Basic Information | |
---|---|
Family ID | F032930 |
Family Type | Metagenome |
Number of Sequences | 178 |
Average Sequence Length | 42 residues |
Representative Sequence | TPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE |
Number of Associated Samples | 19 |
Number of Associated Scaffolds | 178 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.75 % |
% of genes from short scaffolds (< 2000 bps) | 40.45 % |
Associated GOLD sequencing projects | 13 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.461 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater (52.809 % of family members) |
Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.809 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 2.56% Coil/Unstructured: 97.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 178 Family Scaffolds |
---|---|---|
PF00528 | BPD_transp_1 | 2.81 |
PF02518 | HATPase_c | 2.25 |
PF12894 | ANAPC4_WD40 | 2.25 |
PF00440 | TetR_N | 2.25 |
PF08448 | PAS_4 | 2.25 |
PF11721 | Malectin | 1.69 |
PF14338 | Mrr_N | 1.69 |
PF00005 | ABC_tran | 1.69 |
PF04940 | BLUF | 1.69 |
PF01497 | Peripla_BP_2 | 1.69 |
PF05685 | Uma2 | 1.69 |
PF01694 | Rhomboid | 1.69 |
PF08592 | Anthrone_oxy | 1.12 |
PF01022 | HTH_5 | 1.12 |
PF00753 | Lactamase_B | 1.12 |
PF12911 | OppC_N | 1.12 |
PF02874 | ATP-synt_ab_N | 1.12 |
PF03773 | ArsP_1 | 1.12 |
PF00248 | Aldo_ket_red | 1.12 |
PF14748 | P5CR_dimer | 1.12 |
PF00069 | Pkinase | 1.12 |
PF13434 | Lys_Orn_oxgnase | 1.12 |
PF11832 | DUF3352 | 1.12 |
PF08447 | PAS_3 | 1.12 |
PF13646 | HEAT_2 | 1.12 |
PF09992 | NAGPA | 1.12 |
PF02545 | Maf | 1.12 |
PF01850 | PIN | 1.12 |
PF01202 | SKI | 1.12 |
PF02464 | CinA | 1.12 |
PF01844 | HNH | 1.12 |
PF00696 | AA_kinase | 1.12 |
PF01477 | PLAT | 1.12 |
PF01799 | Fer2_2 | 1.12 |
PF02861 | Clp_N | 1.12 |
PF00072 | Response_reg | 1.12 |
PF00111 | Fer2 | 1.12 |
PF10431 | ClpB_D2-small | 0.56 |
PF07690 | MFS_1 | 0.56 |
PF08240 | ADH_N | 0.56 |
PF11716 | MDMPI_N | 0.56 |
PF01547 | SBP_bac_1 | 0.56 |
PF03631 | Virul_fac_BrkB | 0.56 |
PF01381 | HTH_3 | 0.56 |
PF13614 | AAA_31 | 0.56 |
PF00355 | Rieske | 0.56 |
PF02527 | GidB | 0.56 |
PF13279 | 4HBT_2 | 0.56 |
PF00583 | Acetyltransf_1 | 0.56 |
PF08239 | SH3_3 | 0.56 |
PF13185 | GAF_2 | 0.56 |
PF00106 | adh_short | 0.56 |
PF13091 | PLDc_2 | 0.56 |
PF05729 | NACHT | 0.56 |
PF00892 | EamA | 0.56 |
PF08379 | Bact_transglu_N | 0.56 |
PF04226 | Transgly_assoc | 0.56 |
PF08818 | DUF1801 | 0.56 |
PF13478 | XdhC_C | 0.56 |
PF00664 | ABC_membrane | 0.56 |
PF07676 | PD40 | 0.56 |
PF00016 | RuBisCO_large | 0.56 |
PF07885 | Ion_trans_2 | 0.56 |
PF01370 | Epimerase | 0.56 |
PF14520 | HHH_5 | 0.56 |
PF14360 | PAP2_C | 0.56 |
PF13602 | ADH_zinc_N_2 | 0.56 |
PF00578 | AhpC-TSA | 0.56 |
PF01135 | PCMT | 0.56 |
PF04448 | DUF551 | 0.56 |
PF13274 | DUF4065 | 0.56 |
PF13884 | Peptidase_S74 | 0.56 |
PF01053 | Cys_Met_Meta_PP | 0.56 |
PF01872 | RibD_C | 0.56 |
PF08241 | Methyltransf_11 | 0.56 |
PF07683 | CobW_C | 0.56 |
PF13378 | MR_MLE_C | 0.56 |
PF01177 | Asp_Glu_race | 0.56 |
PF03450 | CO_deh_flav_C | 0.56 |
PF13244 | MbhD | 0.56 |
PF13443 | HTH_26 | 0.56 |
PF01121 | CoaE | 0.56 |
PF00400 | WD40 | 0.56 |
PF13493 | DUF4118 | 0.56 |
PF02397 | Bac_transf | 0.56 |
PF00027 | cNMP_binding | 0.56 |
PF10258 | PHAX_RNA-bd | 0.56 |
PF13855 | LRR_8 | 0.56 |
PF04994 | TfoX_C | 0.56 |
PF01841 | Transglut_core | 0.56 |
COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.49 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.69 |
COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.69 |
COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.69 |
COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.69 |
COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.69 |
COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.69 |
COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 1.12 |
COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 1.12 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 1.12 |
COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.12 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.56 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.56 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.56 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.56 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.56 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.56 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.56 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.56 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.56 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.56 |
COG1850 | Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein | Carbohydrate transport and metabolism [G] | 0.56 |
COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.56 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.56 |
COG0523 | Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family | General function prediction only [R] | 0.56 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.56 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.56 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.56 |
COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.56 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.46 % |
