Basic Information | |
---|---|
Family ID | F033156 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 178 |
Average Sequence Length | 41 residues |
Representative Sequence | MSYSPILVVHICGGTLGLLSGTAAMSFRKGSPRHVLAGKVFV |
Number of Associated Samples | 143 |
Number of Associated Scaffolds | 178 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 96.05 % |
% of genes near scaffold ends (potentially truncated) | 98.31 % |
% of genes from short scaffolds (< 2000 bps) | 90.45 % |
Associated GOLD sequencing projects | 139 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.584 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.090 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.652 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 178 Family Scaffolds |
---|---|---|
PF14329 | DUF4386 | 8.43 |
PF01850 | PIN | 5.06 |
PF07859 | Abhydrolase_3 | 3.93 |
PF07238 | PilZ | 3.93 |
PF00248 | Aldo_ket_red | 3.37 |
PF13396 | PLDc_N | 2.81 |
PF12680 | SnoaL_2 | 2.25 |
PF07969 | Amidohydro_3 | 1.69 |
PF10012 | DUF2255 | 1.69 |
PF04397 | LytTR | 1.69 |
PF07228 | SpoIIE | 1.12 |
PF14279 | HNH_5 | 1.12 |
PF04255 | DUF433 | 1.12 |
PF12773 | DZR | 0.56 |
PF13083 | KH_4 | 0.56 |
PF02517 | Rce1-like | 0.56 |
PF14534 | DUF4440 | 0.56 |
PF07719 | TPR_2 | 0.56 |
PF13649 | Methyltransf_25 | 0.56 |
PF13964 | Kelch_6 | 0.56 |
PF00069 | Pkinase | 0.56 |
PF12704 | MacB_PCD | 0.56 |
PF08241 | Methyltransf_11 | 0.56 |
PF01488 | Shikimate_DH | 0.56 |
PF00326 | Peptidase_S9 | 0.56 |
PF12867 | DinB_2 | 0.56 |
PF01370 | Epimerase | 0.56 |
PF01425 | Amidase | 0.56 |
PF12833 | HTH_18 | 0.56 |
PF13335 | Mg_chelatase_C | 0.56 |
PF04986 | Y2_Tnp | 0.56 |
PF00190 | Cupin_1 | 0.56 |
PF13564 | DoxX_2 | 0.56 |
PF03795 | YCII | 0.56 |
PF13376 | OmdA | 0.56 |
PF02775 | TPP_enzyme_C | 0.56 |
PF15919 | HicB_lk_antitox | 0.56 |
PF09411 | PagL | 0.56 |
PF02566 | OsmC | 0.56 |
PF00239 | Resolvase | 0.56 |
PF13466 | STAS_2 | 0.56 |
PF02592 | Vut_1 | 0.56 |
PF02368 | Big_2 | 0.56 |
PF01346 | FKBP_N | 0.56 |
PF01740 | STAS | 0.56 |
PF00589 | Phage_integrase | 0.56 |
PF01381 | HTH_3 | 0.56 |
COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
---|---|---|---|
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 3.93 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.25 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.12 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.56 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.56 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.56 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.56 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.58 % |
Unclassified | root | N/A | 17.42 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10806189 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300001593|JGI12635J15846_10844899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100426189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
3300002908|JGI25382J43887_10176271 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300002908|JGI25382J43887_10234590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
3300002917|JGI25616J43925_10304152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300004080|Ga0062385_10895455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 588 | Open in IMG/M |
3300004156|Ga0062589_101116254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 747 | Open in IMG/M |
3300004633|Ga0066395_10260233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 934 | Open in IMG/M |
3300005176|Ga0066679_10314248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
3300005177|Ga0066690_11033078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium AB_14 | 515 | Open in IMG/M |
3300005178|Ga0066688_10817060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
3300005186|Ga0066676_10392349 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300005440|Ga0070705_100579901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
3300005540|Ga0066697_10099755 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
3300005541|Ga0070733_10007670 | All Organisms → cellular organisms → Bacteria | 6950 | Open in IMG/M |
3300005552|Ga0066701_10121031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1550 | Open in IMG/M |
3300005586|Ga0066691_10496854 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300005610|Ga0070763_10072327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1689 | Open in IMG/M |
