Basic Information | |
---|---|
Family ID | F032914 |
Family Type | Metagenome |
Number of Sequences | 178 |
Average Sequence Length | 51 residues |
Representative Sequence | VVDVSMHYYGFCIYFPVTIWDCMDIVDYLDYAGHVMLVVMFVVVAFCSLDD |
Number of Associated Samples | 74 |
Number of Associated Scaffolds | 178 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 82.39 % |
% of genes near scaffold ends (potentially truncated) | 19.66 % |
% of genes from short scaffolds (< 2000 bps) | 98.88 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (65.730 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (91.011 % of family members) |
Environment Ontology (ENVO) | Unclassified (91.011 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (91.011 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 62.03% β-sheet: 0.00% Coil/Unstructured: 37.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 65.73 % |
All Organisms | root | All Organisms | 34.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005334|Ga0068869_101820485 | Not Available | 545 | Open in IMG/M |
3300009148|Ga0105243_11657742 | Not Available | 667 | Open in IMG/M |
3300009148|Ga0105243_12072092 | Not Available | 604 | Open in IMG/M |
3300011119|Ga0105246_11196502 | Not Available | 699 | Open in IMG/M |
3300013296|Ga0157374_12067048 | Not Available | 596 | Open in IMG/M |
3300013296|Ga0157374_12978263 | Not Available | 500 | Open in IMG/M |
3300014745|Ga0157377_10355382 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 984 | Open in IMG/M |
3300014969|Ga0157376_11139062 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 807 | Open in IMG/M |
3300014969|Ga0157376_11971249 | Not Available | 621 | Open in IMG/M |
3300015267|Ga0182122_1006040 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 982 | Open in IMG/M |
3300015267|Ga0182122_1012710 | Not Available | 805 | Open in IMG/M |
3300015267|Ga0182122_1034358 | Not Available | 619 | Open in IMG/M |
3300015267|Ga0182122_1059924 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 531 | Open in IMG/M |
3300015268|Ga0182154_1003243 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1165 | Open in IMG/M |
3300015268|Ga0182154_1055983 | Not Available | 545 | Open in IMG/M |
3300015269|Ga0182113_1007713 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1040 | Open in IMG/M |
3300015269|Ga0182113_1021248 | Not Available | 786 | Open in IMG/M |
3300015274|Ga0182188_1020936 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 668 | Open in IMG/M |
3300015274|Ga0182188_1047794 | Not Available | 541 | Open in IMG/M |
3300015274|Ga0182188_1058895 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 510 | Open in IMG/M |
3300015275|Ga0182172_1010949 | Not Available | 857 | Open in IMG/M |
3300015275|Ga0182172_1031091 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 652 | Open in IMG/M |
3300015275|Ga0182172_1037495 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 620 | Open in IMG/M |
3300015275|Ga0182172_1045471 | Not Available | 587 | Open in IMG/M |
3300015275|Ga0182172_1062351 | Not Available | 536 | Open in IMG/M |
3300015276|Ga0182170_1022647 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 712 | Open in IMG/M |
3300015276|Ga0182170_1049710 | Not Available | 573 | Open in IMG/M |
3300015276|Ga0182170_1059419 | Not Available | 545 | Open in IMG/M |
3300015277|Ga0182128_1010677 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 876 | Open in IMG/M |
3300015277|Ga0182128_1079272 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 503 | Open in IMG/M |
3300015279|Ga0182174_1014617 | Not Available | 827 | Open in IMG/M |
3300015281|Ga0182160_1007724 | Not Available | 973 | Open in IMG/M |
3300015282|Ga0182124_1009542 | Not Available | 911 | Open in IMG/M |
3300015283|Ga0182156_1011252 | Not Available | 899 | Open in IMG/M |
3300015283|Ga0182156_1031164 | Not Available | 680 | Open in IMG/M |
3300015283|Ga0182156_1034278 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria | 662 | Open in IMG/M |
3300015283|Ga0182156_1053313 | Not Available | 585 | Open in IMG/M |
3300015285|Ga0182186_1055641 | Not Available | 567 | Open in IMG/M |
3300015286|Ga0182176_1019940 | Not Available | 793 | Open in IMG/M |
3300015286|Ga0182176_1029241 | Not Available | 704 | Open in IMG/M |
3300015286|Ga0182176_1065004 | Not Available | 550 | Open in IMG/M |
3300015286|Ga0182176_1070429 | Not Available | 536 | Open in IMG/M |
3300015287|Ga0182171_1012016 | Not Available | 878 | Open in IMG/M |
3300015287|Ga0182171_1075011 | Not Available | 529 | Open in IMG/M |
