Basic Information | |
---|---|
Family ID | F032939 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 178 |
Average Sequence Length | 40 residues |
Representative Sequence | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRLLDTQE |
Number of Associated Samples | 137 |
Number of Associated Scaffolds | 175 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 88.76 % |
% of genes near scaffold ends (potentially truncated) | 56.74 % |
% of genes from short scaffolds (< 2000 bps) | 77.53 % |
Associated GOLD sequencing projects | 127 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.404 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.730 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.539 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.303 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 175 Family Scaffolds |
---|---|---|
PF01850 | PIN | 6.86 |
PF04221 | RelB | 6.29 |
PF00012 | HSP70 | 5.71 |
PF05016 | ParE_toxin | 5.14 |
PF02129 | Peptidase_S15 | 2.29 |
PF01381 | HTH_3 | 2.29 |
PF00578 | AhpC-TSA | 1.71 |
PF05015 | HigB-like_toxin | 1.71 |
PF01425 | Amidase | 1.71 |
PF07883 | Cupin_2 | 1.14 |
PF13365 | Trypsin_2 | 1.14 |
PF09720 | Unstab_antitox | 1.14 |
PF13641 | Glyco_tranf_2_3 | 1.14 |
PF11645 | PDDEXK_5 | 1.14 |
PF02780 | Transketolase_C | 0.57 |
PF13083 | KH_4 | 0.57 |
PF13304 | AAA_21 | 0.57 |
PF14499 | DUF4437 | 0.57 |
PF13751 | DDE_Tnp_1_6 | 0.57 |
PF07638 | Sigma70_ECF | 0.57 |
PF13649 | Methyltransf_25 | 0.57 |
PF01709 | Transcrip_reg | 0.57 |
PF00753 | Lactamase_B | 0.57 |
PF00246 | Peptidase_M14 | 0.57 |
PF12704 | MacB_PCD | 0.57 |
PF02518 | HATPase_c | 0.57 |
PF00069 | Pkinase | 0.57 |
PF07726 | AAA_3 | 0.57 |
PF14082 | DUF4263 | 0.57 |
PF13193 | AMP-binding_C | 0.57 |
PF01797 | Y1_Tnp | 0.57 |
PF00800 | PDT | 0.57 |
PF00312 | Ribosomal_S15 | 0.57 |
PF02866 | Ldh_1_C | 0.57 |
PF13411 | MerR_1 | 0.57 |
PF00108 | Thiolase_N | 0.57 |
PF00072 | Response_reg | 0.57 |
PF13030 | DUF3891 | 0.57 |
PF08843 | AbiEii | 0.57 |
PF01642 | MM_CoA_mutase | 0.57 |
PF00582 | Usp | 0.57 |
PF01555 | N6_N4_Mtase | 0.57 |
PF11746 | DUF3303 | 0.57 |
PF13432 | TPR_16 | 0.57 |
PF03795 | YCII | 0.57 |
PF00149 | Metallophos | 0.57 |
PF00886 | Ribosomal_S16 | 0.57 |
PF13286 | HD_assoc | 0.57 |
PF06983 | 3-dmu-9_3-mt | 0.57 |
PF11138 | DUF2911 | 0.57 |
PF00118 | Cpn60_TCP1 | 0.57 |
PF06071 | YchF-GTPase_C | 0.57 |
PF13589 | HATPase_c_3 | 0.57 |
PF05161 | MOFRL | 0.57 |
PF04226 | Transgly_assoc | 0.57 |
PF02371 | Transposase_20 | 0.57 |
COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
---|---|---|---|
COG3077 | Antitoxin component of the RelBE or YafQ-DinJ toxin-antitoxin module | Defense mechanisms [V] | 6.29 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 5.71 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.29 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 1.71 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.71 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.57 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.57 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.57 |
COG2379 | Glycerate-2-kinase | Carbohydrate transport and metabolism [G] | 0.57 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.57 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.57 |
COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.57 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.57 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.57 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.57 |
COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.57 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.57 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.57 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 0.57 |
COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.57 |
COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.57 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.57 |
COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 0.57 |
COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.97 % |
Unclassified | root | N/A | 23.03 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035918004|FACENC_F56XM5W01BWCGI | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300001356|JGI12269J14319_10115353 | Not Available | 1260 | Open in IMG/M |
3300001593|JGI12635J15846_10167281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1489 | Open in IMG/M |
3300001593|JGI12635J15846_10389222 | Not Available | 844 | Open in IMG/M |
3300001593|JGI12635J15846_10763227 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300002909|JGI25388J43891_1050707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300002917|JGI25616J43925_10090752 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300004092|Ga0062389_100096932 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 2594 | Open in IMG/M |
