFWVTKDSAMKACDEVVSTHLRLKDAEKKSYVEAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314707_1073483913300032743SeawaterASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314705_1055284413300032744SeawaterLATVASINIDHAGYDASMDGFGGYKTYIRDVPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314704_1051310013300032745SeawaterVWFDKYNKFELILNMKYFALAALATVASINIDHAGYDASMDGFGGYKTYIRDIPDRFETEADDTLMKSMYETYAMESADKDGLPTGRFWVTKESAKKAAAEVVGTHLRLDKKAEADYVDAQFPALWARFDVNEENKIEIDRMPQLLRSICGNAEACLGL
Ga0314694_1045280913300032751SeawaterKMKYFAIAALLGLSSAIKSVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEAAGLPTGRFYVTKANAQKACDEVVNTHLHLSGKEKDSYIAAQFPALWTRFDVNEEGKIEVDRMPQLLRSVCGNAEACLGL
Ga0314692_1069164813300032754SeawaterAVNIKTVDYNADMNGFGGYHTYIRDTPDRFETEADDTLMKSMYATYATEGEAAGLPTGRFYVTKDNAKKACDEVVNTHLRLADKEKASYIEAQFPALWTRFDVNEEGKIEVDRMPQLLRSICGNAEACLGL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.