NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F032930

Metagenome Family F032930

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032930
Family Type Metagenome
Number of Sequences 178
Average Sequence Length 42 residues
Representative Sequence TPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE
Number of Associated Samples 19
Number of Associated Scaffolds 178

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.75 %
% of genes from short scaffolds (< 2000 bps) 40.45 %
Associated GOLD sequencing projects 13
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.461 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater
(52.809 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(52.809 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 2.56%    Coil/Unstructured: 97.44%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 178 Family Scaffolds
PF00528BPD_transp_1 2.81
PF02518HATPase_c 2.25
PF12894ANAPC4_WD40 2.25
PF00440TetR_N 2.25
PF08448PAS_4 2.25
PF11721Malectin 1.69
PF14338Mrr_N 1.69
PF00005ABC_tran 1.69
PF04940BLUF 1.69
PF01497Peripla_BP_2 1.69
PF05685Uma2 1.69
PF01694Rhomboid 1.69
PF08592Anthrone_oxy 1.12
PF01022HTH_5 1.12
PF00753Lactamase_B 1.12
PF12911OppC_N 1.12
PF02874ATP-synt_ab_N 1.12
PF03773ArsP_1 1.12
PF00248Aldo_ket_red 1.12
PF14748P5CR_dimer 1.12
PF00069Pkinase 1.12
PF13434Lys_Orn_oxgnase 1.12
PF11832DUF3352 1.12
PF08447PAS_3 1.12
PF13646HEAT_2 1.12
PF09992NAGPA 1.12
PF02545Maf 1.12
PF01850PIN 1.12
PF01202SKI 1.12
PF02464CinA 1.12
PF01844HNH 1.12
PF00696AA_kinase 1.12
PF01477PLAT 1.12
PF01799Fer2_2 1.12
PF02861Clp_N 1.12
PF00072Response_reg 1.12
PF00111Fer2 1.12
PF10431ClpB_D2-small 0.56
PF07690MFS_1 0.56
PF08240ADH_N 0.56
PF11716MDMPI_N 0.56
PF01547SBP_bac_1 0.56
PF03631Virul_fac_BrkB 0.56
PF01381HTH_3 0.56
PF13614AAA_31 0.56
PF00355Rieske 0.56
PF02527GidB 0.56
PF132794HBT_2 0.56
PF00583Acetyltransf_1 0.56
PF08239SH3_3 0.56
PF13185GAF_2 0.56
PF00106adh_short 0.56
PF13091PLDc_2 0.56
PF05729NACHT 0.56
PF00892EamA 0.56
PF08379Bact_transglu_N 0.56
PF04226Transgly_assoc 0.56
PF08818DUF1801 0.56
PF13478XdhC_C 0.56
PF00664ABC_membrane 0.56
PF07676PD40 0.56
PF00016RuBisCO_large 0.56
PF07885Ion_trans_2 0.56
PF01370Epimerase 0.56
PF14520HHH_5 0.56
PF14360PAP2_C 0.56
PF13602ADH_zinc_N_2 0.56
PF00578AhpC-TSA 0.56
PF01135PCMT 0.56
PF04448DUF551 0.56
PF13274DUF4065 0.56
PF13884Peptidase_S74 0.56
PF01053Cys_Met_Meta_PP 0.56
PF01872RibD_C 0.56
PF08241Methyltransf_11 0.56
PF07683CobW_C 0.56
PF13378MR_MLE_C 0.56
PF01177Asp_Glu_race 0.56
PF03450CO_deh_flav_C 0.56
PF13244MbhD 0.56
PF13443HTH_26 0.56
PF01121CoaE 0.56
PF00400WD40 0.56
PF13493DUF4118 0.56
PF02397Bac_transf 0.56
PF00027cNMP_binding 0.56
PF10258PHAX_RNA-bd 0.56
PF13855LRR_8 0.56
PF04994TfoX_C 0.56
PF01841Transglut_core 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 178 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 4.49
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 1.69
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 1.69
COG4607ABC-type enterochelin transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.69
COG4594ABC-type Fe3+-citrate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.69
COG0614ABC-type Fe3+-hydroxamate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.69
COG4592ABC-type Fe2+-enterobactin transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.69
COG4558ABC-type hemin transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.69
COG1546Nicotinamide mononucleotide (NMN) deamidase PncCCoenzyme transport and metabolism [H] 1.12
COG0701Uncharacterized membrane protein YraQ, UPF0718 familyFunction unknown [S] 1.12
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 1.12
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 1.12
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.56
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.56
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.56
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.56
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.56
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 0.56
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.56
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.56
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.56
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.56
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.56
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.56
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.56
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.56
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.56
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.56
COG1850Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like proteinCarbohydrate transport and metabolism [G] 0.56
COG1305Transglutaminase-like enzyme, putative cysteine proteasePosttranslational modification, protein turnover, chaperones [O] 0.56
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.56
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.56
COG0523Zinc metallochaperone YeiR/ZagA and related GTPases, G3E familyGeneral function prediction only [R] 0.56