3300015287|Ga0182171_1079836 | Not Available | 519 | Open in IMG/M |
3300015288|Ga0182173_1085842 | Not Available | 503 | Open in IMG/M |
3300015291|Ga0182125_1019986 | Not Available | 787 | Open in IMG/M |
3300015291|Ga0182125_1073788 | Not Available | 542 | Open in IMG/M |
3300015291|Ga0182125_1088983 | Not Available | 512 | Open in IMG/M |
3300015291|Ga0182125_1093833 | Not Available | 503 | Open in IMG/M |
3300015292|Ga0182141_1061896 | Not Available | 571 | Open in IMG/M |
3300015294|Ga0182126_1072393 | Not Available | 548 | Open in IMG/M |
3300015294|Ga0182126_1080253 | Not Available | 531 | Open in IMG/M |
3300015295|Ga0182175_1037421 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 671 | Open in IMG/M |
3300015298|Ga0182106_1028932 | Not Available | 733 | Open in IMG/M |
3300015298|Ga0182106_1043521 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 652 | Open in IMG/M |
3300015298|Ga0182106_1062119 | Not Available | 588 | Open in IMG/M |
3300015298|Ga0182106_1085238 | Not Available | 533 | Open in IMG/M |
3300015299|Ga0182107_1085176 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 536 | Open in IMG/M |
3300015300|Ga0182108_1018505 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 842 | Open in IMG/M |
3300015300|Ga0182108_1024390 | Not Available | 779 | Open in IMG/M |
3300015300|Ga0182108_1034599 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 706 | Open in IMG/M |
3300015300|Ga0182108_1106390 | Not Available | 502 | Open in IMG/M |
3300015302|Ga0182143_1032487 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 711 | Open in IMG/M |
3300015303|Ga0182123_1018000 | Not Available | 810 | Open in IMG/M |
3300015303|Ga0182123_1048788 | Not Available | 618 | Open in IMG/M |
3300015304|Ga0182112_1029658 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 732 | Open in IMG/M |
3300015304|Ga0182112_1048359 | Not Available | 637 | Open in IMG/M |
3300015304|Ga0182112_1090558 | Not Available | 528 | Open in IMG/M |
3300015304|Ga0182112_1104516 | Not Available | 504 | Open in IMG/M |
3300015305|Ga0182158_1019831 | Not Available | 814 | Open in IMG/M |
3300015305|Ga0182158_1079811 | Not Available | 546 | Open in IMG/M |
3300015307|Ga0182144_1037794 | Not Available | 690 | Open in IMG/M |
3300015308|Ga0182142_1052773 | Not Available | 639 | Open in IMG/M |
3300015308|Ga0182142_1080653 | Not Available | 562 | Open in IMG/M |
3300015308|Ga0182142_1113878 | Not Available | 505 | Open in IMG/M |
3300015314|Ga0182140_1020518 | Not Available | 838 | Open in IMG/M |
3300015314|Ga0182140_1034605 | Not Available | 723 | Open in IMG/M |
3300015314|Ga0182140_1047398 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 662 | Open in IMG/M |
3300015314|Ga0182140_1057714 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 624 | Open in IMG/M |
3300015321|Ga0182127_1017358 | Not Available | 910 | Open in IMG/M |
3300015321|Ga0182127_1020381 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 869 | Open in IMG/M |
3300015321|Ga0182127_1075656 | Not Available | 591 | Open in IMG/M |
3300015321|Ga0182127_1112211 | Not Available | 520 | Open in IMG/M |
3300015322|Ga0182110_1013942 | Not Available | 961 | Open in IMG/M |
3300015322|Ga0182110_1032516 | Not Available | 756 | Open in IMG/M |
3300015322|Ga0182110_1048755 | Not Available | 672 | Open in IMG/M |
3300015322|Ga0182110_1060576 | Not Available | 630 | Open in IMG/M |
3300015322|Ga0182110_1124124 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 502 | Open in IMG/M |
3300015341|Ga0182187_1041473 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria | 869 | Open in IMG/M |
3300015341|Ga0182187_1073103 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 719 | Open in IMG/M |
3300015341|Ga0182187_1114727 | Not Available | 615 | Open in IMG/M |
3300015341|Ga0182187_1123254 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 600 | Open in IMG/M |
3300015342|Ga0182109_1074236 | Not Available | 756 | Open in IMG/M |
3300015342|Ga0182109_1111762 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 653 | Open in IMG/M |
3300015342|Ga0182109_1115173 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 646 | Open in IMG/M |
3300015342|Ga0182109_1143586 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 596 | Open in IMG/M |
3300015342|Ga0182109_1144185 | Not Available | 595 | Open in IMG/M |
3300015342|Ga0182109_1144840 | Not Available | 594 | Open in IMG/M |
3300015342|Ga0182109_1207479 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 517 | Open in IMG/M |
3300015343|Ga0182155_1068229 | Not Available | 772 | Open in IMG/M |