3300005712|Ga0070764_10658158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300005921|Ga0070766_10701267 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300006175|Ga0070712_100152659 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
3300006176|Ga0070765_101857654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
3300006358|Ga0068871_101937917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300006800|Ga0066660_10071251 | All Organisms → cellular organisms → Bacteria | 2358 | Open in IMG/M |
3300006893|Ga0073928_11100036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300006903|Ga0075426_10322996 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300007265|Ga0099794_10608993 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300009038|Ga0099829_10230551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1506 | Open in IMG/M |
3300009038|Ga0099829_11693122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300009088|Ga0099830_10638286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
3300009088|Ga0099830_10981068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300009090|Ga0099827_11034855 | Not Available | 713 | Open in IMG/M |
3300009137|Ga0066709_102324530 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300009143|Ga0099792_10871240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300009792|Ga0126374_11446730 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300010046|Ga0126384_10021098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4207 | Open in IMG/M |
3300010048|Ga0126373_10721675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1056 | Open in IMG/M |
3300010048|Ga0126373_11908581 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300010321|Ga0134067_10015441 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
3300010401|Ga0134121_11591640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300011120|Ga0150983_13863619 | Not Available | 676 | Open in IMG/M |
3300011269|Ga0137392_11481142 | Not Available | 538 | Open in IMG/M |
3300011270|Ga0137391_10243289 | Not Available | 1561 | Open in IMG/M |
3300011270|Ga0137391_10601124 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300012096|Ga0137389_10432881 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300012096|Ga0137389_10561621 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300012198|Ga0137364_10017112 | All Organisms → cellular organisms → Bacteria | 4357 | Open in IMG/M |
3300012200|Ga0137382_10701930 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300012203|Ga0137399_10396982 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300012205|Ga0137362_10082750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2679 | Open in IMG/M |
3300012205|Ga0137362_10553312 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300012205|Ga0137362_10944597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300012207|Ga0137381_10833479 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300012207|Ga0137381_11144272 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300012207|Ga0137381_11354620 | Not Available | 604 | Open in IMG/M |
3300012208|Ga0137376_11152165 | Not Available | 663 | Open in IMG/M |
3300012211|Ga0137377_10264211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1652 | Open in IMG/M |
3300012211|Ga0137377_10684358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
3300012211|Ga0137377_11194674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
3300012285|Ga0137370_10657414 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300012349|Ga0137387_10129716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1783 | Open in IMG/M |
3300012361|Ga0137360_11258936 | Not Available | 640 | Open in IMG/M |
3300012361|Ga0137360_11271273 | Not Available | 636 | Open in IMG/M |
3300012362|Ga0137361_10517058 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300012362|Ga0137361_10971489 | Not Available | 768 | Open in IMG/M |
3300012363|Ga0137390_10994400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
3300012363|Ga0137390_11002858 | Not Available | 787 | Open in IMG/M |
3300012363|Ga0137390_11444619 | Not Available | 630 | Open in IMG/M |
3300012582|Ga0137358_10639245 | Not Available | 713 | Open in IMG/M |
3300012685|Ga0137397_10557586 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300012917|Ga0137395_11058156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300012918|Ga0137396_10189036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1512 | Open in IMG/M |