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.56
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.56
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.56
COG035716S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B)Translation, ribosomal structure and biogenesis [J] 0.56
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.56
COG0237Dephospho-CoA kinaseCoenzyme transport and metabolism [H] 0.56
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.46 %
UnclassifiedrootN/A18.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300007521|Ga0105044_10000641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi43864Open in IMG/M
3300007521|Ga0105044_10017262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae9713Open in IMG/M
3300007521|Ga0105044_10045595All Organisms → cellular organisms → Bacteria5443Open in IMG/M
3300007521|Ga0105044_10054088All Organisms → cellular organisms → Bacteria4885Open in IMG/M
3300007521|Ga0105044_10066694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4268Open in IMG/M
3300007521|Ga0105044_10121712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium2848Open in IMG/M
3300007521|Ga0105044_10132942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2682Open in IMG/M
3300007521|Ga0105044_10143100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2551Open in IMG/M
3300007521|Ga0105044_10144730All Organisms → cellular organisms → Bacteria2531Open in IMG/M
3300007521|Ga0105044_10232034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1824Open in IMG/M
3300007521|Ga0105044_10245402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1753Open in IMG/M
3300007521|Ga0105044_10366749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1317Open in IMG/M
3300007521|Ga0105044_10577660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium948Open in IMG/M
3300007521|Ga0105044_11266028Not Available543Open in IMG/M
3300007521|Ga0105044_11383927Not Available511Open in IMG/M
3300007799|Ga0105049_10003367All Organisms → cellular organisms → Bacteria18887Open in IMG/M
3300007799|Ga0105049_10014163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae9030Open in IMG/M
3300007799|Ga0105049_10014457All Organisms → cellular organisms → Bacteria8923Open in IMG/M
3300007799|Ga0105049_10060212All Organisms → cellular organisms → Bacteria3823Open in IMG/M
3300007799|Ga0105049_10239785Not Available1516Open in IMG/M
3300007799|Ga0105049_10256256All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300007799|Ga0105049_10353715Not Available1157Open in IMG/M
3300007799|Ga0105049_10499445Not Available908Open in IMG/M
3300007799|Ga0105049_10583174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium813Open in IMG/M
3300009032|Ga0105048_10009560All Organisms → cellular organisms → Bacteria15397Open in IMG/M
3300009032|Ga0105048_10021097All Organisms → cellular organisms → Bacteria9926Open in IMG/M
3300009032|Ga0105048_10024914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae9021Open in IMG/M
3300009032|Ga0105048_10053079All Organisms → cellular organisms → Bacteria5752Open in IMG/M
3300009032|Ga0105048_10053102All Organisms → cellular organisms → Bacteria5751Open in IMG/M
3300009032|Ga0105048_10103528All Organisms → cellular organisms → Bacteria3752Open in IMG/M
3300009032|Ga0105048_10157260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2835Open in IMG/M
3300009032|Ga0105048_10197626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2415Open in IMG/M
3300009032|Ga0105048_10210722All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Fulvivirgaceae → Fulvivirga → Fulvivirga lutimaris2308Open in IMG/M
3300009032|Ga0105048_10215417All Organisms → cellular organisms → Bacteria → Proteobacteria2273Open in IMG/M
3300009032|Ga0105048_10518039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1191Open in IMG/M
3300009032|Ga0105048_10758680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium885Open in IMG/M
3300009032|Ga0105048_10767042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium878Open in IMG/M
3300009032|Ga0105048_11003895Not Available712Open in IMG/M
3300009032|Ga0105048_11123977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium652Open in IMG/M
3300009032|Ga0105048_11143987Not Available644Open in IMG/M
3300009083|Ga0105047_10000334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi76452Open in IMG/M
3300009083|Ga0105047_10009867All Organisms → cellular organisms → Bacteria15667Open in IMG/M
3300009083|Ga0105047_10019951All Organisms → cellular organisms → Bacteria → Proteobacteria10320Open in IMG/M
3300009083|Ga0105047_10037927All Organisms → cellular organisms → Bacteria6935Open in IMG/M
3300009083|Ga0105047_10098542All Organisms → cellular organisms → Bacteria3700Open in IMG/M
3300009083|Ga0105047_10131679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3035Open in IMG/M
3300009083|Ga0105047_10236283All Organisms → cellular organisms → Bacteria2003Open in IMG/M
3300009083|Ga0105047_11421270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium524Open in IMG/M
3300009084|Ga0105046_10023884All Organisms → cellular organisms → Bacteria9171Open in IMG/M