3300015344|Ga0182189_1150386 | Not Available | 591 | Open in IMG/M |
3300015345|Ga0182111_1075957 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 783 | Open in IMG/M |
3300015345|Ga0182111_1144421 | Not Available | 617 | Open in IMG/M |
3300015346|Ga0182139_1098218 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 714 | Open in IMG/M |
3300015346|Ga0182139_1118073 | Not Available | 666 | Open in IMG/M |
3300015346|Ga0182139_1181789 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 566 | Open in IMG/M |
3300015346|Ga0182139_1222329 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 522 | Open in IMG/M |
3300015347|Ga0182177_1129363 | Not Available | 646 | Open in IMG/M |
3300015347|Ga0182177_1156469 | Not Available | 602 | Open in IMG/M |
3300015351|Ga0182161_1181964 | Not Available | 587 | Open in IMG/M |
3300015351|Ga0182161_1196918 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 569 | Open in IMG/M |
3300015355|Ga0182159_1084175 | Not Available | 920 | Open in IMG/M |
3300015361|Ga0182145_1127954 | Not Available | 579 | Open in IMG/M |
3300015361|Ga0182145_1181370 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 514 | Open in IMG/M |
3300017404|Ga0182203_1031114 | Not Available | 849 | Open in IMG/M |
3300017404|Ga0182203_1056678 | Not Available | 708 | Open in IMG/M |
3300017407|Ga0182220_1064504 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 583 | Open in IMG/M |
3300017407|Ga0182220_1075907 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 557 | Open in IMG/M |
3300017411|Ga0182208_1100311 | Not Available | 545 | Open in IMG/M |
3300017413|Ga0182222_1023839 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 742 | Open in IMG/M |
3300017413|Ga0182222_1079722 | Not Available | 545 | Open in IMG/M |
3300017415|Ga0182202_1026151 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 845 | Open in IMG/M |
3300017415|Ga0182202_1075089 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 614 | Open in IMG/M |
3300017420|Ga0182228_1059551 | Not Available | 667 | Open in IMG/M |
3300017424|Ga0182219_1029977 | Not Available | 812 | Open in IMG/M |
3300017424|Ga0182219_1049464 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 695 | Open in IMG/M |
3300017424|Ga0182219_1088588 | Not Available | 581 | Open in IMG/M |
3300017425|Ga0182224_1016282 | Not Available | 1022 | Open in IMG/M |
3300017425|Ga0182224_1028301 | Not Available | 869 | Open in IMG/M |
3300017425|Ga0182224_1043419 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 766 | Open in IMG/M |
3300017425|Ga0182224_1056453 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 707 | Open in IMG/M |
3300017425|Ga0182224_1086586 | Not Available | 620 | Open in IMG/M |
3300017427|Ga0182190_1066773 | Not Available | 684 | Open in IMG/M |
3300017427|Ga0182190_1066916 | Not Available | 684 | Open in IMG/M |
3300017427|Ga0182190_1079780 | Not Available | 645 | Open in IMG/M |
3300017427|Ga0182190_1086698 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 628 | Open in IMG/M |
3300017427|Ga0182190_1152744 | Not Available | 516 | Open in IMG/M |
3300017430|Ga0182192_1029481 | Not Available | 918 | Open in IMG/M |
3300017430|Ga0182192_1040498 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 826 | Open in IMG/M |
3300017430|Ga0182192_1066514 | Not Available | 700 | Open in IMG/M |
3300017433|Ga0182206_1129218 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 538 | Open in IMG/M |
3300017438|Ga0182191_1100463 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 616 | Open in IMG/M |
3300017438|Ga0182191_1131672 | Not Available | 563 | Open in IMG/M |
3300017442|Ga0182221_1150543 | Not Available | 523 | Open in IMG/M |
3300017443|Ga0182193_1066959 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 726 | Open in IMG/M |
3300017443|Ga0182193_1093655 | Not Available | 650 | Open in IMG/M |
3300017443|Ga0182193_1095381 | Not Available | 646 | Open in IMG/M |
3300017443|Ga0182193_1096215 | Not Available | 644 | Open in IMG/M |
3300017443|Ga0182193_1125143 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 590 | Open in IMG/M |
3300017443|Ga0182193_1128588 | Not Available | 584 | Open in IMG/M |
3300017443|Ga0182193_1147510 | Not Available | 557 | Open in IMG/M |
3300017443|Ga0182193_1196518 | Not Available | 502 | Open in IMG/M |
3300017680|Ga0182233_1085851 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 574 | Open in IMG/M |
3300017680|Ga0182233_1114941 | Not Available | 504 | Open in IMG/M |
3300017681|Ga0182226_1110057 | Not Available | 523 | Open in IMG/M |