3300004092|Ga0062389_104350056 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300004092|Ga0062389_104807425 | Not Available | 509 | Open in IMG/M |
3300004152|Ga0062386_100639744 | Not Available | 871 | Open in IMG/M |
3300004600|Ga0068964_1205029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 512 | Open in IMG/M |
3300004635|Ga0062388_101281347 | Not Available | 730 | Open in IMG/M |
3300005437|Ga0070710_10012446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4227 | Open in IMG/M |
3300005574|Ga0066694_10207665 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300005591|Ga0070761_10152364 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
3300005591|Ga0070761_10404000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300005591|Ga0070761_10695011 | Not Available | 636 | Open in IMG/M |
3300005602|Ga0070762_10876253 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300005921|Ga0070766_10217950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1200 | Open in IMG/M |
3300005921|Ga0070766_11152381 | Not Available | 536 | Open in IMG/M |
3300006086|Ga0075019_10551196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300006893|Ga0073928_10000006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 664508 | Open in IMG/M |
3300006893|Ga0073928_10900446 | Not Available | 606 | Open in IMG/M |
3300007982|Ga0102924_1046558 | All Organisms → cellular organisms → Bacteria | 2596 | Open in IMG/M |
3300009012|Ga0066710_103130261 | Not Available | 638 | Open in IMG/M |
3300009038|Ga0099829_10054174 | All Organisms → cellular organisms → Bacteria | 2983 | Open in IMG/M |
3300009088|Ga0099830_11872789 | Not Available | 501 | Open in IMG/M |
3300009090|Ga0099827_10336428 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300009090|Ga0099827_10777750 | Not Available | 828 | Open in IMG/M |
3300009523|Ga0116221_1174153 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300009525|Ga0116220_10455429 | Not Available | 577 | Open in IMG/M |
3300009624|Ga0116105_1039024 | Not Available | 1057 | Open in IMG/M |
3300009628|Ga0116125_1105587 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300009636|Ga0116112_1132047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300009638|Ga0116113_1179061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300009641|Ga0116120_1177755 | Not Available | 679 | Open in IMG/M |
3300009665|Ga0116135_1290373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
3300009683|Ga0116224_10037805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2368 | Open in IMG/M |
3300009700|Ga0116217_10260952 | Not Available | 1122 | Open in IMG/M |
3300010336|Ga0134071_10068991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1637 | Open in IMG/M |
3300010341|Ga0074045_10345111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
3300010341|Ga0074045_10913966 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300010373|Ga0134128_11055106 | Not Available | 898 | Open in IMG/M |
3300010379|Ga0136449_102105188 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300010379|Ga0136449_103518622 | Not Available | 596 | Open in IMG/M |
3300010866|Ga0126344_1130158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300011120|Ga0150983_13342041 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300011269|Ga0137392_10177439 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
3300011270|Ga0137391_10652723 | Not Available | 878 | Open in IMG/M |
3300011270|Ga0137391_11410305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300011271|Ga0137393_10334442 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300012039|Ga0137421_1047229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1159 | Open in IMG/M |
3300012189|Ga0137388_10535060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
3300012189|Ga0137388_10837022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
3300012200|Ga0137382_10343492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
3300012202|Ga0137363_10680379 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300012202|Ga0137363_11605064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300012206|Ga0137380_10108291 | Not Available | 2539 | Open in IMG/M |
3300012206|Ga0137380_11767454 | Not Available | 502 | Open in IMG/M |
3300012363|Ga0137390_10708943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
3300012363|Ga0137390_11115236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 738 | Open in IMG/M |
3300012922|Ga0137394_11373770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300012923|Ga0137359_10367524 | Not Available | 1278 | Open in IMG/M |