3300009084|Ga0105046_10066120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium4867Open in IMG/M
3300009084|Ga0105046_10931050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium723Open in IMG/M
3300009084|Ga0105046_11029662Not Available670Open in IMG/M
3300015360|Ga0163144_10054652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium7017Open in IMG/M
3300015360|Ga0163144_10082065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium5294Open in IMG/M
3300015360|Ga0163144_10186597All Organisms → cellular organisms → Bacteria2930Open in IMG/M
3300015360|Ga0163144_10201879All Organisms → cellular organisms → Bacteria2763Open in IMG/M
3300015360|Ga0163144_11113289Not Available738Open in IMG/M
3300015360|Ga0163144_11852789Not Available506Open in IMG/M
3300020180|Ga0163155_10013487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6929Open in IMG/M
3300020180|Ga0163155_10018393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi5629Open in IMG/M
3300020180|Ga0163155_10026073All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans4435Open in IMG/M
3300020180|Ga0163155_10026567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4379Open in IMG/M
3300020180|Ga0163155_10087251All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300020180|Ga0163155_10153732All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300020180|Ga0163155_10166064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1168Open in IMG/M
3300020180|Ga0163155_10218929Not Available952Open in IMG/M
3300020180|Ga0163155_10257929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium842Open in IMG/M
3300020180|Ga0163155_10380016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi630Open in IMG/M
3300020192|Ga0163147_10005798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi14816Open in IMG/M
3300020192|Ga0163147_10011872All Organisms → cellular organisms → Bacteria8979Open in IMG/M
3300020192|Ga0163147_10015630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus7377Open in IMG/M
3300020192|Ga0163147_10018528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus6517Open in IMG/M
3300020192|Ga0163147_10030505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium SM23_844559Open in IMG/M
3300020192|Ga0163147_10032953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4307Open in IMG/M
3300020192|Ga0163147_10042087All Organisms → cellular organisms → Bacteria3614Open in IMG/M
3300020192|Ga0163147_10047537All Organisms → cellular organisms → Bacteria3302Open in IMG/M
3300020192|Ga0163147_10050280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3169Open in IMG/M
3300020192|Ga0163147_10071479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2461Open in IMG/M
3300020192|Ga0163147_10308584Not Available837Open in IMG/M
3300020192|Ga0163147_10331652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium792Open in IMG/M
3300020192|Ga0163147_10375032Not Available720Open in IMG/M
3300020192|Ga0163147_10395976Not Available690Open in IMG/M
3300020201|Ga0163154_10000184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi94159Open in IMG/M
3300020201|Ga0163154_10003955All Organisms → cellular organisms → Bacteria19961Open in IMG/M
3300020201|Ga0163154_10004563All Organisms → cellular organisms → Bacteria18085Open in IMG/M
3300020201|Ga0163154_10008390All Organisms → cellular organisms → Bacteria12073Open in IMG/M
3300020201|Ga0163154_10008424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi12026Open in IMG/M
3300020201|Ga0163154_10010270All Organisms → cellular organisms → Bacteria10459Open in IMG/M
3300020201|Ga0163154_10039520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3758Open in IMG/M
3300020201|Ga0163154_10223947Not Available964Open in IMG/M
3300020201|Ga0163154_10226626Not Available955Open in IMG/M
3300020203|Ga0163148_10020440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi5287Open in IMG/M
3300020203|Ga0163148_10037009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium3634Open in IMG/M
3300020203|Ga0163148_10041673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3359Open in IMG/M
3300020203|Ga0163148_10044118All Organisms → cellular organisms → Bacteria3241Open in IMG/M
3300020203|Ga0163148_10048003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3066Open in IMG/M
3300020203|Ga0163148_10059615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2654Open in IMG/M
3300020203|Ga0163148_10060794Not Available2618Open in IMG/M
3300020203|Ga0163148_10114329Not Available1690Open in IMG/M
3300020203|Ga0163148_10126170All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300020203|Ga0163148_10136858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1483Open in IMG/M
3300020203|Ga0163148_10153796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1362Open in IMG/M
3300020203|Ga0163148_10198617Not Available1127Open in IMG/M
3300020203|Ga0163148_10236667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium989Open in IMG/M
3300020203|Ga0163148_10359016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Phototrophicales → unclassified Phototrophicales → Phototrophicales bacterium721Open in IMG/M