3300017682|Ga0182229_1051509 | Not Available | 698 | Open in IMG/M |
3300017682|Ga0182229_1060657 | Not Available | 644 | Open in IMG/M |
3300017683|Ga0182218_1137264 | Not Available | 521 | Open in IMG/M |
3300017685|Ga0182227_1070628 | Not Available | 644 | Open in IMG/M |
3300017685|Ga0182227_1080196 | Not Available | 613 | Open in IMG/M |
3300017686|Ga0182205_1056371 | Not Available | 728 | Open in IMG/M |
3300017686|Ga0182205_1103543 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 597 | Open in IMG/M |
3300017686|Ga0182205_1110073 | Not Available | 585 | Open in IMG/M |
3300017686|Ga0182205_1160088 | Not Available | 514 | Open in IMG/M |
3300017689|Ga0182231_1106659 | Not Available | 543 | Open in IMG/M |
3300017690|Ga0182223_1012891 | Not Available | 928 | Open in IMG/M |
3300017690|Ga0182223_1060583 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 615 | Open in IMG/M |
3300017690|Ga0182223_1107779 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 523 | Open in IMG/M |
3300025927|Ga0207687_10517247 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 998 | Open in IMG/M |
3300026023|Ga0207677_11670511 | Not Available | 590 | Open in IMG/M |
3300026023|Ga0207677_11999816 | Not Available | 539 | Open in IMG/M |
3300026089|Ga0207648_10499108 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1113 | Open in IMG/M |
3300026089|Ga0207648_11553244 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 622 | Open in IMG/M |
3300026118|Ga0207675_101395542 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 721 | Open in IMG/M |
3300026121|Ga0207683_10617112 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1004 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 91.01% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068869_1018204851 | 3300005334 | Miscanthus Rhizosphere | VVDVSMHYYGFCIYFSVTIWDCMDIVDCAGHVMLVVMFVVVAFCSLDD* |
Ga0105243_116577421 | 3300009148 | Miscanthus Rhizosphere | VVVISMHYYGFCIYFSVTIWDCMDIVDYLDCAGHIMLVVMFVVVALCSLDD* |
Ga0105243_120720922 | 3300009148 | Miscanthus Rhizosphere | VLDVSMYYYGFCSHFPITIWDCIDIVDYLDYAGHVMLIVMFDVVVLCSLED* |
Ga0105246_111965021 | 3300011119 | Miscanthus Rhizosphere | VVVVSMHYYGFCIYFSITIWDCMDIVDYLDYAGYIMLVVMFVVVAFCSLDD* |
Ga0157374_120670481 | 3300013296 | Miscanthus Rhizosphere | VRVVVDVSMHYYGFCIYFSITIWDCMDIVDYLDCAAHIMLVVMFVVVAFCSLDD* |
Ga0157374_129782631 | 3300013296 | Miscanthus Rhizosphere | VVVVSTHYYGFCIYFSVTIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD* |
Ga0157377_103553821 | 3300014745 | Miscanthus Rhizosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDYLDYTGHVMLIVMFVVVALCSLED* |
Ga0157376_111390622 | 3300014969 | Miscanthus Rhizosphere | VRVVVDVSMHYYGFCIYFSVTIWDCMDIVDYLDCAGHIMLVVMFVVVALCSLDD* |
Ga0157376_119712491 | 3300014969 | Miscanthus Rhizosphere | VVDVSMYYYAFCIYFHVTIWDCMNIVDYLDYAGHVMLIVMSVVVALCSLDD* |
Ga0182122_10060401 | 3300015267 | Miscanthus Phyllosphere | VVVVSMHYYGFCIYFSITIWDCMDIVDYLDYAGHIMLVVMFVVVAFCSLDD* |
Ga0182122_10127102 | 3300015267 | Miscanthus Phyllosphere | VVDVSMYYYRFCSYFLITICDYIDIVDYLNYAGHVMLIVMFDVVVLCFLED* |
Ga0182122_10343582 | 3300015267 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDYLDYAGHVMLIVMFVVVVLCSLDD* |
Ga0182122_10599241 | 3300015267 | Miscanthus Phyllosphere | VRVVVVVSMHYYGFCIYFSVTIWDCMNIVDYLDCVRHIMLVLMFVVVVFCSLDD* |
Ga0182154_10032432 | 3300015268 | Miscanthus Phyllosphere | VVDVSMYYYAFCIYFSVTIWDCMDIVGYLDYAGHVMLIVMFVVVALCSLND* |
Ga0182154_10559832 | 3300015268 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSITIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD* |
Ga0182113_10077131 | 3300015269 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFPVTIWDCMDIVDYLDCAGHVMLVVIFIVVALCSLDH* |
Ga0182113_10212481 | 3300015269 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFSVTIWGCMDIVDYAGHVMLIVMFV |
Ga0182188_10209362 | 3300015274 | Miscanthus Phyllosphere | VRDLVPVSMHYYEFCIYFCITIWDCMDIVDYLDYAGHIMLVVIFVVVAFCSLDD* |
Ga0182188_10477941 | 3300015274 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFPVTIWDCMDIVDYLDYAGHVMLIVMFVVVALCSLDG* |
Ga0182188_10588952 | 3300015274 | Miscanthus Phyllosphere | VVDVRMYYYGFCSHFPITIWDYMDIVDYLDYAGHVMLIVMFDVVVLCSLED* |
Ga0182172_10109492 | 3300015275 | Miscanthus Phyllosphere | VVDVSMDYYGFCIYFPITIWDYMDIVDYLDCAGHVMVIVMFVVVVLCYLDD* |
Ga0182172_10213731 | 3300015275 | Miscanthus Phyllosphere | EFCIYFPVTILDCMDIVDYLNRVGHVMLIVMFFVVALCSLDD* |
Ga0182172_10310911 | 3300015275 | Miscanthus Phyllosphere | VVDVSVYHYGFCSYFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLDD* |