Unclassified | root | N/A | 18.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300007521|Ga0105044_10000641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 43864 | Open in IMG/M |
3300007521|Ga0105044_10017262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 9713 | Open in IMG/M |
3300007521|Ga0105044_10045595 | All Organisms → cellular organisms → Bacteria | 5443 | Open in IMG/M |
3300007521|Ga0105044_10054088 | All Organisms → cellular organisms → Bacteria | 4885 | Open in IMG/M |
3300007521|Ga0105044_10066694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4268 | Open in IMG/M |
3300007521|Ga0105044_10121712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2848 | Open in IMG/M |
3300007521|Ga0105044_10132942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2682 | Open in IMG/M |
3300007521|Ga0105044_10143100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2551 | Open in IMG/M |
3300007521|Ga0105044_10144730 | All Organisms → cellular organisms → Bacteria | 2531 | Open in IMG/M |
3300007521|Ga0105044_10232034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1824 | Open in IMG/M |
3300007521|Ga0105044_10245402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1753 | Open in IMG/M |
3300007521|Ga0105044_10366749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1317 | Open in IMG/M |
3300007521|Ga0105044_10577660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 948 | Open in IMG/M |
3300007521|Ga0105044_11266028 | Not Available | 543 | Open in IMG/M |
3300007521|Ga0105044_11383927 | Not Available | 511 | Open in IMG/M |
3300007799|Ga0105049_10003367 | All Organisms → cellular organisms → Bacteria | 18887 | Open in IMG/M |
3300007799|Ga0105049_10014163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 9030 | Open in IMG/M |
3300007799|Ga0105049_10014457 | All Organisms → cellular organisms → Bacteria | 8923 | Open in IMG/M |
3300007799|Ga0105049_10060212 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
3300007799|Ga0105049_10239785 | Not Available | 1516 | Open in IMG/M |
3300007799|Ga0105049_10256256 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300007799|Ga0105049_10353715 | Not Available | 1157 | Open in IMG/M |
3300007799|Ga0105049_10499445 | Not Available | 908 | Open in IMG/M |
3300007799|Ga0105049_10583174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 813 | Open in IMG/M |
3300009032|Ga0105048_10009560 | All Organisms → cellular organisms → Bacteria | 15397 | Open in IMG/M |
3300009032|Ga0105048_10021097 | All Organisms → cellular organisms → Bacteria | 9926 | Open in IMG/M |
3300009032|Ga0105048_10024914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 9021 | Open in IMG/M |
3300009032|Ga0105048_10053079 | All Organisms → cellular organisms → Bacteria | 5752 | Open in IMG/M |
3300009032|Ga0105048_10053102 | All Organisms → cellular organisms → Bacteria | 5751 | Open in IMG/M |
3300009032|Ga0105048_10103528 | All Organisms → cellular organisms → Bacteria | 3752 | Open in IMG/M |
3300009032|Ga0105048_10157260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2835 | Open in IMG/M |
3300009032|Ga0105048_10197626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2415 | Open in IMG/M |
3300009032|Ga0105048_10210722 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Fulvivirgaceae → Fulvivirga → Fulvivirga lutimaris | 2308 | Open in IMG/M |
3300009032|Ga0105048_10215417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2273 | Open in IMG/M |
3300009032|Ga0105048_10518039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1191 | Open in IMG/M |
3300009032|Ga0105048_10758680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 885 | Open in IMG/M |
3300009032|Ga0105048_10767042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 878 | Open in IMG/M |
3300009032|Ga0105048_11003895 | Not Available | 712 | Open in IMG/M |
3300009032|Ga0105048_11123977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 652 | Open in IMG/M |
3300009032|Ga0105048_11143987 | Not Available | 644 | Open in IMG/M |
3300009083|Ga0105047_10000334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 76452 | Open in IMG/M |
3300009083|Ga0105047_10009867 | All Organisms → cellular organisms → Bacteria | 15667 | Open in IMG/M |
3300009083|Ga0105047_10019951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10320 | Open in IMG/M |
3300009083|Ga0105047_10037927 | All Organisms → cellular organisms → Bacteria | 6935 | Open in IMG/M |
3300009083|Ga0105047_10098542 | All Organisms → cellular organisms → Bacteria | 3700 | Open in IMG/M |
3300009083|Ga0105047_10131679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3035 | Open in IMG/M |
3300009083|Ga0105047_10236283 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
3300009083|Ga0105047_11421270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
3300009084|Ga0105046_10023884 | All Organisms → cellular organisms → Bacteria | 9171 | Open in IMG/M |
3300009084|Ga0105046_10066120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4867 | Open in IMG/M |
3300009084|Ga0105046_10931050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 723 | Open in IMG/M |
3300009084|Ga0105046_11029662 | Not Available | 670 | Open in IMG/M |
3300015360|Ga0163144_10054652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 7017 | Open in IMG/M |