3300020203|Ga0163148_10409278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi652Open in IMG/M
3300020213|Ga0163152_10266543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium882Open in IMG/M
3300020219|Ga0163146_10083417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2277Open in IMG/M
3300020219|Ga0163146_10196615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1275Open in IMG/M
3300020219|Ga0163146_10328212Not Available880Open in IMG/M
3300020219|Ga0163146_10362183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium817Open in IMG/M
3300020219|Ga0163146_10374930All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300020596|Ga0163149_10007878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi10646Open in IMG/M
3300020596|Ga0163149_10022494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi5413Open in IMG/M
3300020596|Ga0163149_10027268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium4784Open in IMG/M
3300020596|Ga0163149_10028002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Chloroflexaceae → Chloroflexus4703Open in IMG/M
3300020596|Ga0163149_10051036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3190Open in IMG/M
3300020596|Ga0163149_10074981All Organisms → cellular organisms → Bacteria2478Open in IMG/M
3300020596|Ga0163149_10106270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1958Open in IMG/M
3300020596|Ga0163149_10251677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1049Open in IMG/M
3300020596|Ga0163149_10280212Not Available966Open in IMG/M
3300020596|Ga0163149_10390966All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300020596|Ga0163149_10511762Not Available594Open in IMG/M
3300020596|Ga0163149_10512677Not Available593Open in IMG/M
3300022222|Ga0226658_10014974All Organisms → cellular organisms → Bacteria3709Open in IMG/M
3300022222|Ga0226658_10030669All Organisms → cellular organisms → Bacteria → Proteobacteria2541Open in IMG/M
3300022222|Ga0226658_10031938All Organisms → cellular organisms → Bacteria2489Open in IMG/M
3300022222|Ga0226658_10038138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2266Open in IMG/M
3300022222|Ga0226658_10041434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2166Open in IMG/M
3300022222|Ga0226658_10057456All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300022222|Ga0226658_10069706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1636Open in IMG/M
3300022222|Ga0226658_10082593Not Available1491Open in IMG/M
3300022222|Ga0226658_10266025Not Available775Open in IMG/M
3300022222|Ga0226658_10426345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium593Open in IMG/M
3300027823|Ga0209490_10001491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi22566Open in IMG/M
3300027823|Ga0209490_10014545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus6706Open in IMG/M
3300027823|Ga0209490_10024378All Organisms → cellular organisms → Bacteria5002Open in IMG/M
3300027823|Ga0209490_10041960All Organisms → cellular organisms → Bacteria3630Open in IMG/M
3300027823|Ga0209490_10078880Not Available2461Open in IMG/M
3300027823|Ga0209490_10083338All Organisms → cellular organisms → Bacteria → Proteobacteria2376Open in IMG/M
3300027823|Ga0209490_10192940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1357Open in IMG/M
3300027823|Ga0209490_10194094Not Available1352Open in IMG/M
3300027823|Ga0209490_10512116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Phototrophicales → unclassified Phototrophicales → Phototrophicales bacterium656Open in IMG/M
3300027823|Ga0209490_10512387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium656Open in IMG/M
3300027823|Ga0209490_10526552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi642Open in IMG/M
3300027850|Ga0209591_10019791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus6926Open in IMG/M
3300027850|Ga0209591_10057623All Organisms → cellular organisms → Bacteria3642Open in IMG/M
3300027850|Ga0209591_10322253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1125Open in IMG/M
3300027850|Ga0209591_10350644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1055Open in IMG/M
3300027850|Ga0209591_10655584Not Available642Open in IMG/M
3300027878|Ga0209181_10005770All Organisms → cellular organisms → Bacteria17697Open in IMG/M
3300027878|Ga0209181_10019087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi8150Open in IMG/M
3300027878|Ga0209181_10024372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus6971Open in IMG/M
3300027878|Ga0209181_10030400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6055Open in IMG/M
3300027878|Ga0209181_10034650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi5573Open in IMG/M
3300027878|Ga0209181_10035027All Organisms → cellular organisms → Bacteria5536Open in IMG/M
3300027878|Ga0209181_10037482All Organisms → cellular organisms → Bacteria5294Open in IMG/M
3300027878|Ga0209181_10083074All Organisms → cellular organisms → Bacteria3193Open in IMG/M
3300027878|Ga0209181_10083559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3182Open in IMG/M