3300012918|Ga0137396_10682324 | Not Available | 758 | Open in IMG/M |
3300012925|Ga0137419_10876396 | Not Available | 738 | Open in IMG/M |
3300012930|Ga0137407_11524137 | Not Available | 636 | Open in IMG/M |
3300012944|Ga0137410_11064906 | Not Available | 691 | Open in IMG/M |
3300012944|Ga0137410_11594333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300012944|Ga0137410_12096206 | Not Available | 504 | Open in IMG/M |
3300012948|Ga0126375_10500796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300012971|Ga0126369_11651522 | Not Available | 730 | Open in IMG/M |
3300015245|Ga0137409_10057738 | All Organisms → cellular organisms → Bacteria | 3662 | Open in IMG/M |
3300015245|Ga0137409_10350634 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300015245|Ga0137409_10637086 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300015251|Ga0180070_1017560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
3300015356|Ga0134073_10087594 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300017946|Ga0187879_10728979 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
3300018030|Ga0187869_10309648 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300018038|Ga0187855_10450262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
3300018468|Ga0066662_12443441 | Not Available | 550 | Open in IMG/M |
3300018468|Ga0066662_12522103 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300020579|Ga0210407_11356878 | Not Available | 529 | Open in IMG/M |
3300020580|Ga0210403_10391083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
3300020580|Ga0210403_11162729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300021086|Ga0179596_10611263 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300021403|Ga0210397_10504956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
3300021404|Ga0210389_11071872 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300021405|Ga0210387_11228814 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300021406|Ga0210386_10812070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300021432|Ga0210384_10346108 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300021432|Ga0210384_10954947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
3300021433|Ga0210391_10142302 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300021433|Ga0210391_11560625 | Not Available | 505 | Open in IMG/M |
3300021474|Ga0210390_10016807 | All Organisms → cellular organisms → Bacteria | 5930 | Open in IMG/M |
3300021479|Ga0210410_10519609 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300021559|Ga0210409_10158633 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
3300022557|Ga0212123_10412978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
3300022728|Ga0224566_106403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300024284|Ga0247671_1004681 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
3300024323|Ga0247666_1020185 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
3300025910|Ga0207684_11399676 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300025912|Ga0207707_10838397 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300025918|Ga0207662_10290203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1085 | Open in IMG/M |
3300025922|Ga0207646_10193880 | Not Available | 1835 | Open in IMG/M |
3300026295|Ga0209234_1020304 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
3300026295|Ga0209234_1279008 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300026300|Ga0209027_1196886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300026300|Ga0209027_1276273 | Not Available | 540 | Open in IMG/M |
3300026310|Ga0209239_1212646 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300026320|Ga0209131_1126711 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
3300026328|Ga0209802_1138845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
3300026329|Ga0209375_1080219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1516 | Open in IMG/M |
3300026359|Ga0257163_1077005 | Not Available | 539 | Open in IMG/M |
3300026494|Ga0257159_1094096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 523 | Open in IMG/M |
3300026551|Ga0209648_10253696 | Not Available | 1300 | Open in IMG/M |
3300026551|Ga0209648_10419089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