Ga0182172_10374951 | 3300015275 | Miscanthus Phyllosphere | VRVVVDVSMHYYGFCIYFFVTIWDCMDIMDYLDCAGHVMLVVIFVVVAFCSLDD* |
Ga0182172_10454711 | 3300015275 | Miscanthus Phyllosphere | VVIVSMHYYELCIYFSVTIWDCMDIVDYLDYVGHVVLIVMFVVVALCSLND* |
Ga0182172_10623511 | 3300015275 | Miscanthus Phyllosphere | YYYGFCCYFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLDD* |
Ga0182170_10226472 | 3300015276 | Miscanthus Phyllosphere | VRVVVVVSMHYYGFCIYFSITIWDYMDIVDYMDCAGHIMLVVMFVVVRFCSLDD* |
Ga0182170_10497101 | 3300015276 | Miscanthus Phyllosphere | VRVVVDVSMHYYGFCIYFSVTIWDCMDIADYLDCAGHIMLVVMFVVVAFCSLDD* |
Ga0182170_10594191 | 3300015276 | Miscanthus Phyllosphere | VVVVSMHYYGFCIYFSITIWDCMNIVDYLDYAGHIMLVVMFVVVAFCSLDD* |
Ga0182128_10106772 | 3300015277 | Miscanthus Phyllosphere | VRVVVDVSMHYYRFCMYFPITISDCMDIVDYLDCAGHVMLVVMFVVVVFCSLDD* |
Ga0182128_10792721 | 3300015277 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPVTIWDCMDIMDYLDYTGHVMLIVMFDVVVLCSLDD* |
Ga0182174_10146173 | 3300015279 | Miscanthus Phyllosphere | VVDVSMYYYGFCSHFPITIWDCIDIVDYLDYAGHVIVIVMFIVVALCSLDD* |
Ga0182160_10077241 | 3300015281 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFRVTIWDCMDIVDYLDYARHVVLVVIFYVVVLCYLDD* |
Ga0182124_10095422 | 3300015282 | Miscanthus Phyllosphere | VRVVVDVSMYYYAFCIYFHVTIWDCMNIVDYLDYAGHVMLIVMSVVVALCSLDD* |
Ga0182156_10112521 | 3300015283 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLDN* |
Ga0182156_10311642 | 3300015283 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFPITIWDYMDIVDYLDCAGHVMLIVVFVVVALCSLDD* |
Ga0182156_10342781 | 3300015283 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSVTIWDCMDILDYLYFAGHIMLVVIFIVV |
Ga0182156_10533131 | 3300015283 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFSVTIWDCMDIVDYLDYARHVVLIVMFVVVALCSLDG* |
Ga0182186_10556411 | 3300015285 | Miscanthus Phyllosphere | GFCIYFPVTIWDCMDIVDYLDCAGHVMLVVMFVVVSLCSLDD* |
Ga0182176_10199401 | 3300015286 | Miscanthus Phyllosphere | VRDVVVVGMHYYGFCIYFSITIWDCMDIVDYLDCAAHIMLVVMFVVVAFCSLDD* |
Ga0182176_10292411 | 3300015286 | Miscanthus Phyllosphere | MLVCTIYGFCIYFPITIWDCMDIVDYLDCAGHVMLIVMFVVVALCSLDD* |
Ga0182176_10650041 | 3300015286 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDYLDCAGYIMLVVMFVVVAFCSLDD* |
Ga0182176_10704291 | 3300015286 | Miscanthus Phyllosphere | VRVVVDISIHYYGFCIYFPVTIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD* |
Ga0182171_10120161 | 3300015287 | Miscanthus Phyllosphere | VVDVSMYYYGFCSHFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLED* |
Ga0182171_10750111 | 3300015287 | Miscanthus Phyllosphere | VVDVSMYYYRFCSYFLITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLDD* |
Ga0182171_10798361 | 3300015287 | Miscanthus Phyllosphere | VRDMVVVSMQYYGFCIYFSITIWDCMNIVDYLDYAGHIMLVVMFVVVAFCSLDD* |
Ga0182173_10858421 | 3300015288 | Miscanthus Phyllosphere | VVVVSMHYYGFCIYFSITIWDCMDIVDYLDCAGHIMLVVIFVVVAFFSLDD* |
Ga0182125_10199861 | 3300015291 | Miscanthus Phyllosphere | VRNLVAISMYYYGLCIYFSVTIWDYMDIMDYLDCAGHIMLVLMFVVVAFCSLDD* |
Ga0182125_10737882 | 3300015291 | Miscanthus Phyllosphere | VVDVSVYYYEFCSHFPITIWDCMDIVDYLDYVGHVMLIMMFDVVVLCSLDD* |
Ga0182125_10889831 | 3300015291 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFPVTIWDCMDIVDYLDYARHVMLIVMFVVVALCSLDD* |
Ga0182125_10938331 | 3300015291 | Miscanthus Phyllosphere | MVDVSMYYYRFCSHFPLTIWDCIDIVDYLDYAGHVMLIVMFDVVVLCSLED* |
Ga0182141_10618961 | 3300015292 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFSKTIWDCTNIVDYLDYAGHVMLIVMFVVVALCSLDD* |
Ga0182126_10723931 | 3300015294 | Miscanthus Phyllosphere | YYRFCSYFSITIWDCMDIVDYLNYTGHVMLIVMFDVVVLCSLDD* |
Ga0182126_10802531 | 3300015294 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCFLED* |
Ga0182175_10374211 | 3300015295 | Miscanthus Phyllosphere | VRVVVDVSMHYYGFCIYFSVTIWDCMDIVDYLDCAGHIMLVVIFVVVAFCSLDD* |
Ga0182106_10289321 | 3300015298 | Miscanthus Phyllosphere | MYYYEFCSYFYITIWDCMDIVDYLDYARHVMLIVMFDVIVLCSWDD* |
Ga0182106_10435211 | 3300015298 | Miscanthus Phyllosphere | VVDVSMYYYGFCSHFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLDN* |
Ga0182106_10621191 | 3300015298 | Miscanthus Phyllosphere | MRVVVDVSMHYYGFCIYFLVTIWDCMDIVDYLGCAGHVMLIVVFVVVALCSLDD* |
Ga0182106_10852381 | 3300015298 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFPVTIWDCMDIVDYLDCAGHVMLVVMFVVVAFCSLDD* |
Ga0182107_10851762 | 3300015299 | Miscanthus Phyllosphere | VVVVSMHYYGFCIYFYVTIWDCMDTMDYLDYVGHIMLVVKFIVVAFCSLDD* |
Ga0182108_10185052 | 3300015300 | Miscanthus Phyllosphere | VVVVSMHYYGFCIYFSVTIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD* |
Ga0182108_10243901 | 3300015300 | Miscanthus Phyllosphere | DISMHYYGFCIFFRVTIWDCMDIVDYLDCARHVMLIVMFVVVAFCSMDD* |