3300012925|Ga0137419_10730169 | Not Available | 805 | Open in IMG/M |
3300012944|Ga0137410_10015500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5188 | Open in IMG/M |
3300012944|Ga0137410_11793286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300012988|Ga0164306_10094440 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
3300014169|Ga0181531_10539989 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300014489|Ga0182018_10031670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3357 | Open in IMG/M |
3300014495|Ga0182015_10196856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. EB88 | 1349 | Open in IMG/M |
3300014495|Ga0182015_10196856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. EB88 | 1349 | Open in IMG/M |
3300014498|Ga0182019_10356528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
3300014501|Ga0182024_10012434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16840 | Open in IMG/M |
3300014501|Ga0182024_10031164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9132 | Open in IMG/M |
3300014501|Ga0182024_10232619 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
3300014501|Ga0182024_10676014 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300014654|Ga0181525_10040015 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
3300014839|Ga0182027_10872159 | Not Available | 934 | Open in IMG/M |
3300015052|Ga0137411_1092831 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300017933|Ga0187801_10109411 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300017946|Ga0187879_10006615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7612 | Open in IMG/M |
3300017948|Ga0187847_10014401 | All Organisms → cellular organisms → Bacteria | 5091 | Open in IMG/M |
3300018033|Ga0187867_10806631 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300018038|Ga0187855_10553589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. EB88 | 670 | Open in IMG/M |
3300018046|Ga0187851_10851131 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300018060|Ga0187765_11350224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300018062|Ga0187784_11509123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300018082|Ga0184639_10526418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300018468|Ga0066662_11945563 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300019786|Ga0182025_1356669 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
3300020062|Ga0193724_1011134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1913 | Open in IMG/M |
3300020579|Ga0210407_10327623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1197 | Open in IMG/M |
3300020580|Ga0210403_10420742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
3300020583|Ga0210401_10084281 | All Organisms → cellular organisms → Bacteria | 2990 | Open in IMG/M |
3300020583|Ga0210401_10084281 | All Organisms → cellular organisms → Bacteria | 2990 | Open in IMG/M |
3300020583|Ga0210401_10595113 | Not Available | 968 | Open in IMG/M |
3300021168|Ga0210406_11088908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300021180|Ga0210396_10545017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1012 | Open in IMG/M |
3300021181|Ga0210388_10003670 | All Organisms → cellular organisms → Bacteria | 12000 | Open in IMG/M |
3300021403|Ga0210397_11298461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 565 | Open in IMG/M |
3300021407|Ga0210383_10318081 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300021407|Ga0210383_10492382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
3300021433|Ga0210391_10648600 | Not Available | 828 | Open in IMG/M |
3300022521|Ga0224541_1003232 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
3300022521|Ga0224541_1018485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 750 | Open in IMG/M |
3300022557|Ga0212123_10000002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2195071 | Open in IMG/M |
3300022714|Ga0242671_1132683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300024225|Ga0224572_1055350 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300024225|Ga0224572_1113293 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300024227|Ga0228598_1000983 | All Organisms → cellular organisms → Bacteria | 6218 | Open in IMG/M |
3300024330|Ga0137417_1052289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2233 | Open in IMG/M |
3300025505|Ga0207929_1040044 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300025898|Ga0207692_10008351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4281 | Open in IMG/M |
3300025922|Ga0207646_10551469 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300025928|Ga0207700_10848217 | Not Available | 817 | Open in IMG/M |
3300026078|Ga0207702_12078915 | Not Available | 558 | Open in IMG/M |