3300026551|Ga0209648_10632925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300026551|Ga0209648_10833739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300026865|Ga0207746_1020819 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300027505|Ga0209218_1107141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300027528|Ga0208985_1049888 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300027633|Ga0208988_1123082 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300027698|Ga0209446_1154144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300027738|Ga0208989_10132914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 840 | Open in IMG/M |
3300027768|Ga0209772_10077738 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300027775|Ga0209177_10186350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
3300027795|Ga0209139_10000906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10700 | Open in IMG/M |
3300027846|Ga0209180_10170406 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300027874|Ga0209465_10134012 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300027882|Ga0209590_10925833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300027986|Ga0209168_10153351 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300028020|Ga0265351_1002873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
3300028047|Ga0209526_10534094 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300028673|Ga0257175_1031863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 920 | Open in IMG/M |
3300028909|Ga0302200_10365216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300029951|Ga0311371_11623072 | Not Available | 711 | Open in IMG/M |
3300029992|Ga0302276_10313575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300030041|Ga0302274_10022128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4295 | Open in IMG/M |
3300030054|Ga0302182_10115177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1176 | Open in IMG/M |
3300030509|Ga0302183_10264396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
3300031028|Ga0302180_10226455 | Not Available | 993 | Open in IMG/M |
3300031231|Ga0170824_124405525 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300031544|Ga0318534_10707665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300031561|Ga0318528_10157953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
3300031573|Ga0310915_11247044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300031590|Ga0307483_1008951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
3300031719|Ga0306917_10442962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
3300031720|Ga0307469_10301104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1321 | Open in IMG/M |
3300031753|Ga0307477_10015742 | All Organisms → cellular organisms → Bacteria | 5160 | Open in IMG/M |
3300031765|Ga0318554_10742273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300031768|Ga0318509_10403850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300031823|Ga0307478_11126251 | Not Available | 654 | Open in IMG/M |
3300031879|Ga0306919_11150422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300031890|Ga0306925_10445468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1384 | Open in IMG/M |
3300031910|Ga0306923_11401276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 736 | Open in IMG/M |
3300031912|Ga0306921_10248039 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
3300031912|Ga0306921_12181447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300031947|Ga0310909_10023429 | All Organisms → cellular organisms → Bacteria | 4479 | Open in IMG/M |
3300031947|Ga0310909_10555259 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300031962|Ga0307479_10676874 | Not Available | 1011 | Open in IMG/M |
3300031962|Ga0307479_10804421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 915 | Open in IMG/M |
3300031962|Ga0307479_11036564 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300032001|Ga0306922_12017252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300032059|Ga0318533_10270802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
3300032180|Ga0307471_100846518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
3300032261|Ga0306920_103607504 | Not Available | 570 | Open in IMG/M |