Ga0182108_10345992 | 3300015300 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDYLDCAGHIMLVMFVVVAFCSLDD* |
Ga0182108_11063901 | 3300015300 | Miscanthus Phyllosphere | VRVVVDVSMDYYGFCIYFPITIWDYMDIVDYLDCAGHVMVIVMFVVVALCYLDD* |
Ga0182143_10324871 | 3300015302 | Miscanthus Phyllosphere | VRDLVAVSMHYYGFCIYFYVTIWDCMDIMDYLDCAGYIMLVVMFVVVAFCSLDD* |
Ga0182123_10180002 | 3300015303 | Miscanthus Phyllosphere | MVDVSMYYYRFCSYFPITICDCMDIVDYLDYAKHVMLIVMFDVVVLCSLDD* |
Ga0182123_10487881 | 3300015303 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSITIWDCMDIVDYLDCVGHIMLVVMFVVVAFCSLDD* |
Ga0182112_10296581 | 3300015304 | Miscanthus Phyllosphere | MRVVVDVSMHYYGFCIYFPVTIWDCMDIVDYLDCAGHVMLVVIFVVVAFCSLDD* |
Ga0182112_10483591 | 3300015304 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFCITIWDCVNIVDYLDCVGHIILVVMFVVVAFC |
Ga0182112_10905582 | 3300015304 | Miscanthus Phyllosphere | FMVDVRMYYYRFCSHFPITIWDCMDIVDYLDCAGHVMLIVIFVVVALCSLDD* |
Ga0182112_11045161 | 3300015304 | Miscanthus Phyllosphere | VVDVSMYYYAFCIYFPVTIWDCMDIVDYLDYAGHVILIVMFVVVALCS |
Ga0182158_10198312 | 3300015305 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSVTIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD* |
Ga0182158_10798111 | 3300015305 | Miscanthus Phyllosphere | HYYGFCIYFSVTIWDCMDIVDCAGHVMLVVMFVVVAFCSLDD* |
Ga0182144_10377942 | 3300015307 | Miscanthus Phyllosphere | VVDVSMHYYGFCSHFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLED* |
Ga0182142_10527731 | 3300015308 | Miscanthus Phyllosphere | VVDVSMHYYGSCIYFPVTIWDCIDIVDYLDYAGHVMLIVMFDVVVLCSLED* |
Ga0182142_10806531 | 3300015308 | Miscanthus Phyllosphere | VVVVSMHYYGFCIYFSVTIWNCMDIVDYLDYARHIMLVVMFVVVAFCSLND* |
Ga0182142_11138781 | 3300015308 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFPVTIWDCMDIVDYLDCAGHVMLIVMFIVVALCSLDD* |
Ga0182140_10205181 | 3300015314 | Miscanthus Phyllosphere | VRDVVVVGMHYYEFCIYFSITIWDCMDIVDYLECAAHIMLVVIFVVVALCSLDD* |
Ga0182140_10346052 | 3300015314 | Miscanthus Phyllosphere | VVDVSMHYYRFCIYFPVTIWDCMDIVDYLDYAGHVMLIVMFVVVVLCSLDV* |
Ga0182140_10473981 | 3300015314 | Miscanthus Phyllosphere | VRVVVDVSMHYYGFCIYFSVTIWDCMDIVDYLDYAGHIMLVVMFVVVVFCSLDD* |
Ga0182140_10577141 | 3300015314 | Miscanthus Phyllosphere | VVDVSMHYYGFCSDFPITIWDCMDIVDYLNYAGHVMLIVMFDVVVLCFLED* |
Ga0182127_10173581 | 3300015321 | Miscanthus Phyllosphere | MIDVSMYYYVFCSYFPITIWDCLDIVDYLDYAGHVILIVMFDVVVLCSLDD* |
Ga0182127_10203811 | 3300015321 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLDD* |
Ga0182127_10756561 | 3300015321 | Miscanthus Phyllosphere | VRVVVDVSMHYYGFCFYFRVTIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLDD* |
Ga0182127_11122111 | 3300015321 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFSKTIWDCTDIVDYLDYAGHVMLIVMFVVVALCSLDD* |
Ga0182110_10139421 | 3300015322 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSITIWDCMDIVDYLDYAGHIMLVVMFVVVAFCSLDD* |
Ga0182110_10325161 | 3300015322 | Miscanthus Phyllosphere | MVDVSMYYYEFCSHFPITIWDCMDIVDYLDYAGYVILIVMFVVVALCSLDD* |
Ga0182110_10487551 | 3300015322 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFFTTIWDCMNIVDYLDCATHIMLVVMFVVVEFCSLDD* |
Ga0182110_10605762 | 3300015322 | Miscanthus Phyllosphere | VRDLVAISMHYYGFYIYFSITIWDCMDIVDYLDCAGYIMLVVMFVVVAFCSLDD* |
Ga0182110_11241241 | 3300015322 | Miscanthus Phyllosphere | VVDVSIYYYEFCSYFPVTIWDCMDIVDYSDYAGYVMLIVMFVVVVLCSLDD* |
Ga0182187_10414731 | 3300015341 | Miscanthus Phyllosphere | VVDVSMYYYGFCNYFPVTIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLED* |
Ga0182187_10731031 | 3300015341 | Miscanthus Phyllosphere | VRVVVVVSMHYYGFCIYFSITIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD* |
Ga0182187_11147271 | 3300015341 | Miscanthus Phyllosphere | VRVVVDVSMHYYGFCIYFPVTIWDCMDIVDYLDCAGHVMLIVMFVVVALCYLDD* |
Ga0182187_11232542 | 3300015341 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLYD* |
Ga0182109_10742361 | 3300015342 | Miscanthus Phyllosphere | VVAVSLNYYGFCIYFFVTIWDYMDILDYLYFAGHIMLVVMLIVVALCSLDD* |
Ga0182109_11117621 | 3300015342 | Miscanthus Phyllosphere | VVDVSMHYYGFCSHFPITIWHYMDIVDYLDYAEHVMLIVMLDVVVLCSLKD* |
Ga0182109_11151732 | 3300015342 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDYLDYAGHVMLIVMLVVVVLCSLDD* |
Ga0182109_11435862 | 3300015342 | Miscanthus Phyllosphere | VMVDVSMHYYGFCINFPVTIWYCMDIMDYLDCIGHVMLVVMFVVVVFCSLDD* |
Ga0182109_11441851 | 3300015342 | Miscanthus Phyllosphere | VVVDVTMHNYGFCIYFHVTIWDCMDIVDYLDCAGHVMLIVIFVVVALCSLDD* |
Ga0182109_11448401 | 3300015342 | Miscanthus Phyllosphere | MRFVVDVSMHYYGFCIYFPITIWDCMDIVDYLDYVGHVMLIMMFVVVVVALCSLED* |