3300026320|Ga0209131_1092970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1604 | Open in IMG/M |
3300026320|Ga0209131_1092970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1604 | Open in IMG/M |
3300026324|Ga0209470_1251099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300026496|Ga0257157_1102643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300026555|Ga0179593_1138377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1629 | Open in IMG/M |
3300026555|Ga0179593_1162945 | Not Available | 1496 | Open in IMG/M |
3300027629|Ga0209422_1062837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 880 | Open in IMG/M |
3300027648|Ga0209420_1110349 | Not Available | 776 | Open in IMG/M |
3300027660|Ga0209736_1017513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2225 | Open in IMG/M |
3300027667|Ga0209009_1062611 | Not Available | 933 | Open in IMG/M |
3300027692|Ga0209530_1183018 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300027767|Ga0209655_10170501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 719 | Open in IMG/M |
3300027768|Ga0209772_10003506 | All Organisms → cellular organisms → Bacteria | 4083 | Open in IMG/M |
3300027829|Ga0209773_10006313 | All Organisms → cellular organisms → Bacteria | 4462 | Open in IMG/M |
3300027846|Ga0209180_10121826 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
3300027867|Ga0209167_10667544 | Not Available | 568 | Open in IMG/M |
3300027889|Ga0209380_10109144 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300027903|Ga0209488_10234046 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300027908|Ga0209006_10000002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 303505 | Open in IMG/M |
3300028731|Ga0302301_1000124 | All Organisms → cellular organisms → Bacteria | 63902 | Open in IMG/M |
3300028731|Ga0302301_1000437 | All Organisms → cellular organisms → Bacteria | 19278 | Open in IMG/M |
3300028747|Ga0302219_10005981 | All Organisms → cellular organisms → Bacteria | 4689 | Open in IMG/M |
3300028748|Ga0302156_10115194 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300028759|Ga0302224_10016831 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
3300028759|Ga0302224_10347767 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300028781|Ga0302223_10275307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. EB88 | 556 | Open in IMG/M |
3300028789|Ga0302232_10553659 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300028798|Ga0302222_10003750 | All Organisms → cellular organisms → Bacteria | 6780 | Open in IMG/M |
3300028866|Ga0302278_10111374 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300028906|Ga0308309_11186310 | Not Available | 658 | Open in IMG/M |
3300029636|Ga0222749_10624708 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300029882|Ga0311368_10049990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3824 | Open in IMG/M |
3300029882|Ga0311368_10439248 | Not Available | 952 | Open in IMG/M |
3300029944|Ga0311352_10235971 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300030041|Ga0302274_10391148 | Not Available | 623 | Open in IMG/M |
3300030054|Ga0302182_10001082 | All Organisms → cellular organisms → Bacteria | 15083 | Open in IMG/M |
3300030618|Ga0311354_10994031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
3300030646|Ga0302316_10391193 | Not Available | 559 | Open in IMG/M |
3300031057|Ga0170834_111827675 | Not Available | 536 | Open in IMG/M |
3300031234|Ga0302325_10440265 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
3300031234|Ga0302325_10926707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1204 | Open in IMG/M |
3300031234|Ga0302325_11980066 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300031241|Ga0265325_10099576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1424 | Open in IMG/M |
3300031708|Ga0310686_111480102 | Not Available | 643 | Open in IMG/M |
3300031708|Ga0310686_115908379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 3932 | Open in IMG/M |
3300031715|Ga0307476_10083379 | Not Available | 2234 | Open in IMG/M |
3300031715|Ga0307476_10118583 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
3300031715|Ga0307476_10165692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1593 | Open in IMG/M |
3300031823|Ga0307478_10539785 | Not Available | 973 | Open in IMG/M |
3300032160|Ga0311301_11762660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 740 | Open in IMG/M |
3300032180|Ga0307471_103668858 | Not Available | 543 | Open in IMG/M |
3300032515|Ga0348332_10777182 | Not Available | 550 | Open in IMG/M |
3300032515|Ga0348332_14516530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 998 | Open in IMG/M |