3300033289|Ga0310914_10539501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.62% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.49% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.37% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.25% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.25% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.25% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.69% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.12% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.12% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.12% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.56% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.56% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026865 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_108061891 | 3300001593 | Forest Soil | MSYSPILIVHICGGSLGLLSGTAAMSFRKGSPRHVLA |
JGI12635J15846_108448992 | 3300001593 | Forest Soil | MFYSPTLLVHICGGTVGLLSGTAAMSFRKGSPRHAL |
JGIcombinedJ26739_1004261893 | 3300002245 | Forest Soil | VSYSPILIAHIFAGTFGLLSGTAAMSFRKGSPRHVLAGKIFV |
JGI25382J43887_101762712 | 3300002908 | Grasslands Soil | MSYSPILIAHICGGVVGLVSGTAAMCFRKGSPRHVLAGKVFV |
JGI25382J43887_102345903 | 3300002908 | Grasslands Soil | MSYSPSLIVHICGGSLGLLSGTAAMAFRKGSPRHVLAGKVFVAS |
JGI25616J43925_103041522 | 3300002917 | Grasslands Soil | MAYSPTLIVHILGGTVGLVSGTAAMCFRKGSSRHVLAGRVFVAS |
Ga0062385_108954552 | 3300004080 | Bog Forest Soil | MSYSPILVVHICAGTLGLLSGTAAMSFRKGSPRHALAGKVFV |
Ga0062589_1011162541 | 3300004156 | Soil | MPYSPLLPVHIAGGIIGIASGAAAMVFPKGGRSHALAGKVFVASML |
Ga0066395_102602331 | 3300004633 | Tropical Forest Soil | MSYSPTLLVHIGAGIFALPSGAAAMVFRKGSPRHILAGRVFVASMLTMAVAA |
Ga0066679_103142481 | 3300005176 | Soil | MSYSPILAVHICAGSLGLLSGTAAMSFRKGSPRHVLTGKVFVASMLTM |
Ga0066690_110330781 | 3300005177 | Soil | MSYSPALIAHICGGSLGLLSGTAAMTFRKGSPGHVLAGKVFVASMLTMG |
Ga0066688_108170602 | 3300005178 | Soil | MSYSPILIVHICAGSLGLLSGTAAMSFRKGSPRHVLAGKVFVASM |
Ga0066676_103923491 | 3300005186 | Soil | MQFSPVLVVHICAGTLGLLSGSAAMLFRKGSPRHVLAGKV |
Ga0070705_1005799013 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYSPILTVHILGGTVGLVSGTAAMCFRKGSHRHVLAGRIFV |
Ga0066697_100997553 | 3300005540 | Soil | MSYSPILIAHICGGVVGLVSGTAAMCFRKGSPRHVLAGKVFVAS |
Ga0070733_100076701 | 3300005541 | Surface Soil | MSYSPILIFHICAGTVGLLSGTVAIIFRKGSRGHV |
Ga0066701_101210311 | 3300005552 | Soil | MSYSPALIVHICGGSLGLLSGTAAMCFRKGSPRHVLAGKV |
Ga0066691_104968541 | 3300005586 | Soil | MSYSPALVVHICGGTLGLLSGTAAMCFRKGSPRHVLAGKVFVASMLTMGAFAAY |
Ga0070763_100723276 | 3300005610 | Soil | MAYSPILVVHICAGTAGLLSGTAAMSFRKGSSRHVLAGRVFVA |
Ga0070764_106581581 | 3300005712 | Soil | MSYSPILIAHIFAGTLGLLSGTAAMSFRKGSPRHVLAGK |
Ga0070766_107012672 | 3300005921 | Soil | MPYSPILMVHICAGTLGLLSGTAAMSFRKGSARHVLAGRVFVASMLTM |
Ga0070712_1001526593 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFSPLLPVHIAGGIVGILSGTAAMSFRKGSLRHALAGKVFVA |
Ga0070765_1018576542 | 3300006176 | Soil | MPYSPIMLLHICAGTIGLLSGAAAIVFRKGSPRHV |
Ga0068871_1019379171 | 3300006358 | Miscanthus Rhizosphere | MPYSPILIVHICAGTLGLLSGTAAMSFRKGSPRHVLAGKVFVASMLSM |
Ga0066660_100712515 | 3300006800 | Soil | MSYSPILIAYACAGNVGLLSGTAAMCFRKGSPRHVLAGKIFVA |
Ga0073928_111000361 | 3300006893 | Iron-Sulfur Acid Spring | MPYSPILIGHICAGTLGLLSGTAAMSFRKGSPRHVLAGKVFV |
Ga0075426_103229961 | 3300006903 | Populus Rhizosphere | MTYSPILLVHICCGTLGLLSGTAAMCFRKGSSRHVLAGKVFVA |
Ga0099794_106089931 | 3300007265 | Vadose Zone Soil | MSYSPILIVHICAGSLGLLSGTAAMSFRKGSPRHVLA |
Ga0099829_102305513 | 3300009038 | Vadose Zone Soil | MAYSPALIVHICGGSLGLLSGTAAMCFRKGSPRHVLAG |
Ga0099829_116931221 | 3300009038 | Vadose Zone Soil | MSFSLLPLHVSAGIVGILSGAAAMSFRKGSPRHAL |
Ga0099830_106382862 | 3300009088 | Vadose Zone Soil | MPYSPILVVHICAGSLGLLSGTAAMSFRKGSPRHMLAGKVFVVS |
Ga0099830_109810681 | 3300009088 | Vadose Zone Soil | MSYSPTLIVHILGGSLGLVSGTAAMTFRKGSPRHVLAGRV |
Ga0099827_110348551 | 3300009090 | Vadose Zone Soil | MSYSPALIVHICGGVVGLVCGTAAMAFRKGSPRHVLAGRIFVASM |
Ga0066709_1023245302 | 3300009137 | Grasslands Soil | MSYSPILAVHICAGSLGLLSGTAAMSFRKGSPRHVLAGKVFVASM |
Ga0099792_108712402 | 3300009143 | Vadose Zone Soil | MPYSPILVVHICAGTLGLLSGTAAMSFRKGSPRHMLAG |
Ga0126374_114467302 | 3300009792 | Tropical Forest Soil | MGFSPILFVHICSGIAGLFSGAAAAIFRKGSHRHALA |
Ga0126384_100210981 | 3300010046 | Tropical Forest Soil | MSYSPMLIVHICAGTLGLLTGTAAMSFRKGSHPHVVA |
Ga0126373_107216752 | 3300010048 | Tropical Forest Soil | MLYSPILVAHICAGSVGLLSGTAALSFRKGSSRHVLAGRVFV |
Ga0126373_119085812 | 3300010048 | Tropical Forest Soil | MHYSPLLLVHICAGTAALVSGATAMVFRKGSRGHVMAGKVFVA |