Ga0182109_12074792 | 3300015342 | Miscanthus Phyllosphere | VRVVVDVSMHYYGFCIYFPVTIWDCMDIVDYLDCAGHVMLVVMFVVVAFCSLDD* |
Ga0182155_10682292 | 3300015343 | Miscanthus Phyllosphere | VSMHYYGFCIYFSVTIWDCMDIVDYLDYAGHIMLVVMFVVVAFCSLDD* |
Ga0182189_11503861 | 3300015344 | Miscanthus Phyllosphere | VVDVSMYYYAFCIYFPVTIWDCMDIVDYLDYAGHVMLIVMFVVVALCSLDD* |
Ga0182111_10759571 | 3300015345 | Miscanthus Phyllosphere | VVGVTMKYYEFCIYFSVTIRDCMDIVDYLIYAENVLLIVMLVVVALCYLDD* |
Ga0182111_11444212 | 3300015345 | Miscanthus Phyllosphere | VVDVSMYYYRFYSHFPITIWDCMDIMNYLDYAGHVMLIGMFDVVVLCSLKDYWII* |
Ga0182139_10982181 | 3300015346 | Miscanthus Phyllosphere | VRDVVVVSMHYYGLCIYFSITIWDCMDIVDCAGHIILVVMFVVVAFCSLDD* |
Ga0182139_11180731 | 3300015346 | Miscanthus Phyllosphere | VADVSMFYYGFCNYFPITIWDCMDIVDYAGHVMLIVMFVVVALCSLDD* |
Ga0182139_11817892 | 3300015346 | Miscanthus Phyllosphere | VVDVSMYYYGFYSYFPITIWDCMVIVDYLDYAGHVMLIVMFDVVVLCSLDD* |
Ga0182139_12223292 | 3300015346 | Miscanthus Phyllosphere | MVDVSMHYYGFCINFPVTIWYCMDIMDYLDCIGHVMLVVMFVVVVFCSLDD* |
Ga0182177_11293631 | 3300015347 | Miscanthus Phyllosphere | VKVVVDVSMHYYGSCIYFPVTIWDCIDIVDYLDYAGHIMLVVMFVVVAFCSLDD* |
Ga0182177_11564691 | 3300015347 | Miscanthus Phyllosphere | YYGFCINFPVTIWYCMDIMDYLDCIGHVMLVVMFVVVVFCSLDD* |
Ga0182161_11819641 | 3300015351 | Miscanthus Phyllosphere | VVDVRMYYYGFCSHFPITIWDYMDIVDYLDYAEHVMLFMVFVVVVLCSLDD* |
Ga0182161_11969181 | 3300015351 | Miscanthus Phyllosphere | VVDVSMYYYGFCSHFPVTIWDCMDIVDYLDYAGYVMLIVMFVVVALCSLDD* |
Ga0182159_10841751 | 3300015355 | Miscanthus Phyllosphere | VVDVSVYYYEFCSHFPITIWDCMDIVDYLDYAGHVMLIMMFDVVVLCSLED* |
Ga0182145_11279541 | 3300015361 | Miscanthus Phyllosphere | AVRDVVVVSMHYYGFCIYFSITIWDCMDILDYLDCAGHIMLVMMFVVVAFCSLDD* |
Ga0182145_11813701 | 3300015361 | Miscanthus Phyllosphere | VVDVSMYYYGFCSHFSETIWDCMDIMDYLDYAGHVMLIVMFVVVALCSLDD* |
Ga0182203_10311141 | 3300017404 | Miscanthus Phyllosphere | VRVVIDVSMYYYAFCIYFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLED |
Ga0182203_10566781 | 3300017404 | Miscanthus Phyllosphere | VVDVSMYYYRFCSHFPITIWDYMDIVDYLEYTGHVMLILMFVVVALCSLDD |
Ga0182220_10645041 | 3300017407 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSITIWDCMDIVDYLDCAGHIMLVVMFVVIAFCSLDD |
Ga0182220_10759072 | 3300017407 | Miscanthus Phyllosphere | VVDVTMHNYGFCIYFPVTIWDCMDIVDYLDCAGHVMLIVIFVVVALCSLDD |
Ga0182208_11003111 | 3300017411 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSVTIWDCMDIVDCAGHVMLVVMFVVVAFCSLDD |
Ga0182222_10238392 | 3300017413 | Miscanthus Phyllosphere | VRDVVVISMHYYGFCIYFSVTIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD |
Ga0182222_10797222 | 3300017413 | Miscanthus Phyllosphere | VRVVVDVSMHYYRFCIYFLVTIWDCMDIMDYLDCAGHVMLVVMFVVVAFCSLDD |
Ga0182202_10261511 | 3300017415 | Miscanthus Phyllosphere | VVDVSMHYYRFCIYFPITIWDYMDIMDYLDCAGYVMLIVMFVVVALCSLDD |
Ga0182202_10750891 | 3300017415 | Miscanthus Phyllosphere | VVDVSLHYYGFCIYFPVTIWDCMDIVDYLDCAGHVMLIVIFVVVALCSSDD |
Ga0182228_10595513 | 3300017420 | Miscanthus Phyllosphere | VRDLVPVSMHYYGFCIYFSITIWDCMDIVDYLDCAGHIMLVVMF |
Ga0182219_10299772 | 3300017424 | Miscanthus Phyllosphere | VRVVVGLSMSYYRFCINFSVTIWDCMDIMDYLDYTGHVMLIVMLVVVVLCSLDD |
Ga0182219_10494641 | 3300017424 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFSITIWDCMDIVDYLNYAGYVMLIVMFDVVVLCTLDD |
Ga0182219_10885881 | 3300017424 | Miscanthus Phyllosphere | VVDVRMYYYGFCSHFPITIWDYMDIVDYLDYAGHVMLIVMFDVVVLCSLED |
Ga0182224_10162822 | 3300017425 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPISFWDCMDIVEYLDYAGHVMLIVMFDVVVLCSLDD |
Ga0182224_10283011 | 3300017425 | Miscanthus Phyllosphere | VRDVVVVGMHYYGFCIYFSITIWDCMDIVDYLDCAAHIMLVVMFVVVAFCSLDD |
Ga0182224_10434192 | 3300017425 | Miscanthus Phyllosphere | VRVVVDVSMHYYGFCIYFSVTIWDCMDIMDYLDCVGHIMLVVMFVAVAFCSLDD |
Ga0182224_10564532 | 3300017425 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSITIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD |
Ga0182224_10865861 | 3300017425 | Miscanthus Phyllosphere | VRDVVVVSMHYYGCCIYFFVTIWDCMDIVDCAGHIMLVVMFVVVVFCSLDD |
Ga0182190_10667732 | 3300017427 | Miscanthus Phyllosphere | VVDVTMHNYEFCIYFPVTIWDCMDIVDYLDCAGHVMLIVIFVVVALCSLDD |
Ga0182190_10669161 | 3300017427 | Miscanthus Phyllosphere | VRDMVVVSMHYYGFCIYFSVTIWDCMDIVDYLDYAGHIMLVVMFVVVAFCSLDD |
Ga0182190_10797801 | 3300017427 | Miscanthus Phyllosphere | VRVVVDVSMHYYRFCIYFCVTIWDYMDIVDYLDCAGQVMLIVMFVVVALCSLDD |
Ga0182190_10866981 | 3300017427 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDYLNYAGHVMLIVMFDVVVLCSLDD |
Ga0182190_11527441 | 3300017427 | Miscanthus Phyllosphere | MVVVDVSMHYYGFCIYFHVTIWDCMDIVEYLDYAGHVMLVVMFVAVAFCSLDD |