3300032898|Ga0335072_10130575 | All Organisms → cellular organisms → Bacteria | 3131 | Open in IMG/M |
3300033829|Ga0334854_016776 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
3300033829|Ga0334854_076634 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300034124|Ga0370483_0013156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 2370 | Open in IMG/M |
3300034163|Ga0370515_0036710 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
3300034163|Ga0370515_0072124 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300034163|Ga0370515_0182360 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300034163|Ga0370515_0413146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.73% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.43% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.62% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.06% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.49% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.49% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.37% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.37% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.25% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.25% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.81% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.81% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.81% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.69% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.69% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.69% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.12% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.12% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.12% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.12% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.12% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.56% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.56% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.56% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.56% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.56% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004600 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCA_6922550 | 2035918004 | Soil | MNIEIKDRALEARIQKQIQATGAASAEEALLRLLETQEEQDR |
JGI12269J14319_101153533 | 3300001356 | Peatlands Soil | MTIEIRDASLEARIQKQLQATGSRSVEEVLLRLLDTQE |
JGI12635J15846_101672813 | 3300001593 | Forest Soil | MTVEIRDASLEARIQTQLQATGSSSVEEVLLFSLETPSLLSS* |
JGI12635J15846_103892222 | 3300001593 | Forest Soil | MTIEIRDASLEARIRKQLQATGSSSVEEALLRLLGTNSALSS* |
JGI12635J15846_107632271 | 3300001593 | Forest Soil | MNIEIRDAALEARIQKQLQTTGSTTVEEVLIRLLETQEEQ |
JGI25388J43891_10507071 | 3300002909 | Grasslands Soil | VNIEIHNAALEARLQKQLQATGSASVEEVLLRLLETQEEQDR |
JGI25616J43925_100907522 | 3300002917 | Grasslands Soil | MTIEIRDASLEARIKKQLQATGSSSVEEVLLRLLEPQPLPALTSTI* |
Ga0062389_1000969321 | 3300004092 | Bog Forest Soil | VAAQEPGMNIEIRDRALEARIQRQIQATGSGSVEEVLLRLLETQ |
Ga0062389_1043500561 | 3300004092 | Bog Forest Soil | VNIEIRDPALEARLRKQLQATGSGSVEEVLLRLLETQEEQDR |
Ga0062389_1048074251 | 3300004092 | Bog Forest Soil | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRLLDTQEEQ |
Ga0062386_1006397442 | 3300004152 | Bog Forest Soil | VGLGRKERTLNIEIRDAELEARIRKQLQATGSGSVEEVLHRLLETQEE |
Ga0068964_12050291 | 3300004600 | Peatlands Soil | TKEDPVHIDIQDPALEARLQKQIQATGAGSAEEALNRLLQTQE* |
Ga0062388_1012813471 | 3300004635 | Bog Forest Soil | VAAQEPGMNIEIRDRALEARIQRQIQATGSGSVEEVLLRLLET |
Ga0070710_100124462 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIKIRDASLEARIQKPLQATGSSSVEEMLFRLLETTSALSS* |
Ga0066694_102076651 | 3300005574 | Soil | VNIEIHNAALEARLQKQLQATGSASVEEVLLRLLETQ |
Ga0070761_101523643 | 3300005591 | Soil | MTIEIRDASLEARIRKQLQATGSSSVEEALPRLFVTTPALSS* |
Ga0070761_104040001 | 3300005591 | Soil | MNIEIRDSALEARIQRQLQATGSSTVEEVLLRLLETQEEQ |
Ga0070761_106950111 | 3300005591 | Soil | VNIEIRDSALEARIQRQLQATGSSTVEEVLLRLLETQEEQ |
Ga0070762_108762531 | 3300005602 | Soil | VNIEIHDAALEARIQKQLQATGSASVEEVLLRLLETQ |
Ga0070766_102179502 | 3300005921 | Soil | MNIEINDRALEARIQKQIQAMGAASAEEALLRLLETQE |
Ga0070766_111523811 | 3300005921 | Soil | MHIEIHDAALEARIQKQIHATGSTSAEEALLHLLETQE |
Ga0075019_105511962 | 3300006086 | Watersheds | MYIEILDPAVEARIKKQMDSTGAASAEEALLRLLDT* |
Ga0073928_10000006389 | 3300006893 | Iron-Sulfur Acid Spring | MTTEIRDASLVARIRKQLQATGSSSVKEVLLRLLETTE* |
Ga0073928_109004462 | 3300006893 | Iron-Sulfur Acid Spring | MTIEIRDASSEARLQKQLQATGSSRAEEVLLRLPETAPSLLSS* |
Ga0102924_10465581 | 3300007982 | Iron-Sulfur Acid Spring | MNIEIRDAALEARLQKKLQATGSGSVEEVLLRLLETQEEQ |
Ga0066710_1031302611 | 3300009012 | Grasslands Soil | MNIEIHDSALDSRIQKLLRATGSSSVEEVLLRWVETQEEQDRW |