Ga0134067_100154414 | 3300010321 | Grasslands Soil | MAYSPILLAHILGGTVGLLSGTAAMSFRKGSPRHVL |
Ga0134121_115916402 | 3300010401 | Terrestrial Soil | VSPILAAHICGGTLGLASGAAALSLPKGSRWHALAGKVFVVS |
Ga0150983_138636192 | 3300011120 | Forest Soil | MPYSPILIGHTCAGTLGLLSGTAAMSFRKGSPRHVMA |
Ga0137392_114811421 | 3300011269 | Vadose Zone Soil | MSFSPLLAFHISAGSVGILSGAAAMSFRKGSPRHA |
Ga0137391_102432893 | 3300011270 | Vadose Zone Soil | MSYSPILIVHICAGSLGLLSGTAAMSFRKGSPRHVLAG |
Ga0137391_106011242 | 3300011270 | Vadose Zone Soil | MKYSPILIFHICAGILGLLSGTAAMSFRKGSHRHRLTGNVF |
Ga0137389_104328813 | 3300012096 | Vadose Zone Soil | MSYSPILVVHICAGSLGLLSGTAAMSFRKGSPRHVLAGKVFVASML |
Ga0137389_105616212 | 3300012096 | Vadose Zone Soil | MSYSPILIVHICAGSLGLLSGTAAMSFRKGSPRHALAGKVFVIA |
Ga0137364_100171126 | 3300012198 | Vadose Zone Soil | MQFSPVLVVHICAGTLGLLSGSAAMLFRKGSPRHVLAG |
Ga0137382_107019301 | 3300012200 | Vadose Zone Soil | MSYSPILAVHICAGSLGLLSGTAAMSFRKGSPRHV |
Ga0137399_103969823 | 3300012203 | Vadose Zone Soil | MSYSPILVVHICGATLGLLSGTAAMSFRKGSPRHVLAGKVFVAS |
Ga0137362_100827501 | 3300012205 | Vadose Zone Soil | MSYSPILVVHICGGTLGLLSGTAAMSFRKGSPRHVLAGKVFVASMLTMA |
Ga0137362_105533123 | 3300012205 | Vadose Zone Soil | MSYPPILVVHICAGTAGLLSGTAAMSFRKGSPRHVLAGQVFVAS |
Ga0137362_109445971 | 3300012205 | Vadose Zone Soil | MAYSPTLIVHIFGGTFGLLSGTAAMFFRKGSPRHVLAGKVFVASMLTM |
Ga0137381_108334791 | 3300012207 | Vadose Zone Soil | MSYSPALIVHICGGTLGLLSGTAAMCFRKGSPRHV |
Ga0137381_111442721 | 3300012207 | Vadose Zone Soil | MAYSPILVVHICAGSLGLLSGTAAMSFRKGSPRHL |
Ga0137381_113546201 | 3300012207 | Vadose Zone Soil | MSYSPILVVHICAGSLGLLSGTAAMSFRKGSPRHL |
Ga0137376_111521652 | 3300012208 | Vadose Zone Soil | MAYSPTLIVHICGGSLGLLSGTAAMCFRKGSPRHVLA |
Ga0137377_102642112 | 3300012211 | Vadose Zone Soil | MSYSPALIVHICGGSLGLLSGTAAMAFRKGSPRHVLAGKVFVASML |
Ga0137377_106843583 | 3300012211 | Vadose Zone Soil | MRPPILIIHICAGVVGVLSGAAAMSFRKGSRPHRVG |
Ga0137377_111946741 | 3300012211 | Vadose Zone Soil | MSYSPALIVHICGGSLGWPPGSLPGIFPKGSPGPVLGGRGFSQT |
Ga0137370_106574141 | 3300012285 | Vadose Zone Soil | MSYSPALIAHICGGSLGLLSGTAAMTFRKGSPGHVLAGKVFVASMRTMGAF |
Ga0137387_101297161 | 3300012349 | Vadose Zone Soil | MSYSPALVVHICGGTLGLLSGTAAMCFRKGSPRHVLAGKVFVAS |
Ga0137360_112589362 | 3300012361 | Vadose Zone Soil | MAYSPILIVHILGGSLGLLSGTAAMTFRKGSPRHVLA |
Ga0137360_112712731 | 3300012361 | Vadose Zone Soil | MSYSPTLIVHILGGTVGLLSGTAAMTFRKGSPRHVLAGR |
Ga0137361_105170583 | 3300012362 | Vadose Zone Soil | MSYPPILVVHICAGTLGLLSGTAAMSFRKGSPRHVLAG |
Ga0137361_109714892 | 3300012362 | Vadose Zone Soil | MAYSPTLIVHILGGTVGLVSGTAAMCFRKGSSRHVLAGRVFVASMLTMGVF |
Ga0137390_109944002 | 3300012363 | Vadose Zone Soil | MPYSPILVVHICGGTLGLLSGTAAIAFRKGSPRHVL |
Ga0137390_110028582 | 3300012363 | Vadose Zone Soil | MPYSPILVVHICAGSLGLLSGTAAMSFRKGSPRHRLAG |
Ga0137390_114446191 | 3300012363 | Vadose Zone Soil | MSYSPILIVHICAGSLGLLFGTAAMSFRKGSPRHVLAGKV |
Ga0137358_106392452 | 3300012582 | Vadose Zone Soil | MSYSPPLIVHICGGSLGLLSGTAAMCFRKGSPRHVLA |
Ga0137397_105575861 | 3300012685 | Vadose Zone Soil | MSYSPILIVHICGGVVGLVSGTAAMCFRKGSPRHVLAGKVFVASMLTMAVFAV |
Ga0137395_110581561 | 3300012917 | Vadose Zone Soil | MSYSPILLVHICGGTLGLLSGTAAMTFRKGSPRHV |
Ga0137396_101890361 | 3300012918 | Vadose Zone Soil | MPYSPTLIVHILGGVVGLVSGTAALAFRKGSRRHVLAGRIF |
Ga0137396_106823241 | 3300012918 | Vadose Zone Soil | MAYSPILVIHICAATLGLVSGTAAMCFRKGSPRHVLAGKVFVASMLTMAA |
Ga0137419_108763962 | 3300012925 | Vadose Zone Soil | MAYSPILIVRICGGTLGLLSGTAAMSFRKGSPRHVLAGRIFVAS |
Ga0137407_115241371 | 3300012930 | Vadose Zone Soil | MVFSPLLPVHLSAGVVGILSGTAAMSFRKGSPRHALAGRIFVIAMVT |
Ga0137410_110649061 | 3300012944 | Vadose Zone Soil | MSYSPILIVHICGGVVGLVSGTAAMCFRKGSPRHVLAGKVFVASMLTMAVFAVYL |
Ga0137410_115943332 | 3300012944 | Vadose Zone Soil | MSYSPTLIVHILGGTVGLVSGTAALAFRKGFPRHVLAGRIFVASML |
Ga0137410_120962062 | 3300012944 | Vadose Zone Soil | MLYLPILILHVCAGAVGLLSGTAAILFSKGSPRHVQAGKVFVASMLIMA |
Ga0126375_105007962 | 3300012948 | Tropical Forest Soil | MIYFPMLAIHICGGILGLLSGTAAICFRKGSPRHVLAGKVFVASM |
Ga0126369_116515221 | 3300012971 | Tropical Forest Soil | MRYSPILLVHILGGTLGLVSGATAVVFRKGSRGRVLPGRVFVASMLT |
Ga0137409_100577386 | 3300015245 | Vadose Zone Soil | MSYSPILVVHICGGTLGLLSGTAAMSFRKGSPRHVLAGKVFVASMLTMAVF |
Ga0137409_103506341 | 3300015245 | Vadose Zone Soil | MSYSPILIVHICGGVVGLVSGTAAMCFRKGSPRHVLAGKVFVASMLTMAVF |