3300015360|Ga0163144_10082065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5294 | Open in IMG/M |
3300015360|Ga0163144_10186597 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
3300015360|Ga0163144_10201879 | All Organisms → cellular organisms → Bacteria | 2763 | Open in IMG/M |
3300015360|Ga0163144_11113289 | Not Available | 738 | Open in IMG/M |
3300015360|Ga0163144_11852789 | Not Available | 506 | Open in IMG/M |
3300020180|Ga0163155_10013487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6929 | Open in IMG/M |
3300020180|Ga0163155_10018393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5629 | Open in IMG/M |
3300020180|Ga0163155_10026073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans | 4435 | Open in IMG/M |
3300020180|Ga0163155_10026567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4379 | Open in IMG/M |
3300020180|Ga0163155_10087251 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
3300020180|Ga0163155_10153732 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300020180|Ga0163155_10166064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1168 | Open in IMG/M |
3300020180|Ga0163155_10218929 | Not Available | 952 | Open in IMG/M |
3300020180|Ga0163155_10257929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 842 | Open in IMG/M |
3300020180|Ga0163155_10380016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 630 | Open in IMG/M |
3300020192|Ga0163147_10005798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 14816 | Open in IMG/M |
3300020192|Ga0163147_10011872 | All Organisms → cellular organisms → Bacteria | 8979 | Open in IMG/M |
3300020192|Ga0163147_10015630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 7377 | Open in IMG/M |
3300020192|Ga0163147_10018528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 6517 | Open in IMG/M |
3300020192|Ga0163147_10030505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium SM23_84 | 4559 | Open in IMG/M |
3300020192|Ga0163147_10032953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4307 | Open in IMG/M |
3300020192|Ga0163147_10042087 | All Organisms → cellular organisms → Bacteria | 3614 | Open in IMG/M |
3300020192|Ga0163147_10047537 | All Organisms → cellular organisms → Bacteria | 3302 | Open in IMG/M |
3300020192|Ga0163147_10050280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3169 | Open in IMG/M |
3300020192|Ga0163147_10071479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2461 | Open in IMG/M |
3300020192|Ga0163147_10308584 | Not Available | 837 | Open in IMG/M |
3300020192|Ga0163147_10331652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 792 | Open in IMG/M |
3300020192|Ga0163147_10375032 | Not Available | 720 | Open in IMG/M |
3300020192|Ga0163147_10395976 | Not Available | 690 | Open in IMG/M |
3300020201|Ga0163154_10000184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 94159 | Open in IMG/M |
3300020201|Ga0163154_10003955 | All Organisms → cellular organisms → Bacteria | 19961 | Open in IMG/M |
3300020201|Ga0163154_10004563 | All Organisms → cellular organisms → Bacteria | 18085 | Open in IMG/M |
3300020201|Ga0163154_10008390 | All Organisms → cellular organisms → Bacteria | 12073 | Open in IMG/M |
3300020201|Ga0163154_10008424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 12026 | Open in IMG/M |
3300020201|Ga0163154_10010270 | All Organisms → cellular organisms → Bacteria | 10459 | Open in IMG/M |
3300020201|Ga0163154_10039520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3758 | Open in IMG/M |
3300020201|Ga0163154_10223947 | Not Available | 964 | Open in IMG/M |
3300020201|Ga0163154_10226626 | Not Available | 955 | Open in IMG/M |
3300020203|Ga0163148_10020440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5287 | Open in IMG/M |
3300020203|Ga0163148_10037009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 3634 | Open in IMG/M |
3300020203|Ga0163148_10041673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3359 | Open in IMG/M |
3300020203|Ga0163148_10044118 | All Organisms → cellular organisms → Bacteria | 3241 | Open in IMG/M |
3300020203|Ga0163148_10048003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3066 | Open in IMG/M |
3300020203|Ga0163148_10059615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2654 | Open in IMG/M |
3300020203|Ga0163148_10060794 | Not Available | 2618 | Open in IMG/M |
3300020203|Ga0163148_10114329 | Not Available | 1690 | Open in IMG/M |
3300020203|Ga0163148_10126170 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
3300020203|Ga0163148_10136858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1483 | Open in IMG/M |
3300020203|Ga0163148_10153796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1362 | Open in IMG/M |
3300020203|Ga0163148_10198617 | Not Available | 1127 | Open in IMG/M |
3300020203|Ga0163148_10236667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 989 | Open in IMG/M |
3300020203|Ga0163148_10359016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Phototrophicales → unclassified Phototrophicales → Phototrophicales bacterium | 721 | Open in IMG/M |
3300020203|Ga0163148_10409278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 652 | Open in IMG/M |
3300020213|Ga0163152_10266543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 882 | Open in IMG/M |