3300027878|Ga0209181_10128329All Organisms → cellular organisms → Bacteria → Proteobacteria2411Open in IMG/M
3300027878|Ga0209181_10129403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2398Open in IMG/M
3300027878|Ga0209181_10186060All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300032420|Ga0335397_10028723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus6401Open in IMG/M
3300032420|Ga0335397_10031317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6088Open in IMG/M
3300032420|Ga0335397_10043724All Organisms → cellular organisms → Bacteria → Proteobacteria4982Open in IMG/M
3300032420|Ga0335397_10071173All Organisms → cellular organisms → Bacteria3703Open in IMG/M
3300032420|Ga0335397_10089242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae3219Open in IMG/M
3300032420|Ga0335397_10127653All Organisms → cellular organisms → Bacteria2561Open in IMG/M
3300032420|Ga0335397_10137301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2441Open in IMG/M
3300032420|Ga0335397_10188404All Organisms → cellular organisms → Bacteria1974Open in IMG/M
3300032420|Ga0335397_10247598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1636Open in IMG/M
3300032420|Ga0335397_10271178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1534Open in IMG/M
3300032420|Ga0335397_10932039Not Available591Open in IMG/M
3300032456|Ga0335394_10927748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi601Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater52.81%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat47.19%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300007799Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06EnvironmentalOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009083Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)EnvironmentalOpen in IMG/M
3300009084Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly)EnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300020180Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1EnvironmentalOpen in IMG/M
3300020192Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1EnvironmentalOpen in IMG/M
3300020201Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1EnvironmentalOpen in IMG/M
3300020203Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2EnvironmentalOpen in IMG/M
3300020213Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2EnvironmentalOpen in IMG/M
3300020219Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1EnvironmentalOpen in IMG/M
3300020596Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1EnvironmentalOpen in IMG/M
3300022222Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2)EnvironmentalOpen in IMG/M
3300027823Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes)EnvironmentalOpen in IMG/M
3300027850Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027878Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes)EnvironmentalOpen in IMG/M
3300032420Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)EnvironmentalOpen in IMG/M
3300032456Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0105044_1000064113300007521FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE*
Ga0105044_1001726213300007521FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPAMKKLLLNSGMP*
Ga0105044_1004559573300007521FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPVE*
Ga0105044_1005408813300007521FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEKLSI*
Ga0105044_1006669413300007521FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE*
Ga0105044_1012171213300007521FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPGYV*
Ga0105044_1013294233300007521FreshwaterTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPESVTMKAL*
Ga0105044_1014310013300007521FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEIIEC*
Ga0105044_1014473013300007521FreshwaterAFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPDKES*
Ga0105044_1023203413300007521FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA*
Ga0105044_1024540213300007521FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAMNT*
Ga0105044_1036674913300007521FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPAI*
Ga0105044_1057766023300007521FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDF*
Ga0105044_1126602813300007521FreshwaterAFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPEM*
Ga0105044_1138392713300007521FreshwaterTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI*
Ga0105049_1000336713300007799FreshwaterAFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEITSD*
Ga0105049_1001416313300007799FreshwaterAFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI*
Ga0105049_10014457133300007799FreshwaterTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR*
Ga0105049_1006021213300007799FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERRPGGEVSESPE*
Ga0105049_1023978533300007799FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPETLFSRLVPFP*
Ga0105049_1025625643300007799FreshwaterTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE*
Ga0105049_1035371513300007799FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPELN*