Ga0099829_100541742 | 3300009038 | Vadose Zone Soil | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRLLETAPSAVSS* |
Ga0099830_118727892 | 3300009088 | Vadose Zone Soil | MNIEIRDAALEARIKKQLQATGSASVEEVLHRLLETQEEQD |
Ga0099827_103364281 | 3300009090 | Vadose Zone Soil | MNIEIRDAALEARIKKQLQATGSASVEEVMLRLLET |
Ga0099827_107777502 | 3300009090 | Vadose Zone Soil | MTIEIRDASLEARIQKQVQATGSSSVEEVLLRLLETPSLLSS* |
Ga0116221_11741532 | 3300009523 | Peatlands Soil | VNIKIHDAALEARIQKQLQATGSARVEEVLVRLLETQEEQ |
Ga0116220_104554292 | 3300009525 | Peatlands Soil | MTIEIRDASLEARIQKQLQATDSRSVEEVLLRLLDTQEEQ |
Ga0116105_10390242 | 3300009624 | Peatland | MPIEIRNASLEARIRKQLQATGSSSVEEVLLLLFEPAPSVLSS* |
Ga0116125_11055871 | 3300009628 | Peatland | MTIEIRDPSLEARIRKQLQATGSSSVEEVLFRPLENTSTLSS* |
Ga0116112_11320472 | 3300009636 | Peatland | MNIEIRDEALAARIQKQLQLTGSGNVEELLLHLVET* |
Ga0116113_11790611 | 3300009638 | Peatland | MHIEIRGASLEARIQKQLHATGSASVEEVLLRLIETQV* |
Ga0116120_11777551 | 3300009641 | Peatland | MNIEIRDAALEARIRKQLQATGSNSVEEVLLRLLDTQEEQDR |
Ga0116135_12903731 | 3300009665 | Peatland | MTIEIRDASLEARIRKQLQATGSSSVEEVLLLLFEPAPSVLSS* |
Ga0116224_100378051 | 3300009683 | Peatlands Soil | VNIEIRDAALQARIQKQLQATGSGSVEEMLLRLLETQE |
Ga0116217_102609521 | 3300009700 | Peatlands Soil | VGLGRKERTLNIEIRDTELEARLKKQIQATGAGSVEEVLVRLLETQE |
Ga0134071_100689911 | 3300010336 | Grasslands Soil | VNIEIHDAALEARIQKQIQATSSSSVEEVLLRLLETQE |
Ga0074045_103451112 | 3300010341 | Bog Forest Soil | MNIEIRDPGLAARIEKQRKASASASVEDVLRRLLETQ |
Ga0074045_109139661 | 3300010341 | Bog Forest Soil | MNIEIRDASLEARIQRQLRATGSSSLEEVVQRLLETQEEQNR |
Ga0134128_110551062 | 3300010373 | Terrestrial Soil | MTIQIRDAELEARLQKQLEATGSNSLEELLLRLLENQEEQD |
Ga0136449_1021051881 | 3300010379 | Peatlands Soil | MNIEIRDAALEARIQKQLQATGSRSVEEVLLRLLETQEEQDRW |
Ga0136449_1035186222 | 3300010379 | Peatlands Soil | MNIEIRDRALEARIQRQIQATGSGSVEEALLRLLET |
Ga0126344_11301582 | 3300010866 | Boreal Forest Soil | MNIGIRDRDLEARIQRQIQATGSGSVEEVLLRLLETEEEQIASS* |
Ga0150983_133420411 | 3300011120 | Forest Soil | MTIEIRDASLEARIRKQLQAAGSSSVEEVLLRLLERNPSPR* |
Ga0137392_101774394 | 3300011269 | Vadose Zone Soil | MTIEIRDASLEARIRKQLQATGSSSVEEMLLRLHETALSAVSS* |
Ga0137391_106527233 | 3300011270 | Vadose Zone Soil | MNIEIRNPSLQARIQKQLEATGSASVEEVLLRLLE |
Ga0137391_114103052 | 3300011270 | Vadose Zone Soil | MNIEIRNASLQARIQKQLEATGSASVEEVLLRLLETQEE |
Ga0137393_103344422 | 3300011271 | Vadose Zone Soil | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRRLETASPLSS* |
Ga0137421_10472293 | 3300012039 | Soil | MKIEIHDPTLEARIQRQVQATGSGSVEETLVRLLET |
Ga0137388_105350601 | 3300012189 | Vadose Zone Soil | MTFSEHKERAMNIEIHDAALEARIQKQLLATGSGSVEEVLLR |
Ga0137388_108370224 | 3300012189 | Vadose Zone Soil | MTIEIRDASLEARIQKQLQATGSSSVEEVLLRLLDT |
Ga0137382_103434922 | 3300012200 | Vadose Zone Soil | VNIEIHDAALEARLQKQLQATGSASVEEVLLRLLETQEE |
Ga0137363_106803793 | 3300012202 | Vadose Zone Soil | MSKDGRPIMQIEIHDAILEERIQKQIQSTGSSSAEEVLLRLLET |
Ga0137363_116050641 | 3300012202 | Vadose Zone Soil | MNIEIHDAALEARIQKQLQATGSASVEEVLLRLLETQEEQD |
Ga0137380_101082916 | 3300012206 | Vadose Zone Soil | MNIEIRDAALEARIKKQLQATGSATVEEVLHRLLETQEEQDR |
Ga0137380_117674541 | 3300012206 | Vadose Zone Soil | MNIEIRDAALEARIKKQLQATGSASVEEVLHRLLETQ |
Ga0137390_107089431 | 3300012363 | Vadose Zone Soil | MTIEIRDAALEARLQKQLKSTGSSSVEELLLHLLQTQEEQ |
Ga0137390_111152363 | 3300012363 | Vadose Zone Soil | MTIEIRDASLEARIKKQLQVTDSSSVEEVLLRLLDPQEE |
Ga0137394_113737702 | 3300012922 | Vadose Zone Soil | MHEAPAMNIEIRDAALEARIKKQLRATGSTSVEEVLLRLLE |
Ga0137359_103675243 | 3300012923 | Vadose Zone Soil | MNIEIHDTALEARIQKQIQATGAASAEEALLRLLE |
Ga0137419_107301691 | 3300012925 | Vadose Zone Soil | MQIEIRDAALEARIRKQLQTSDTGSVEEVLSRLLEIQEEQDRW |
Ga0137410_100155008 | 3300012944 | Vadose Zone Soil | MTIKIRDASLEARIQKQLQATGSSSVEEVLLRLLETALSTVSS* |
Ga0137410_117932861 | 3300012944 | Vadose Zone Soil | MHEAPAMNIEIRDAALEARIKKQLRATGSTSVEEVLLR |
Ga0164306_100944402 | 3300012988 | Soil | MTIQIRDAALEARLKKQIEATGSGSVEELLQRLLESQE |
Ga0181531_105399891 | 3300014169 | Bog | MAIEIRDPSFEARIRKQLQATGSSSVEEVLLRLLEP* |
Ga0182018_100316703 | 3300014489 | Palsa | MTIEIRDASLEARTQKQLQTTGSSSVEEVLLRLLETNPE* |
Ga0182015_101968563 | 3300014495 | Palsa | MTIEIRDAFLDARIRKQLQATGSSSVEEVPLRLL* |
Ga0182015_101968564 | 3300014495 | Palsa | MTIEIRDASLEARIQEQLQATGSSSVEEVLLRLLEATCALSS* |
Ga0182019_103565281 | 3300014498 | Fen | MNIEIRDRALEARIQRQIQATGSGNVEEVLLRLLETQ |
Ga0182024_100124341 | 3300014501 | Permafrost | MNIEIRNAALEARLQKQLQATDFGSVEEALLRLPETQE* |
Ga0182024_100311645 | 3300014501 | Permafrost | MTIEIRDASLEARIRKQLQATGSGSVEEVLLRLLEVRAYSW* |
Ga0182024_102326193 | 3300014501 | Permafrost | MTIEIRDASLVARIRKQLQATGSGSVEEVLLRPLEIQPE* |