3300020219|Ga0163146_10083417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2277 | Open in IMG/M |
3300020219|Ga0163146_10196615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1275 | Open in IMG/M |
3300020219|Ga0163146_10328212 | Not Available | 880 | Open in IMG/M |
3300020219|Ga0163146_10362183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 817 | Open in IMG/M |
3300020219|Ga0163146_10374930 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300020596|Ga0163149_10007878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 10646 | Open in IMG/M |
3300020596|Ga0163149_10022494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5413 | Open in IMG/M |
3300020596|Ga0163149_10027268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4784 | Open in IMG/M |
3300020596|Ga0163149_10028002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Chloroflexaceae → Chloroflexus | 4703 | Open in IMG/M |
3300020596|Ga0163149_10051036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3190 | Open in IMG/M |
3300020596|Ga0163149_10074981 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
3300020596|Ga0163149_10106270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1958 | Open in IMG/M |
3300020596|Ga0163149_10251677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1049 | Open in IMG/M |
3300020596|Ga0163149_10280212 | Not Available | 966 | Open in IMG/M |
3300020596|Ga0163149_10390966 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300020596|Ga0163149_10511762 | Not Available | 594 | Open in IMG/M |
3300020596|Ga0163149_10512677 | Not Available | 593 | Open in IMG/M |
3300022222|Ga0226658_10014974 | All Organisms → cellular organisms → Bacteria | 3709 | Open in IMG/M |
3300022222|Ga0226658_10030669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2541 | Open in IMG/M |
3300022222|Ga0226658_10031938 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
3300022222|Ga0226658_10038138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2266 | Open in IMG/M |
3300022222|Ga0226658_10041434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2166 | Open in IMG/M |
3300022222|Ga0226658_10057456 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300022222|Ga0226658_10069706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1636 | Open in IMG/M |
3300022222|Ga0226658_10082593 | Not Available | 1491 | Open in IMG/M |
3300022222|Ga0226658_10266025 | Not Available | 775 | Open in IMG/M |
3300022222|Ga0226658_10426345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
3300027823|Ga0209490_10001491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 22566 | Open in IMG/M |
3300027823|Ga0209490_10014545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 6706 | Open in IMG/M |
3300027823|Ga0209490_10024378 | All Organisms → cellular organisms → Bacteria | 5002 | Open in IMG/M |
3300027823|Ga0209490_10041960 | All Organisms → cellular organisms → Bacteria | 3630 | Open in IMG/M |
3300027823|Ga0209490_10078880 | Not Available | 2461 | Open in IMG/M |
3300027823|Ga0209490_10083338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2376 | Open in IMG/M |
3300027823|Ga0209490_10192940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1357 | Open in IMG/M |
3300027823|Ga0209490_10194094 | Not Available | 1352 | Open in IMG/M |
3300027823|Ga0209490_10512116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Phototrophicales → unclassified Phototrophicales → Phototrophicales bacterium | 656 | Open in IMG/M |
3300027823|Ga0209490_10512387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 656 | Open in IMG/M |
3300027823|Ga0209490_10526552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 642 | Open in IMG/M |
3300027850|Ga0209591_10019791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 6926 | Open in IMG/M |
3300027850|Ga0209591_10057623 | All Organisms → cellular organisms → Bacteria | 3642 | Open in IMG/M |
3300027850|Ga0209591_10322253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1125 | Open in IMG/M |
3300027850|Ga0209591_10350644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1055 | Open in IMG/M |
3300027850|Ga0209591_10655584 | Not Available | 642 | Open in IMG/M |
3300027878|Ga0209181_10005770 | All Organisms → cellular organisms → Bacteria | 17697 | Open in IMG/M |
3300027878|Ga0209181_10019087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8150 | Open in IMG/M |
3300027878|Ga0209181_10024372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 6971 | Open in IMG/M |
3300027878|Ga0209181_10030400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6055 | Open in IMG/M |
3300027878|Ga0209181_10034650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5573 | Open in IMG/M |
3300027878|Ga0209181_10035027 | All Organisms → cellular organisms → Bacteria | 5536 | Open in IMG/M |
3300027878|Ga0209181_10037482 | All Organisms → cellular organisms → Bacteria | 5294 | Open in IMG/M |
3300027878|Ga0209181_10083074 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
3300027878|Ga0209181_10083559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3182 | Open in IMG/M |
3300027878|Ga0209181_10128329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2411 | Open in IMG/M |
3300027878|Ga0209181_10129403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2398 | Open in IMG/M |