Ga0137409_106370862 | 3300015245 | Vadose Zone Soil | MSYSPTLIVHILGGVVGLVSGTAALAFRKGSPRHVLAGRIFV |
Ga0180070_10175602 | 3300015251 | Soil | MRSPILVIHICGGVAGLLSGVAAVSFRKGSPRHRMAGN |
Ga0134073_100875941 | 3300015356 | Grasslands Soil | MSYSPILIAHICGGVVGLVSGTAAMCFRKGSPRHVLA |
Ga0132255_1015478131 | 3300015374 | Arabidopsis Rhizosphere | MLYSPLLPVHIAGGITGILFGAAALIYRKGSARHAL |
Ga0187879_107289792 | 3300017946 | Peatland | MSYSPMLTVHIFAGILGLLSGTAALSFRKGSARHVL |
Ga0187869_103096482 | 3300018030 | Peatland | MSFSPLLPVHISAGITGILSGAAAMGFRKGSPRHA |
Ga0187855_104502621 | 3300018038 | Peatland | MSYSPILSAHIFAGTLGLLSGTAAMSFRKGSTRHVLAGKIFVA |
Ga0066662_124434411 | 3300018468 | Grasslands Soil | MSYSPTLIVHICGGVVGLVSGTAAMCFRKGSPRHVLAGRIFVASMLTMGAL |
Ga0066662_125221032 | 3300018468 | Grasslands Soil | MLVSPLLPVHISAGVVGILSGSAAMSFRKGSPRHALAGKVFV |
Ga0210407_113568782 | 3300020579 | Soil | TLIAHIFARTLGLLSGTAAMSFRKGFPRHVLTGKIFVASMLTMAVLNVRDLC |
Ga0210403_103910832 | 3300020580 | Soil | VSYSPILIAHIFAGTLGLLSGTAAMSVRKGSPRHVLV |
Ga0210403_111627292 | 3300020580 | Soil | MSPLLPLHISAGIVGILSGAAAMSFRKGSARHALA |
Ga0179596_106112631 | 3300021086 | Vadose Zone Soil | MSYSPALIVHICGGVVGLVCGTAAMAFRKGSPRHVLAGRIFVAS |
Ga0210397_105049561 | 3300021403 | Soil | MFYSPILFLHICAGTLGLLSGTVAICFRKGSRGHVLAG |
Ga0210389_110718721 | 3300021404 | Soil | MPYLPILFLHVCAGTVGLLSGTAAMFFRKGSPRHIQA |
Ga0210387_112288142 | 3300021405 | Soil | MSYSPVLLVHICAGTVGLLSGTAAILFRKGSPRHVL |
Ga0210386_108120701 | 3300021406 | Soil | MPYSPILMVHICGGTLGLLSGTAAMSFRKGSPRHVLAGKVF |
Ga0210384_103461083 | 3300021432 | Soil | MRFSPVLLFHICAGILGLPSGTAAMSFRKGSPRHALAGKIFV |
Ga0210384_109549472 | 3300021432 | Soil | MSYSPTLIVHICGGTLGLLSGTAAMTFRKGSPRHVLAGKVFVASMLTMAVF |
Ga0210391_101423022 | 3300021433 | Soil | MRYSPILIAHICAGTIGLLSGTAAMSFRKGSTRHVLAGKVFVAN |
Ga0210391_115606252 | 3300021433 | Soil | MSYSPILVVHICAGSLGLLSGTAAMLFRKGSRGHV |
Ga0210390_100168071 | 3300021474 | Soil | MAYSPVMIIHILGGTLGLVSGTAAIVFRKGSPRHKLAGRIF |
Ga0210410_105196091 | 3300021479 | Soil | MSYSPILIVHICGGTLGLLSGTAAMTFRKGSPRHVLAG |
Ga0210409_101586334 | 3300021559 | Soil | MSYSPTLIVHILGGSLGLLSGTAAMIFRKGSPRHVLAG |
Ga0212123_104129782 | 3300022557 | Iron-Sulfur Acid Spring | VSYSPILIAHIFAGTLGLLSGTAAMSVRKGSPRHV |
Ga0224566_1064032 | 3300022728 | Plant Litter | MQSPILLIHICAGVLGLLSGTAALCFRKGSPGHVLAGKVFVASMLT |
Ga0247671_10046815 | 3300024284 | Soil | MSYSPILIAHICGGVVGLVSGTAAMCFRKGSPRHVLAGRIFVASMLTMGAL |
Ga0247666_10201851 | 3300024323 | Soil | MSYSPILIVHICAGSLGLVSGTAAMCFRKGSPRHVLAGKVFV |
Ga0207684_113996761 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAYSPTLLVHILGGTIGLLSGTAAMSFRKGSPRHVLAGRIF |
Ga0207707_108383971 | 3300025912 | Corn Rhizosphere | MSPILAVHICGGTLGLISGAAAICFRKGSPRHAFAGKIFVLSM |
Ga0207662_102902031 | 3300025918 | Switchgrass Rhizosphere | VSPILAAHICGGTLGLASGAAALSLPKGSRWHALAGKVFV |
Ga0207646_101938803 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLYSPLLPVHIAGGIAGILSGMAALIYRKGSARHALA |
Ga0209234_10203043 | 3300026295 | Grasslands Soil | MSYSPILVLHICAGSLGLLSGTAAMSFRKGSARHVLAGKVWSEPLF |
Ga0209234_12790081 | 3300026295 | Grasslands Soil | MPYSPILIVHICAGTLGLLSGTAAMSFRKGFPRHVLAGRVFVISMLTM |
Ga0209027_11968862 | 3300026300 | Grasslands Soil | MSYSPILVVHICGGTLGLLSGTAAMSFRKGSPRHVLAGKVFV |
Ga0209027_12762731 | 3300026300 | Grasslands Soil | MSYSPALIAHICGGSLGLLSGTAAMIFRKGSPGHVLA |
Ga0209239_12126462 | 3300026310 | Grasslands Soil | MRFSPVLVVHICAGTLGLLSGSAAMLFRKGSPRHVL |
Ga0209131_11267113 | 3300026320 | Grasslands Soil | MSYSPTLIVHICGGVVGLVSGTAAMCFRKGSPRHVLA |
Ga0209802_11388453 | 3300026328 | Soil | MSYSPTLIVHICGGVVGLVSGTAAMCFRKGSPRHVLAGRIFVASMLTM |
Ga0209375_10802193 | 3300026329 | Soil | MSYSPALIVHICGGSLGLLSGTAAMCFRKGSPRHVLAGRVFVASML |
Ga0257163_10770051 | 3300026359 | Soil | MAYSPILIVHICGGTLGLLSGTAAMSFRKGSPRHVLA |
Ga0257159_10940962 | 3300026494 | Soil | MSPLLPLHISAGIVGMLSGAAAMSFRKGSARHALAGKVFV |
Ga0209648_102536961 | 3300026551 | Grasslands Soil | MSYSPTLIVHILGGSLGLLSGTAAMTFRKGSPRHV |
Ga0209648_104190891 | 3300026551 | Grasslands Soil | MPYSPILVVHICAGSLGLVTGTAAMSFRKGSPRHRLAG |
Ga0209648_106329252 | 3300026551 | Grasslands Soil | MSYSPILIVHICAGSLGLLSGTAAMSFRKGSPRHVLAGK |
Ga0209648_108337391 | 3300026551 | Grasslands Soil | MPYSPILVVHICAGTLGLLSGTAAMSFRKGSPRHMLA |
Ga0207746_10208192 | 3300026865 | Tropical Forest Soil | MRFSPMLALHICSGVLGFLSGAAAISFRKGSPNHALAGKVFVITMLSLSA |