Ga0182192_10294812 | 3300017430 | Miscanthus Phyllosphere | VVDVSLHYYGFCIYFPVTIWDCMDIVDYLDCAGHVMLVVMFIVVACCSLDD |
Ga0182192_10404982 | 3300017430 | Miscanthus Phyllosphere | VRIVVDVSMDYYGFCIYFPITIWDCMDIVDYLDCAGHVMVIVMFVVVALCYLDD |
Ga0182192_10665141 | 3300017430 | Miscanthus Phyllosphere | VVDVSMYYYRFCSYFPITIWDCMNIVDYLDYAGHVTLIVMFVVVAFVLFGWLNV |
Ga0182206_11292182 | 3300017433 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSITIWDCMDIVDYLDCAGHIMLVVMFIVVALCSLDD |
Ga0182191_11004631 | 3300017438 | Miscanthus Phyllosphere | MVDVSMYYYGFCSYFSITIWDCMDIMDYLDYAGHVMLIVMFDVVVLCSLDD |
Ga0182191_11316721 | 3300017438 | Miscanthus Phyllosphere | VVDVNMYYYGFCSYFPITIWDYMDIVDYFDYEGHVMLIVMFVVVALCSLDD |
Ga0182221_11505432 | 3300017442 | Miscanthus Phyllosphere | VRDVVVVSMYYYGFCIYFSVIIYDCIDIVDYLDCVGYIILVMMSVVVAFFSLDD |
Ga0182193_10669591 | 3300017443 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSVTIWDCMDIVYYLDCAGHIMLVVMFVV |
Ga0182193_10936551 | 3300017443 | Miscanthus Phyllosphere | VVDVSVYYYEFCSHFPITIWDCMDIVDYLDYVGHVMLIVMFDVVVLCSLDD |
Ga0182193_10953811 | 3300017443 | Miscanthus Phyllosphere | VVDVSMYYYGFCSYFPITIWDCMDIVDHLDYAGHVILIVMFDVVVLCSLDD |
Ga0182193_10962151 | 3300017443 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFRVTIWDCMDIVDYLDCAGHVMLIVMFVMVALRSLDD |
Ga0182193_11251431 | 3300017443 | Miscanthus Phyllosphere | VRDVVGVTMNYYEFCSYFYITIWDCMDIVDYLDYARHVMLIVMFDVVVLCSLDD |
Ga0182193_11285881 | 3300017443 | Miscanthus Phyllosphere | MRVVVDVSMHYYGFCIYFPITIWDCMDIVDYLDYAGHVMLIVMFVVVALCSLDD |
Ga0182193_11475101 | 3300017443 | Miscanthus Phyllosphere | VRVVVDVSMHYYGFCIYFSVTICDCMDIVDSLDCAGHIMLVVMFVVVAFCSFDD |
Ga0182193_11965181 | 3300017443 | Miscanthus Phyllosphere | VVDVSMYYYGFYSHFLITIWDCMDIVDYLDYARHVMLIMMFDVVVLCSL |
Ga0182233_10858511 | 3300017680 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFPVTIWDCMDIVDYLDYAGHVMLVVMFVVVAFCSLDD |
Ga0182233_11149412 | 3300017680 | Miscanthus Phyllosphere | VVHVSMYYYEFCSHFPITIYDCMDIVDYAGHVMLIVMFVVVALCSLDD |
Ga0182226_11100571 | 3300017681 | Miscanthus Phyllosphere | VVVVSMHYYGFCINFYVTIWDCMDIMDYLDCARHVMLVVMFVVVAFHSLD |
Ga0182229_10515092 | 3300017682 | Miscanthus Phyllosphere | VRVAVDVSMHYYGFFIYFPVTIWDCMDIVDYLDCVGHVMLIVMFVVVSLCSLDD |
Ga0182229_10606572 | 3300017682 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCMDIVDYLDCAGHIMLFVMFVVVAFCSLDD |
Ga0182218_11372641 | 3300017683 | Miscanthus Phyllosphere | YFSVTIWDCMDIVDYLDCAGHIMLVVMFVVIAFCSLDD |
Ga0182227_10706282 | 3300017685 | Miscanthus Phyllosphere | VVDVSMYYYRFCSYFPITIWDCMDIVDYLDYAGHVMLIVMFDVVVLCSLDD |
Ga0182227_10801961 | 3300017685 | Miscanthus Phyllosphere | RDVVVVSMHYYGFCIYFSVTIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD |
Ga0182205_10563711 | 3300017686 | Miscanthus Phyllosphere | VVDVSMYYYRFCSHFPVTIWDCMNIVDYLDYAGHVMLIVMFIMVELCSLDD |
Ga0182205_11035431 | 3300017686 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSVTIWDCMDIVDYLDYAGHIMLVVMFIVVAF |
Ga0182205_11100731 | 3300017686 | Miscanthus Phyllosphere | SIYYYGFCSHFSVIIWDYMDIVDYLDYVGHVMLIVMFVVVALCSLDD |
Ga0182205_11600881 | 3300017686 | Miscanthus Phyllosphere | MQYYRFCIYFCITIWDCMDIVDYAVHIMLVVMFVVVAFCSLDD |
Ga0182231_11014042 | 3300017689 | Miscanthus Phyllosphere | VRDVVVVSMHYYGFCIYFSVTIWDCMDIVDYLDYAGHYVGC |
Ga0182231_11066591 | 3300017689 | Miscanthus Phyllosphere | MVDVSMYYYEFCSNFPITIWDCMDIVDYLDYAGHVILIMIFVVVALCSLDD |
Ga0182223_10128911 | 3300017690 | Miscanthus Phyllosphere | VVDVSMHYYGFCIYFPITIWDYMDIVDYLDCAGHVMLIVMFFVVALCSLDD |
Ga0182223_10605832 | 3300017690 | Miscanthus Phyllosphere | VRDLVPVSMHYYGFCIYFSITIWDCMDIVDYLDCAGHIMLVVMFVVVAFCSLDD |
Ga0182223_11077791 | 3300017690 | Miscanthus Phyllosphere | MVDVSMYYYGFCSHFPITIWDCIDIVDYLDYAGHVMLIVMFDVVVLCSLED |
Ga0207687_105172471 | 3300025927 | Miscanthus Rhizosphere | EAVRDVVVVSMHYYGFCIYFSVNIWDCMDIVDYLDYARHIMLVVMFVVVAFCSLDD |
Ga0207677_116705111 | 3300026023 | Miscanthus Rhizosphere | VVDVSMYYYAFCIYFHVTIWDCMNIVDYLDYAGHVMLIVMSVVVALCSLDD |
Ga0207677_119998161 | 3300026023 | Miscanthus Rhizosphere | VVDVSMHYYGFCIYFSKTIWDCTDIVDYLDYAGHVMLIVMFVVVALCSLDD |
Ga0207648_104991081 | 3300026089 | Miscanthus Rhizosphere | VVVVSMHNYGFCIYFSITIWDCMNIVDYLDCAGHIMLVVMFVVVAFCSLDD |
Ga0207648_115532442 | 3300026089 | Miscanthus Rhizosphere | VRDVVVVGMHYYGFCIYFSITIWDCIDIVDYLDCAAHIMLVVMFIVVVFCSLDD |
Ga0207675_1013955423 | 3300026118 | Switchgrass Rhizosphere | MVDVSMHYYGFCIYFSIAIWDYMDCAGHIMLVVMFVVVAFCSLDD |
Ga0207683_106171121 | 3300026121 | Miscanthus Rhizosphere | VRVVVDVSMHYYGFCIYFSVTISDYMDIVDYLNYAGHVMLIVMFDVVVLCSLDD |
⦗Top⦘ |