3300027878|Ga0209181_10186060 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300032420|Ga0335397_10028723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 6401 | Open in IMG/M |
3300032420|Ga0335397_10031317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6088 | Open in IMG/M |
3300032420|Ga0335397_10043724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4982 | Open in IMG/M |
3300032420|Ga0335397_10071173 | All Organisms → cellular organisms → Bacteria | 3703 | Open in IMG/M |
3300032420|Ga0335397_10089242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 3219 | Open in IMG/M |
3300032420|Ga0335397_10127653 | All Organisms → cellular organisms → Bacteria | 2561 | Open in IMG/M |
3300032420|Ga0335397_10137301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2441 | Open in IMG/M |
3300032420|Ga0335397_10188404 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
3300032420|Ga0335397_10247598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1636 | Open in IMG/M |
3300032420|Ga0335397_10271178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1534 | Open in IMG/M |
3300032420|Ga0335397_10932039 | Not Available | 591 | Open in IMG/M |
3300032456|Ga0335394_10927748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 601 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 52.81% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 47.19% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300020180 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1 | Environmental | Open in IMG/M |
3300020192 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 | Environmental | Open in IMG/M |
3300020201 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1 | Environmental | Open in IMG/M |
3300020203 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2 | Environmental | Open in IMG/M |
3300020213 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2 | Environmental | Open in IMG/M |
3300020219 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1 | Environmental | Open in IMG/M |
3300020596 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1 | Environmental | Open in IMG/M |
3300022222 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2) | Environmental | Open in IMG/M |
3300027823 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes) | Environmental | Open in IMG/M |
3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
3300027878 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes) | Environmental | Open in IMG/M |
3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0105044_100006411 | 3300007521 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE* |
Ga0105044_100172621 | 3300007521 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPAMKKLLLNSGMP* |
Ga0105044_100455957 | 3300007521 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPVE* |
Ga0105044_100540881 | 3300007521 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEKLSI* |
Ga0105044_100666941 | 3300007521 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE* |
Ga0105044_101217121 | 3300007521 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPGYV* |
Ga0105044_101329423 | 3300007521 | Freshwater | TPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPESVTMKAL* |
Ga0105044_101431001 | 3300007521 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEIIEC* |
Ga0105044_101447301 | 3300007521 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPDKES* |
Ga0105044_102320341 | 3300007521 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA* |
Ga0105044_102454021 | 3300007521 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAMNT* |
Ga0105044_103667491 | 3300007521 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPAI* |
Ga0105044_105776602 | 3300007521 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDF* |
Ga0105044_112660281 | 3300007521 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPEM* |
Ga0105044_113839271 | 3300007521 | Freshwater | TPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI* |
Ga0105049_100033671 | 3300007799 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEITSD* |
Ga0105049_100141631 | 3300007799 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI* |
Ga0105049_1001445713 | 3300007799 | Freshwater | TPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR* |
Ga0105049_100602121 | 3300007799 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERRPGGEVSESPE* |
Ga0105049_102397853 | 3300007799 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPETLFSRLVPFP* |
Ga0105049_102562564 | 3300007799 | Freshwater | TPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE* |
Ga0105049_103537151 | 3300007799 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPELN* |
Ga0105049_104994451 | 3300007799 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFTKIRLLFI* |
Ga0105049_105831741 | 3300007799 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVYL* |
Ga0105048_100043411 | 3300009032 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVK* |
Ga0105048_100095601 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGLGGEVSESPEI* |
Ga0105048_100210971 | 3300009032 | Freshwater | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED* |
Ga0105048_100249141 | 3300009032 | Freshwater | PPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI* |