Ga0209218_11071412 | 3300027505 | Forest Soil | MFYSPILFLHICAGTLGLLSGTVAIFFRKGSRGHVLAG |
Ga0208985_10498882 | 3300027528 | Forest Soil | MHYSPTLIAHICGGSVGLLSGTVALCVRKGSIRHALAG |
Ga0208988_11230822 | 3300027633 | Forest Soil | MSYSPILVVHICGGTLGLLSGTAAMSFRKGSPRHVLAGKVF |
Ga0209446_11541441 | 3300027698 | Bog Forest Soil | MSYSPILVVHICAGTLGLLSGTAAMSFRKGSPRHALAGKVFVAA |
Ga0208989_101329141 | 3300027738 | Forest Soil | MAYSPILVVHICAGTLGLLSGTAAMSFRKGSPRHMLAGKVFV |
Ga0209772_100777381 | 3300027768 | Bog Forest Soil | MSYSPILIAHICAGTLGMLSGTAAMSFRKGSPRHVLAGKVFVSSMLTMAAGAVYL |
Ga0209177_101863501 | 3300027775 | Agricultural Soil | MAYSPILLVHICGGTLGLLSGTAAMSFRKGSPRHVLAGRIFVASMLFMAAG |
Ga0209139_100009065 | 3300027795 | Bog Forest Soil | MCYSPMLLVHICAGTTGLLSGGAAMSFRKGSPRYVLAGRWFVALMLTADSAG |
Ga0209180_101704061 | 3300027846 | Vadose Zone Soil | MSYSPILVVHICAGSLGLLSGTAAMSFRKGSPRHVL |
Ga0209465_101340123 | 3300027874 | Tropical Forest Soil | MAYSPILLVHIFGGTVGLLSGAAAMSFRKGSPRHVL |
Ga0209590_109258332 | 3300027882 | Vadose Zone Soil | MPYSPILLAHICGGTLGLLSGTAAMTFRKGSPRHVLAGKVFVA |
Ga0209168_101533513 | 3300027986 | Surface Soil | MLYSPILLFHICCGTLGLLSGIAALLFRKGSPRHVLAGKIF |
Ga0265351_10028733 | 3300028020 | Soil | VSYSPILIAHIFAGTIGLLSGTAAMSFRKGSSRHVLVGK |
Ga0209526_105340942 | 3300028047 | Forest Soil | MRYSPILIFHVCAGITGLLSGAVAMSFRKGSRGHVM |
Ga0257175_10318631 | 3300028673 | Soil | MSPLLPLHISAGIVGILSGAAAISFRKGSARHALAG |
Ga0302200_103652162 | 3300028909 | Bog | MQSPILLIHICAGVLGLLSGTAALCFRKGSPGHVSAGKVFVASM |
Ga0311371_116230722 | 3300029951 | Palsa | LPFPPILALHIGAGTLGLLSGTVAISVRKGSRNHATS |
Ga0302276_103135751 | 3300029992 | Bog | MQSPILLIHICAGVLGLLSGTAALCFRKGSPGHVSAG |
Ga0302274_100221287 | 3300030041 | Bog | MQSPILLIHICAGVLGLLSGTAALCFRKGSPGHVSAGKVFV |
Ga0302182_101151771 | 3300030054 | Palsa | MSYSPILMAHIFAGTLGLLSGTAAMSLRKGSPRHVLAGKIFVASMLT |
Ga0302183_102643961 | 3300030509 | Palsa | MSYSPILIAHIFAGTLGLLAGTAAMSFRKGSPRHVLAGKIFVASM |
Ga0302180_102264552 | 3300031028 | Palsa | MSYSPILMAHIFAGTLGLLSGTAAMSLRKGSPRHVLA |
Ga0170824_1244055251 | 3300031231 | Forest Soil | MPYSPILIGHICAGTSGLLSGTAAMSFRKGSPRHVLAGKIFVASMLTMV |
Ga0318534_107076651 | 3300031544 | Soil | MPYSPVLLVHIFGGALGLLSGAAAVVFRKGSRRHILSGRI |
Ga0318528_101579533 | 3300031561 | Soil | MLYSPLLPVHITGGVLGILSGSAAMIYRKGSTRHALAGKFFVAS |
Ga0310915_112470441 | 3300031573 | Soil | MPYSPMLVVHICGGILGLLSGTAAISFQKGSHRHILAGKVFVASMLVMA |
Ga0307483_10089513 | 3300031590 | Hardwood Forest Soil | MPYSPILIVHICGGTLGLASGTASMSFRKGSPRHMLAGKVFVVSM |
Ga0306917_104429621 | 3300031719 | Soil | MPYSPILVLHICGGTLGLLSGSAAISFRKGSRRHVLAGR |
Ga0307469_103011041 | 3300031720 | Hardwood Forest Soil | MPFSPLLPVHIAGGIVGLLSGTAALCFRKGSPRHALAG |
Ga0307477_100157421 | 3300031753 | Hardwood Forest Soil | MPYSPILMVHICGGTLGLLSGTAAMSFRKGSPRHVLAGRVFV |
Ga0318554_107422731 | 3300031765 | Soil | MRYSPILVVHICAGTSGLFSGTAAMIFRKGSPRHVL |
Ga0318509_104038502 | 3300031768 | Soil | MLYSPLLPVHITGGVLGILSGSAAMIYRKGSTRHALAGKFFVASML |
Ga0307478_111262511 | 3300031823 | Hardwood Forest Soil | MSYSLILVAHICAGTLGLLSGTAAMCFRKGSPRHG |
Ga0306919_111504222 | 3300031879 | Soil | MPYSPVLTLHIVAGIMGILSGTAAMSFRKGSPRHALAGKVFVSSML |
Ga0306925_104454681 | 3300031890 | Soil | MRFSPILALHICSGVLGFLSGAVAISFRKGSPNHGLAGKVFVITMLSLA |
Ga0306923_114012761 | 3300031910 | Soil | VSYSPMLTVHILGGTLGLLSGAAALAFRKGSPRHVLAGRIFV |
Ga0306921_102480395 | 3300031912 | Soil | MPSSPLLFVHVCAGTLGLLSGTAALSFRKGSPRHVHA |
Ga0306921_121814471 | 3300031912 | Soil | MWFSPILILHISAGILGIVSGTAAISFRKGSPRHALAGKV |
Ga0310909_100234298 | 3300031947 | Soil | MLYSSILAAHICAGTVGVLSGTAALSFRKGSPRHV |
Ga0310909_105552593 | 3300031947 | Soil | MPSSPLLFVHVCAGTLGLLSGTAALSFRKGSPRHVHAGRVFVASMLTMAAAAIYL |
Ga0307479_106768742 | 3300031962 | Hardwood Forest Soil | MPFSPLLPVHIAGGIVGILSGTAAMSFRKGSPRHALAGKVFVAAM |
Ga0307479_108044212 | 3300031962 | Hardwood Forest Soil | MPYSPILVVHICAGTLGLLSGTAAMSFRKGSRRHVL |
Ga0307479_110365641 | 3300031962 | Hardwood Forest Soil | MSYSPIMVVHLCAGTLGLVSGTAAMSFRKGSPRHVLAGKVFVASMLTMA |
Ga0306922_120172522 | 3300032001 | Soil | MPYSPALVVHICGGTLGLLSGTAAIVFRKGSPRHVLAGKI |
Ga0318533_102708022 | 3300032059 | Soil | MPYSPVLLVHIFGGALGLLSGAAAVVFRKGSRRHILSGRIF |
Ga0307471_1008465183 | 3300032180 | Hardwood Forest Soil | MSFSLLPLHVSAGIAGLLSGTAAMSFRKGSPRHALAGKIF |
Ga0306920_1036075041 | 3300032261 | Soil | MHLPLLILHITGGTLGILTGFTAIFFRKGSRWHALAGKAFVASMLTMASCGT |
Ga0310914_105395011 | 3300033289 | Soil | MPYSPILVLHICGGTLGLLSGSAAISFRKGSRRHVLAG |
⦗Top⦘ |