Ga0105049_1049944513300007799FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFTKIRLLFI*
Ga0105049_1058317413300007799FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVYL*
Ga0105048_1000434113300009032FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVK*
Ga0105048_1000956013300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGLGGEVSESPEI*
Ga0105048_1002109713300009032FreshwaterPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED*
Ga0105048_1002491413300009032FreshwaterPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI*
Ga0105048_1005307913300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESLGLNKV*
Ga0105048_1005310213300009032FreshwaterNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDYNP*
Ga0105048_1010352813300009032FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPEMNT*
Ga0105048_1015726013300009032FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVRNKK*
Ga0105048_1019762613300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD*
Ga0105048_1021072233300009032FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI*
Ga0105048_1021541713300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPVIIAAN*
Ga0105048_1051803923300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDF*
Ga0105048_1075868013300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPGYVIRKTQ*
Ga0105048_1076704213300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM*
Ga0105048_1100389513300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI*
Ga0105048_1112397713300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPESIALC*
Ga0105048_1114398713300009032FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGG*
Ga0105047_1000033413300009083FreshwaterFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI*
Ga0105047_1000986713300009083FreshwaterMIENLDIYRTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGE
Ga0105047_1001995113300009083FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPGYV*
Ga0105047_1003792713300009083FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQYLEREPGGEVSESPVFKIMRIPP*
Ga0105047_1009854273300009083FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPDYNP*
Ga0105047_1013167953300009083FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDIE*
Ga0105047_1023628313300009083FreshwaterAFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPEFVSSPRLGGSKIE*
Ga0105047_1142127013300009083FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM*
Ga0105046_1002388413300009084FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPAKKKED*
Ga0105046_1006612013300009084FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPK*
Ga0105046_1093105033300009084FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVINILD*
Ga0105046_1102966213300009084FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVVVLR*
Ga0163144_1005465263300015360Freshwater Microbial MatFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED*
Ga0163144_1008206513300015360Freshwater Microbial MatFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEITSD*
Ga0163144_1018659713300015360Freshwater Microbial MatFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPEKLSI*
Ga0163144_1020187913300015360Freshwater Microbial MatAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGKV*
Ga0163144_1111328933300015360Freshwater Microbial MatTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTMN*
Ga0163144_1185278913300015360Freshwater Microbial MatAFTPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT*
Ga0163155_1001348743300020180Freshwater Microbial MatPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPVINPFRGLQTL
Ga0163155_1001839313300020180Freshwater Microbial MatPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED
Ga0163155_1002607313300020180Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPK
Ga0163155_1002656753300020180Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE
Ga0163155_1008725113300020180Freshwater Microbial MatPIAWRGDFKMRFSPPLQYLERGSGGEVSESPEMNT
Ga0163155_1015373213300020180Freshwater Microbial MatLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD
Ga0163155_1016606413300020180Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDYNP
Ga0163155_1021892913300020180Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFTKIRLLFI
Ga0163155_1025792923300020180Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGYVIRKTQ
Ga0163155_1038001633300020180Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI
Ga0163147_1000579813300020192Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM
Ga0163147_10011872103300020192Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVNESPAII
Ga0163147_1001563013300020192Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEVI
Ga0163147_1001852893300020192Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA
Ga0163147_1003050553300020192Freshwater Microbial MatNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED
Ga0163147_1003295313300020192Freshwater Microbial MatPPLNPLPIAWRGDFKMRFSPPLQVLERRPGGEVSESPE
Ga0163147_1004208753300020192Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE
Ga0163147_1004753713300020192Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGIFKIN
Ga0163147_1005028013300020192Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI
Ga0163147_1007147933300020192Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERKPGGEVSESPDFSELYVVD
Ga0163147_1030858413300020192Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPELN
Ga0163147_1033165213300020192Freshwater Microbial MatPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPGYVIRKTQ
Ga0163147_1037503233300020192Freshwater Microbial MatPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTMN
Ga0163147_1039597613300020192Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQYLEREPGGEVSESPE
Ga0163154_10000184803300020201Freshwater Microbial MatHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE
Ga0163154_10003955193300020201Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPLLQYLEREPGGEVSESPEITSD
Ga0163154_1000456313300020201Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESSDVI
Ga0163154_1000839013300020201Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPALKT
Ga0163154_10008424123300020201Freshwater Microbial MatLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPEM
Ga0163154_1001027013300020201Freshwater Microbial MatAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGLGGEVSESPEI
Ga0163154_1003952043300020201Freshwater Microbial MatAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI
Ga0163154_1022394733300020201Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPIS
Ga0163154_1022662633300020201Freshwater Microbial MatAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPELN
Ga0163148_10020440103300020203Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM
Ga0163148_1003700943300020203Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGDEVSESPAMNT
Ga0163148_1004167353300020203Freshwater Microbial MatPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDIE
Ga0163148_1004411843300020203Freshwater Microbial MatFNPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI
Ga0163148_1004800313300020203Freshwater Microbial MatVEVIYYKYIFRTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQYLERVPGGEVSESPD
Ga0163148_1005961513300020203Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPELLSLL
Ga0163148_1006079413300020203Freshwater Microbial MatNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPE
Ga0163148_1011432933300020203Freshwater Microbial MatPLNPLPIAWRGDFKMRFSAPLQVLERGPGGEVSESPDLIEVT
Ga0163148_1012617013300020203Freshwater Microbial MatPIAWRGDFKMRFSPPLQVLEREPGGEVSESPEKLSI
Ga0163148_1013685833300020203Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED
Ga0163148_1015379633300020203Freshwater Microbial MatHAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPGYV
Ga0163148_1019861713300020203Freshwater Microbial MatPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFTKIRLLFI
Ga0163148_1023666713300020203Freshwater Microbial MatPLPIAWRGDFKMRFSPPLQVVERGPGGEVSESPTIK
Ga0163148_1027376913300020203Freshwater Microbial MatPLNPLPIAWRGDFKMRFSLPLQVLERGPGGEVSESPEYDKNCPLDKN
Ga0163148_1035901613300020203Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDPLEAHFDYRG
Ga0163148_1040927813300020203Freshwater Microbial MatNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPAI
Ga0163152_1026654323300020213Freshwater Microbial MatHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE
Ga0163146_1008341713300020219Freshwater Microbial MatPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEIIEC
Ga0163146_1019661513300020219Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDF
Ga0163146_1032821213300020219Freshwater Microbial MatFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPALNHID
Ga0163146_1036218313300020219Freshwater Microbial MatPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGYVIRKTQ
Ga0163146_1037493013300020219Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD
Ga0163149_1000787813300020596Freshwater Microbial MatPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFIT
Ga0163149_1002249413300020596Freshwater Microbial MatPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPELLSLL
Ga0163149_1002726813300020596Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPVINPFRGLQTL
Ga0163149_1002800213300020596Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPDYNP
Ga0163149_1005103653300020596Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQYLERVPGGEVSESPDIE
Ga0163149_1005243413300020596Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVYDRFSTVVL
Ga0163149_1007498113300020596Freshwater Microbial MatPLNPLPIAGRGDFKMRFSPPLQVLERGPGGEVSESPGIFKIN
Ga0163149_1010627013300020596Freshwater Microbial MatLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGVKSDK
Ga0163149_1025167713300020596Freshwater Microbial MatAHAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPKIIRLS
Ga0163149_1028021213300020596Freshwater Microbial MatIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFTKIRLLFI
Ga0163149_1039096623300020596Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGLGGEVSESPEI
Ga0163149_1051176213300020596Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEVI
Ga0163149_1051267713300020596Freshwater Microbial MatFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI
Ga0226658_1001497413300022222Freshwater Microbial MatHAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDYNP
Ga0226658_1003066913300022222Freshwater Microbial MatPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR
Ga0226658_1003193813300022222Freshwater Microbial MatAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPVIVS
Ga0226658_1003813833300022222Freshwater Microbial MatPLNPLPVAWRGDFKMRFSPPLQVLERGPGGEVSESPESVTMKAL
Ga0226658_1004143413300022222Freshwater Microbial MatLHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERVPGGEVSESPVL
Ga0226658_1005745613300022222Freshwater Microbial MatPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPAI
Ga0226658_1006970613300022222Freshwater Microbial MatLNPLPIAWRGDFKMRFSPPLQVLERGPGDEVSESPAMNT
Ga0226658_1008259313300022222Freshwater Microbial MatAFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI
Ga0226658_1026602513300022222Freshwater Microbial MatPPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVRNKK
Ga0226658_1042634513300022222Freshwater Microbial MatHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDF
Ga0209490_10001491233300027823FreshwaterIRTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE
Ga0209490_1001454593300027823FreshwaterPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA
Ga0209490_1002437813300027823FreshwaterHAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPEMNT
Ga0209490_1004196013300027823FreshwaterRTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPVE
Ga0209490_1007888013300027823FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPE
Ga0209490_1008333813300027823FreshwaterPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR
Ga0209490_1019294033300027823FreshwaterLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT
Ga0209490_1019409423300027823FreshwaterHAFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPEM
Ga0209490_1051211623300027823FreshwaterPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI
Ga0209490_1051238723300027823FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM
Ga0209490_1052655213300027823FreshwaterPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI
Ga0209591_1001979113300027850FreshwaterHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEVI
Ga0209591_1005762313300027850FreshwaterHAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDIE
Ga0209591_1032225343300027850FreshwaterRTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT
Ga0209591_1035064413300027850FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGYVIRKTQ
Ga0209591_1065558413300027850FreshwaterNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPDLVKL
Ga0209181_1000577013300027878FreshwaterPLPIAGRGDFKMRFSPPLQVLERGPGGEVSESPDVI
Ga0209181_1001908793300027878FreshwaterLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPDKES
Ga0209181_1002437293300027878FreshwaterPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA
Ga0209181_1003040013300027878FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE
Ga0209181_1003465013300027878FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT
Ga0209181_1003502713300027878FreshwaterPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDYNP
Ga0209181_1003748213300027878FreshwaterHAFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEITSD
Ga0209181_1008307413300027878FreshwaterPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI
Ga0209181_1008355913300027878FreshwaterHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI
Ga0209181_1012832913300027878FreshwaterPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR
Ga0209181_1012940313300027878FreshwaterPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD
Ga0209181_1018606013300027878FreshwaterLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEIIEC
Ga0335397_1002872313300032420FreshwaterSLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA
Ga0335397_1003131713300032420FreshwaterPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE
Ga0335397_1004372483300032420FreshwaterFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR
Ga0335397_1006392413300032420FreshwaterTPPLNPLPIAWRGDFKMRFSPPLQVLERVPGGEVSESPEYDKNCPLDKN
Ga0335397_1007117333300032420FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAMNT
Ga0335397_1008924253300032420FreshwaterLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI
Ga0335397_1012765313300032420FreshwaterHAFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPDKES
Ga0335397_1013730113300032420FreshwaterTPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD
Ga0335397_1018840413300032420FreshwaterHAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPK
Ga0335397_1024759813300032420FreshwaterAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFIT
Ga0335397_1027117813300032420FreshwaterNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT
Ga0335397_1093203913300032420FreshwaterNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI
Ga0335394_1092774823300032456FreshwaterLNPLPIAWGGDFNMRFSPPLQYLERGPGGEVSESPDIIRFLLHWQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.