Ga0105048_100530791 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESLGLNKV* |
Ga0105048_100531021 | 3300009032 | Freshwater | NPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDYNP* |
Ga0105048_101035281 | 3300009032 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPEMNT* |
Ga0105048_101572601 | 3300009032 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVRNKK* |
Ga0105048_101976261 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD* |
Ga0105048_102107223 | 3300009032 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI* |
Ga0105048_102154171 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPVIIAAN* |
Ga0105048_105180392 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDF* |
Ga0105048_107586801 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPGYVIRKTQ* |
Ga0105048_107670421 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM* |
Ga0105048_110038951 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI* |
Ga0105048_111239771 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPESIALC* |
Ga0105048_111439871 | 3300009032 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGG* |
Ga0105047_100003341 | 3300009083 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI* |
Ga0105047_100098671 | 3300009083 | Freshwater | MIENLDIYRTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGE |
Ga0105047_100199511 | 3300009083 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPGYV* |
Ga0105047_100379271 | 3300009083 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQYLEREPGGEVSESPVFKIMRIPP* |
Ga0105047_100985427 | 3300009083 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPDYNP* |
Ga0105047_101316795 | 3300009083 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDIE* |
Ga0105047_102362831 | 3300009083 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPEFVSSPRLGGSKIE* |
Ga0105047_114212701 | 3300009083 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM* |
Ga0105046_100238841 | 3300009084 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPAKKKED* |
Ga0105046_100661201 | 3300009084 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPK* |
Ga0105046_109310503 | 3300009084 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVINILD* |
Ga0105046_110296621 | 3300009084 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVVVLR* |
Ga0163144_100546526 | 3300015360 | Freshwater Microbial Mat | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED* |
Ga0163144_100820651 | 3300015360 | Freshwater Microbial Mat | FTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEITSD* |
Ga0163144_101865971 | 3300015360 | Freshwater Microbial Mat | FTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPEKLSI* |
Ga0163144_102018791 | 3300015360 | Freshwater Microbial Mat | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGKV* |
Ga0163144_111132893 | 3300015360 | Freshwater Microbial Mat | TPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTMN* |
Ga0163144_118527891 | 3300015360 | Freshwater Microbial Mat | AFTPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT* |
Ga0163155_100134874 | 3300020180 | Freshwater Microbial Mat | PLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPVINPFRGLQTL |
Ga0163155_100183931 | 3300020180 | Freshwater Microbial Mat | PLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED |
Ga0163155_100260731 | 3300020180 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPK |
Ga0163155_100265675 | 3300020180 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE |
Ga0163155_100872511 | 3300020180 | Freshwater Microbial Mat | PIAWRGDFKMRFSPPLQYLERGSGGEVSESPEMNT |
Ga0163155_101537321 | 3300020180 | Freshwater Microbial Mat | LPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD |
Ga0163155_101660641 | 3300020180 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDYNP |
Ga0163155_102189291 | 3300020180 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFTKIRLLFI |
Ga0163155_102579292 | 3300020180 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGYVIRKTQ |
Ga0163155_103800163 | 3300020180 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI |
Ga0163147_100057981 | 3300020192 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM |
Ga0163147_1001187210 | 3300020192 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVNESPAII |
Ga0163147_100156301 | 3300020192 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEVI |
Ga0163147_100185289 | 3300020192 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA |
Ga0163147_100305055 | 3300020192 | Freshwater Microbial Mat | NPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED |
Ga0163147_100329531 | 3300020192 | Freshwater Microbial Mat | PPLNPLPIAWRGDFKMRFSPPLQVLERRPGGEVSESPE |
Ga0163147_100420875 | 3300020192 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE |
Ga0163147_100475371 | 3300020192 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGIFKIN |
Ga0163147_100502801 | 3300020192 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI |
Ga0163147_100714793 | 3300020192 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERKPGGEVSESPDFSELYVVD |
Ga0163147_103085841 | 3300020192 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPELN |
Ga0163147_103316521 | 3300020192 | Freshwater Microbial Mat | PLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPGYVIRKTQ |
Ga0163147_103750323 | 3300020192 | Freshwater Microbial Mat | PIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTMN |
Ga0163147_103959761 | 3300020192 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQYLEREPGGEVSESPE |
Ga0163154_1000018480 | 3300020201 | Freshwater Microbial Mat | HAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE |
Ga0163154_1000395519 | 3300020201 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPLLQYLEREPGGEVSESPEITSD |
Ga0163154_100045631 | 3300020201 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESSDVI |
Ga0163154_100083901 | 3300020201 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPALKT |
Ga0163154_1000842412 | 3300020201 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPEM |
Ga0163154_100102701 | 3300020201 | Freshwater Microbial Mat | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGLGGEVSESPEI |
Ga0163154_100395204 | 3300020201 | Freshwater Microbial Mat | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI |
Ga0163154_102239473 | 3300020201 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPIS |
Ga0163154_102266263 | 3300020201 | Freshwater Microbial Mat | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPELN |
Ga0163148_1002044010 | 3300020203 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM |
Ga0163148_100370094 | 3300020203 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGDEVSESPAMNT |
Ga0163148_100416735 | 3300020203 | Freshwater Microbial Mat | PLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDIE |
Ga0163148_100441184 | 3300020203 | Freshwater Microbial Mat | FNPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI |
Ga0163148_100480031 | 3300020203 | Freshwater Microbial Mat | VEVIYYKYIFRTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQYLERVPGGEVSESPD |
Ga0163148_100596151 | 3300020203 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPELLSLL |
Ga0163148_100607941 | 3300020203 | Freshwater Microbial Mat | NPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPE |
Ga0163148_101143293 | 3300020203 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSAPLQVLERGPGGEVSESPDLIEVT |
Ga0163148_101261701 | 3300020203 | Freshwater Microbial Mat | PIAWRGDFKMRFSPPLQVLEREPGGEVSESPEKLSI |
Ga0163148_101368583 | 3300020203 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAKKKED |
Ga0163148_101537963 | 3300020203 | Freshwater Microbial Mat | HAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPGYV |
Ga0163148_101986171 | 3300020203 | Freshwater Microbial Mat | PIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFTKIRLLFI |
Ga0163148_102366671 | 3300020203 | Freshwater Microbial Mat | PLPIAWRGDFKMRFSPPLQVVERGPGGEVSESPTIK |
Ga0163148_102737691 | 3300020203 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSLPLQVLERGPGGEVSESPEYDKNCPLDKN |
Ga0163148_103590161 | 3300020203 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDPLEAHFDYRG |
Ga0163148_104092781 | 3300020203 | Freshwater Microbial Mat | NPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPAI |
Ga0163152_102665432 | 3300020213 | Freshwater Microbial Mat | HAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPE |
Ga0163146_100834171 | 3300020219 | Freshwater Microbial Mat | PLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEIIEC |
Ga0163146_101966151 | 3300020219 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDF |
Ga0163146_103282121 | 3300020219 | Freshwater Microbial Mat | FTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPALNHID |
Ga0163146_103621831 | 3300020219 | Freshwater Microbial Mat | PIAWRGDFKMRFSPPLQVLERGPGGEVSESPGYVIRKTQ |
Ga0163146_103749301 | 3300020219 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD |
Ga0163149_100078781 | 3300020596 | Freshwater Microbial Mat | PIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFIT |
Ga0163149_100224941 | 3300020596 | Freshwater Microbial Mat | PPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPELLSLL |
Ga0163149_100272681 | 3300020596 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPVINPFRGLQTL |
Ga0163149_100280021 | 3300020596 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPDYNP |
Ga0163149_100510365 | 3300020596 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQYLERVPGGEVSESPDIE |
Ga0163149_100524341 | 3300020596 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVYDRFSTVVL |
Ga0163149_100749811 | 3300020596 | Freshwater Microbial Mat | PLNPLPIAGRGDFKMRFSPPLQVLERGPGGEVSESPGIFKIN |
Ga0163149_101062701 | 3300020596 | Freshwater Microbial Mat | LPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGVKSDK |
Ga0163149_102516771 | 3300020596 | Freshwater Microbial Mat | AHAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPKIIRLS |
Ga0163149_102802121 | 3300020596 | Freshwater Microbial Mat | IAWRGDFKMRFSPPLQVLERGPGGEVSESPDFTKIRLLFI |
Ga0163149_103909662 | 3300020596 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGLGGEVSESPEI |
Ga0163149_105117621 | 3300020596 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEVI |
Ga0163149_105126771 | 3300020596 | Freshwater Microbial Mat | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI |
Ga0226658_100149741 | 3300022222 | Freshwater Microbial Mat | HAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDYNP |
Ga0226658_100306691 | 3300022222 | Freshwater Microbial Mat | PLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR |
Ga0226658_100319381 | 3300022222 | Freshwater Microbial Mat | AFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPVIVS |
Ga0226658_100381383 | 3300022222 | Freshwater Microbial Mat | PLNPLPVAWRGDFKMRFSPPLQVLERGPGGEVSESPESVTMKAL |
Ga0226658_100414341 | 3300022222 | Freshwater Microbial Mat | LHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERVPGGEVSESPVL |
Ga0226658_100574561 | 3300022222 | Freshwater Microbial Mat | PLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPAI |
Ga0226658_100697061 | 3300022222 | Freshwater Microbial Mat | LNPLPIAWRGDFKMRFSPPLQVLERGPGDEVSESPAMNT |
Ga0226658_100825931 | 3300022222 | Freshwater Microbial Mat | AFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI |
Ga0226658_102660251 | 3300022222 | Freshwater Microbial Mat | PPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPVRNKK |
Ga0226658_104263451 | 3300022222 | Freshwater Microbial Mat | HAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDF |
Ga0209490_1000149123 | 3300027823 | Freshwater | IRTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE |
Ga0209490_100145459 | 3300027823 | Freshwater | PIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA |
Ga0209490_100243781 | 3300027823 | Freshwater | HAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPEMNT |
Ga0209490_100419601 | 3300027823 | Freshwater | RTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPVE |
Ga0209490_100788801 | 3300027823 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPE |
Ga0209490_100833381 | 3300027823 | Freshwater | PLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR |
Ga0209490_101929403 | 3300027823 | Freshwater | LPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT |
Ga0209490_101940942 | 3300027823 | Freshwater | HAFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPEM |
Ga0209490_105121162 | 3300027823 | Freshwater | PLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI |
Ga0209490_105123872 | 3300027823 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGFM |
Ga0209490_105265521 | 3300027823 | Freshwater | PPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI |
Ga0209591_100197911 | 3300027850 | Freshwater | HAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEVI |
Ga0209591_100576231 | 3300027850 | Freshwater | HAFTPPLNPLPIAWRGDFKMRFSPPLQYLERGPGGEVSESPDIE |
Ga0209591_103222534 | 3300027850 | Freshwater | RTFAHAFTPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT |
Ga0209591_103506441 | 3300027850 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPGYVIRKTQ |
Ga0209591_106555841 | 3300027850 | Freshwater | NPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPDLVKL |
Ga0209181_100057701 | 3300027878 | Freshwater | PLPIAGRGDFKMRFSPPLQVLERGPGGEVSESPDVI |
Ga0209181_100190879 | 3300027878 | Freshwater | LPIAWRGDFKMRFSPLLQYLERVPGGEVSESPDKES |
Ga0209181_100243729 | 3300027878 | Freshwater | PLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA |
Ga0209181_100304001 | 3300027878 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE |
Ga0209181_100346501 | 3300027878 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT |
Ga0209181_100350271 | 3300027878 | Freshwater | PIAWRGDFKMRFSPPLQYLERGPGGEVSESPDYNP |
Ga0209181_100374821 | 3300027878 | Freshwater | HAFTPPLNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEITSD |
Ga0209181_100830741 | 3300027878 | Freshwater | PLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPTIKTI |
Ga0209181_100835591 | 3300027878 | Freshwater | HAFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI |
Ga0209181_101283291 | 3300027878 | Freshwater | PIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR |
Ga0209181_101294031 | 3300027878 | Freshwater | PLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD |
Ga0209181_101860601 | 3300027878 | Freshwater | LNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPEIIEC |
Ga0335397_100287231 | 3300032420 | Freshwater | SLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDLVKGIIFA |
Ga0335397_100313171 | 3300032420 | Freshwater | PIAWRGDFKMRFSPPLQVLERGPGGEVSESPENNE |
Ga0335397_100437248 | 3300032420 | Freshwater | FTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDTIRQLR |
Ga0335397_100639241 | 3300032420 | Freshwater | TPPLNPLPIAWRGDFKMRFSPPLQVLERVPGGEVSESPEYDKNCPLDKN |
Ga0335397_100711733 | 3300032420 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPAMNT |
Ga0335397_100892425 | 3300032420 | Freshwater | LNPLPIAWRGDFKMRFSPLLQYLERGPGGEVSESPEIVITIDLRELI |
Ga0335397_101276531 | 3300032420 | Freshwater | HAFTPPLNPLPIAWRGDFKMRFSPLLQYLERVPGGEVSESPDKES |
Ga0335397_101373011 | 3300032420 | Freshwater | TPPLNPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPDFSELYVVD |
Ga0335397_101884041 | 3300032420 | Freshwater | HAFTPPLNPLPIAWRGDFKMRFSPPLQVLEREPGGEVSESPK |
Ga0335397_102475981 | 3300032420 | Freshwater | AFTPPLNPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPDFIT |
Ga0335397_102711781 | 3300032420 | Freshwater | NPLPIAWRGDFKMRFSPPLQVLESGPGGEVSESPEEETKT |
Ga0335397_109320391 | 3300032420 | Freshwater | NPLPIAWRGDFKMRFSPPLQVLERGPGGEVSESPARI |
Ga0335394_109277482 | 3300032456 | Freshwater | LNPLPIAWGGDFNMRFSPPLQYLERGPGGEVSESPDIIRFLLHWQ |
⦗Top⦘ |