Ga0182024_106760141 | 3300014501 | Permafrost | MTIEIRDASLEARIRRQLQATGSSSVEEVLLRLLATTSALSS* |
Ga0181525_100400151 | 3300014654 | Bog | MAIEIRDPSFEARIRKQLQATGSSSVEEVLLRLLDT |
Ga0182027_108721592 | 3300014839 | Fen | MNIEIRDRALEARIQRQIQATGSASIEEVLLRLLET |
Ga0137411_10928311 | 3300015052 | Vadose Zone Soil | MTIEIRDASLEARLQKQLQATGSSSVEEVLLRLLVDTQEEQDRWLL |
Ga0187801_101094111 | 3300017933 | Freshwater Sediment | VNIEIRDAALEARIRKQLQATGSATVEEVLLRLLETQEE |
Ga0187879_100066159 | 3300017946 | Peatland | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRLLEATLGSVS |
Ga0187847_100144017 | 3300017948 | Peatland | MPIEIRNASLEARIRKQLQATGSSSVEEVLLLLFEPAPSVLSS |
Ga0187867_108066311 | 3300018033 | Peatland | MNIEIRDTALEARIQKQIQATGAARVQEALLRLLGTQEEQDRW |
Ga0187855_105535891 | 3300018038 | Peatland | PTMTIEIRDPSLEARIRKQLQATGSSSVEEVLLLLFEPAPSVLSS |
Ga0187851_108511311 | 3300018046 | Peatland | HIEIRDTPLEARIQKQIHATGAASAEEALLRLLETQEEQDR |
Ga0187765_113502242 | 3300018060 | Tropical Peatland | MNIEIRDADLEARIQKQLQTTGSGSLEEVLLRLLET |
Ga0187784_115091232 | 3300018062 | Tropical Peatland | MNIEIHDPALEARIRKQIQATGAASAEEALLRLLET |
Ga0184639_105264181 | 3300018082 | Groundwater Sediment | MKIEIHDTALEARIQRQIQATGSGSVEEALIRLLETQEE |
Ga0066662_119455632 | 3300018468 | Grasslands Soil | MMNIEIRDAALQARIQKQLQSTGSGSVEEMLRRLL |
Ga0182025_13566692 | 3300019786 | Permafrost | MTIEIRDASLEARIRKQLQATGSGSVEEVLLRLLEVRAYSW |
Ga0193724_10111341 | 3300020062 | Soil | LNIEIHDAALEARIQKQLQATGSASVEEVLLRLLETQEEQD |
Ga0210407_103276232 | 3300020579 | Soil | MTIEIRDASLGARIRKQLQATGSSSVEEVPLRLLDTQEEQDR |
Ga0210403_104207422 | 3300020580 | Soil | MNIEIHDAVLEARIQKLLQVTGSSSIEEVLLRLVETQEEQDRWLFGKPNCG |
Ga0210401_100842811 | 3300020583 | Soil | DASLGARIRKQLHTGSSSVEEVLFRLLKTPSALSS |
Ga0210401_100842816 | 3300020583 | Soil | MTVEIRDASLEARIRRQLQATGSSSVGEELLRLLEAALALSS |
Ga0210401_105951133 | 3300020583 | Soil | MNIEIHDAALEARVQEPHRASGSSSVEEVLLRLVQTQEERDRRLLE |
Ga0210406_110889082 | 3300021168 | Soil | VNIEIHDAALEARIQKQLQATGSASVEEVLLRLLETQEE |
Ga0210396_105450172 | 3300021180 | Soil | MTIEIRDASLVARIQKQLQATGSSSVEELLLRLLDTQE |
Ga0210388_1000367011 | 3300021181 | Soil | MNIEIHDAALEARIQKLLQVTGSSSIEEVLLRLVETQEEQDRWLFGKPNCG |
Ga0210397_112984611 | 3300021403 | Soil | MTIEIRDASLGARIRKQLHTGSSSVEEVLFRLLKTPSALSS |
Ga0210383_103180811 | 3300021407 | Soil | VNIEIRDATLEARLRKQLQATGSGSVEEVLLRLLETQEEQD |
Ga0210383_104923821 | 3300021407 | Soil | VNIEIHDAALEARIQKQLQATGSASVEEVLLRLLETQE |
Ga0210391_106486001 | 3300021433 | Soil | MNIEINDRALEARIQKQIQATGAASAEEALLRLLETQEEQD |
Ga0224541_10032323 | 3300022521 | Soil | MTIEIRDASLEVRIRKQLQSTGSSSVEEALLRLLATTSVLSS |
Ga0224541_10184853 | 3300022521 | Soil | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRMLET |
Ga0212123_100000021047 | 3300022557 | Iron-Sulfur Acid Spring | MTTEIRDASLVARIRKQLQATGSSSVKEVLLRLLETTE |
Ga0242671_11326831 | 3300022714 | Soil | NIEIHDAVLEARIQKLLQVTGSSSIEEVLLRLVETQEEQDRWLFGKPNCG |
Ga0224572_10553502 | 3300024225 | Rhizosphere | MTIEIRDASLEARIRKQLQATGSSSVEEALLRLLEIATLLSS |
Ga0224572_11132931 | 3300024225 | Rhizosphere | MTIEIRDPSLEARIQKQLQATGSRNVEEVLLRLLDTQEEQ |
Ga0228598_10009832 | 3300024227 | Rhizosphere | MTIEIRDASLEARIQKQLQATGSSSVEEVLLRPLETQV |
Ga0137417_10522891 | 3300024330 | Vadose Zone Soil | MNIEIHDAALEARIKKQLQATGSASVEEVLVRLLETQEEQDRGTGPL |
Ga0207929_10400442 | 3300025505 | Arctic Peat Soil | MGFAGQRCAALEARIQKQMQATGSRNVEEVLLRLLETQEEQDR |
Ga0207692_100083512 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIKIRDASLEARIQKPLQATGSSSVEEMLFRLLETTSALSS |
Ga0207646_105514691 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIEIHDAALAARIQKLLQATGSSSVEEVLLRLVETQEEQDRW |
Ga0207700_108482172 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIEIRDRALEARIQRQIKATGSGSVEEVLLRLLETQEEQ |
Ga0207702_120789151 | 3300026078 | Corn Rhizosphere | LTIQIRNAALEARLKKQIEATGSDSLEELLLHLLES |
Ga0209131_10929701 | 3300026320 | Grasslands Soil | MTIEIRDASLEARIQKQLQATGSSSVEEVLLRVLEP |
Ga0209131_10929704 | 3300026320 | Grasslands Soil | MTIEIRDASLEARIKKQLQATGSSSVEEVLLRLHETALSAVSS |
Ga0209470_12510991 | 3300026324 | Soil | VNIEIHDAALEARIQKQIQATGSSSVEEVLLRLLETQEE |
Ga0257157_11026431 | 3300026496 | Soil | VNIEIHDAALEARIQKQLQATGSASVEEVLLRLLETQEEQD |
Ga0179593_11383772 | 3300026555 | Vadose Zone Soil | MTIEIRDASLEARIRKQLQATGSSSAEEVLLRLLGTQEEQDR |
Ga0179593_11629451 | 3300026555 | Vadose Zone Soil | MNIEIRDAALEARIKKQLQATGSASVEEVLLRLLET |
Ga0209422_10628373 | 3300027629 | Forest Soil | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRLFSPILDMLST |
Ga0209420_11103491 | 3300027648 | Forest Soil | MTIEIRDASSEARIRKQLQATGSSSVEEVPLRLLEATSALSS |
Ga0209736_10175135 | 3300027660 | Forest Soil | MTVEIRDASLEARIQTQLQATGSSSVEEVLLFSLETPSLLSS |
Ga0209009_10626111 | 3300027667 | Forest Soil | MNIEIRDSTLKARIQKQLEATGTGSVEELLAHLLETQEE |
Ga0209530_11830182 | 3300027692 | Forest Soil | MTPLNIEINDRALEARIQKQIQATGAASAEEALLRLLETQE |
Ga0209655_101705013 | 3300027767 | Bog Forest Soil | KEPTTTIEIRDASLAARIQKQLQATGSSSVEEVLLRLRETNPE |
Ga0209772_100035064 | 3300027768 | Bog Forest Soil | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRLRETNPE |
Ga0209773_100063135 | 3300027829 | Bog Forest Soil | MTIEIRDASLEARIRKQLQATGSSSVEKVLLRLLEVTSDLSS |
Ga0209180_101218264 | 3300027846 | Vadose Zone Soil | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRLLETAPSAVSS |
Ga0209167_106675441 | 3300027867 | Surface Soil | MTIEIRDASLEARIRKQLQATGSSSVEEVLLRLLDTQE |
Ga0209380_101091442 | 3300027889 | Soil | VNIEIRDPELEARLRKQLEATGSGSVEEVLQRLLETKEE |
Ga0209488_102340462 | 3300027903 | Vadose Zone Soil | MGIEIRDASLEARIKKQLQATDSSSVEEVLLRLLGTQPE |
Ga0209006_10000002261 | 3300027908 | Forest Soil | MTIEIRDASLEARIQKQLQATGSSSVEEVLLRLLAT |
Ga0302301_10001241 | 3300028731 | Palsa | MTIEIRDASLQARIRRQLQATGFSSVEEVLLRLLAATPALSS |
Ga0302301_100043715 | 3300028731 | Palsa | MTITIRNASLEARLRKRLEATGSSSVEEVLLRRLETVTPLSS |
Ga0302219_100059815 | 3300028747 | Palsa | MTIEIRDASSEARIRKQLQATGSASVEEVLLRLLQP |
Ga0302156_101151944 | 3300028748 | Bog | KKPIMTIEIRDASLEARIRKQLQATGSSSVEEVLPRLLETNPE |
Ga0302224_100168317 | 3300028759 | Palsa | TIEIRDASLEARIRKQLQATGSSSVEEVPLRLLEVTSTLSS |
Ga0302224_103477672 | 3300028759 | Palsa | MTIEIRDASLEARIQKQLKATGSRSVEEVLLRLLEP |
Ga0302223_102753073 | 3300028781 | Palsa | TMTPEIRDASLEARIRKQLQATGSSSVEEVLLRLL |
Ga0302232_105536592 | 3300028789 | Palsa | MTIEIRDASLEATIRKQLQATGSASVEEVLLRLLQT |
Ga0302222_100037503 | 3300028798 | Palsa | MTIEIRDASLEARIRKQLQATGSSSVEEVPLRLLEVTSTLSS |
Ga0302278_101113742 | 3300028866 | Bog | MTIEIRDASLEARIRKQLQATGSSSVEEVLPRLLETNPE |
Ga0308309_111863102 | 3300028906 | Soil | MNIEIRDAALEARIQRQLQATGSRSVEEVLLRLLETQE |
Ga0222749_106247082 | 3300029636 | Soil | MTIEIRDASLEARLQKQLQATGSGSVEEVLLRLLEP |
Ga0311368_100499903 | 3300029882 | Palsa | MTIEIRDASLEARIQEQLQATGSSSVEEVLLRLLEATCALSS |
Ga0311368_104392481 | 3300029882 | Palsa | MTIEIRDASLEARIRKQLQATGSSSVEEVPLRLLEVTSTLS |
Ga0311352_102359713 | 3300029944 | Palsa | MTIEIRDASLEARIQEQLQATGSSSVEEVLLRLLEA |
Ga0302274_103911481 | 3300030041 | Bog | MNIEIRDAAIEARLQKQLQASGSDSVEEVLVRLLETQEEQ |
Ga0302182_1000108218 | 3300030054 | Palsa | MTIEIRDASLEARIRKQLQATGSSSVEEVPLRLLEVTST |
Ga0311354_109940311 | 3300030618 | Palsa | MTIEIRDASLEARIQKQLQATGSSSVEEVLLRLLDTKEEQDRW |
Ga0302316_103911931 | 3300030646 | Palsa | NASLEARLRKRLEATGSSSVEEVLLRRLETVTPLSS |
Ga0170834_1118276751 | 3300031057 | Forest Soil | MAIEIRDAALEARLQKHLEASGSNTVEELLLRLLDSQEEQERW |
Ga0302325_104402652 | 3300031234 | Palsa | MTIEIRDASLEARIRKQLQATGSSSVEEVPLRLLDTQEEQDL |
Ga0302325_109267071 | 3300031234 | Palsa | MNIEIHDMALEARIRKQIQATGSSSAEEASLRLLDT |
Ga0302325_119800662 | 3300031234 | Palsa | MSIEIEDGASEARIQKQRQAIGATTAEEALLRLLNTEEEGDRQRS |
Ga0265325_100995761 | 3300031241 | Rhizosphere | MNIEIRDETLAARINRQLQLTGSENVEEVLLHLLDTQEQQ |
Ga0310686_1114801022 | 3300031708 | Soil | MTIEIRDASLEARIQKQLQATGSSSVDEVLLRLLDIASALSS |
Ga0310686_1159083792 | 3300031708 | Soil | MTLEIRDASLEARIRKQLQATGSSSVEEVLLRLLESTSTLSS |
Ga0307476_100833793 | 3300031715 | Hardwood Forest Soil | MTIEIRDASLEARIRKQLQATGSSSVEEVLLCLLES |
Ga0307476_101185833 | 3300031715 | Hardwood Forest Soil | MTIEIRDASLEARIRKQLQATGSSSLGEVLLCLLES |
Ga0307476_101656921 | 3300031715 | Hardwood Forest Soil | MTIEIRDASLEARIRKQLQATGSSSLEEVPLRLLDTQEEHDR |
Ga0307478_105397852 | 3300031823 | Hardwood Forest Soil | MTIEIRDANLEARIKKQLQATGSSTIEEVLLRLLETQEEQQARFVL |
Ga0311301_117626601 | 3300032160 | Peatlands Soil | MTIEIRDASLEARIQKQLQATGSSSVEEVLLRLLEIAIPLSS |
Ga0307471_1036688581 | 3300032180 | Hardwood Forest Soil | MTIEIRDAALEARLQKQLKSTGSRSVEELLLHLLKT |
Ga0348332_107771821 | 3300032515 | Plant Litter | MTIEIRDASLEARIRKQLQATGSSSVEEALLRLLEIAT |
Ga0348332_145165302 | 3300032515 | Plant Litter | MTIEIRDASLEARIRKQLQATGSSSVEELLLRLLETTSVLSS |
Ga0335072_101305752 | 3300032898 | Soil | LKIEIRDAALEARIHKQLRATGSASVEEVLIRLLETQEEQDR |
Ga0334854_016776_499_627 | 3300033829 | Soil | MTIEIRDASSEARIRKQLQATGSSSVEEVLLRLLETTTLLSS |
Ga0334854_076634_2_109 | 3300033829 | Soil | MTIEIRDASLEVRIRKQLQSTGSSSVEEALLRLLAT |
Ga0370483_0013156_472_585 | 3300034124 | Untreated Peat Soil | MTIEIRDAPLEARIRKQLQATGSSSVEEVLLRLIEAD |
Ga0370515_0036710_1279_1389 | 3300034163 | Untreated Peat Soil | MTIEIRDASSEARIRKQLQATGSASVEEVLLRLLQT |
Ga0370515_0072124_413_541 | 3300034163 | Untreated Peat Soil | MTIEIRDASLAARIRKQLQATGSSSVEEVLLRLLAATPVLSS |
Ga0370515_0182360_662_775 | 3300034163 | Untreated Peat Soil | MTIEIRDASLEARIQKQLQATGSSSVEEVPLRLLETA |
Ga0370515_0413146_363_473 | 3300034163 | Untreated Peat Soil | MTIEIRDASLEARIRKQLQAAGSSSVEEVPLRLLEP |
⦗Top⦘ |