Basic Information | |
---|---|
Family ID | F032454 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 180 |
Average Sequence Length | 41 residues |
Representative Sequence | VLRAGRNFVVTECEIFNEDGSLAAKALLTFGATAGHSLYK |
Number of Associated Samples | 147 |
Number of Associated Scaffolds | 180 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.56 % |
% of genes near scaffold ends (potentially truncated) | 99.44 % |
% of genes from short scaffolds (< 2000 bps) | 94.44 % |
Associated GOLD sequencing projects | 139 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.444 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.444 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.88% Coil/Unstructured: 69.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 180 Family Scaffolds |
---|---|---|
PF17209 | Hfq | 52.22 |
PF03061 | 4HBT | 5.56 |
PF13177 | DNA_pol3_delta2 | 5.00 |
PF00709 | Adenylsucc_synt | 1.11 |
PF02223 | Thymidylate_kin | 0.56 |
PF12697 | Abhydrolase_6 | 0.56 |
PF12307 | DUF3631 | 0.56 |
PF00557 | Peptidase_M24 | 0.56 |
PF02594 | DUF167 | 0.56 |
PF01168 | Ala_racemase_N | 0.56 |
PF12838 | Fer4_7 | 0.56 |
COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
---|---|---|---|
COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 1.11 |
COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.56 |
COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.44 % |
Unclassified | root | N/A | 0.56 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_79412 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300001593|JGI12635J15846_10159212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1538 | Open in IMG/M |
3300001593|JGI12635J15846_10789181 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300001661|JGI12053J15887_10139606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
3300001867|JGI12627J18819_10167568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
3300003219|JGI26341J46601_10128484 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300003223|JGI26343J46809_1007395 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10089577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
3300004082|Ga0062384_100201187 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300004118|Ga0058886_1327825 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300004136|Ga0058889_1398959 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300004606|Ga0068962_1234513 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300004631|Ga0058899_10045627 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300004635|Ga0062388_102973910 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005332|Ga0066388_105753708 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300005334|Ga0068869_100186103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1630 | Open in IMG/M |
3300005434|Ga0070709_10869594 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300005454|Ga0066687_10835777 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005529|Ga0070741_10509705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
3300005529|Ga0070741_11236206 | Not Available | 628 | Open in IMG/M |
3300005533|Ga0070734_10397065 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300005555|Ga0066692_10394309 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300005561|Ga0066699_10850385 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005575|Ga0066702_10869874 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300005586|Ga0066691_10000175 | All Organisms → cellular organisms → Bacteria | 18196 | Open in IMG/M |
3300005591|Ga0070761_10342536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300005591|Ga0070761_10628477 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300005712|Ga0070764_10133300 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300005718|Ga0068866_10350889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
3300005764|Ga0066903_105085726 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300006163|Ga0070715_10803117 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300006796|Ga0066665_11465261 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300007265|Ga0099794_10604580 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300007788|Ga0099795_10115565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
3300009089|Ga0099828_10514465 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300009089|Ga0099828_10651140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
3300009524|Ga0116225_1410417 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300009824|Ga0116219_10491360 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300010062|Ga0127426_103151 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300010104|Ga0127446_1058858 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300010113|Ga0127444_1057563 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300010321|Ga0134067_10010221 | All Organisms → cellular organisms → Bacteria | 2650 | Open in IMG/M |
3300010359|Ga0126376_11608053 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300010362|Ga0126377_10169379 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
3300010376|Ga0126381_101069528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
3300010858|Ga0126345_1120231 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300010859|Ga0126352_1258719 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300011069|Ga0138592_1010056 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300011080|Ga0138568_1091155 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300011120|Ga0150983_14764099 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300011120|Ga0150983_16442682 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300011269|Ga0137392_11242104 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300011270|Ga0137391_10043742 | All Organisms → cellular organisms → Bacteria | 3801 | Open in IMG/M |
3300012096|Ga0137389_10319061 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300012202|Ga0137363_10703183 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300012203|Ga0137399_10492482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 1028 | Open in IMG/M |
3300012203|Ga0137399_10510930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
3300012203|Ga0137399_10625277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
3300012203|Ga0137399_11408969 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300012357|Ga0137384_11392213 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012361|Ga0137360_11220410 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300012363|Ga0137390_11274892 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300012364|Ga0134027_1020749 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300012364|Ga0134027_1124159 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300012373|Ga0134042_1002549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300012376|Ga0134032_1020911 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300012388|Ga0134031_1185490 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300012399|Ga0134061_1280773 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300012469|Ga0150984_107809768 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300012469|Ga0150984_108282336 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300012685|Ga0137397_10049920 | All Organisms → cellular organisms → Bacteria | 3000 | Open in IMG/M |
3300012918|Ga0137396_10520430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300012923|Ga0137359_10919240 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300012925|Ga0137419_11633947 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300012927|Ga0137416_10746948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
3300012971|Ga0126369_12711897 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300014657|Ga0181522_10778045 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300015051|Ga0137414_1095952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 1113 | Open in IMG/M |
3300015052|Ga0137411_1084393 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300016270|Ga0182036_11262731 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300016294|Ga0182041_11962421 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300017927|Ga0187824_10100028 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300017928|Ga0187806_1230989 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300017933|Ga0187801_10038783 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
3300017973|Ga0187780_10002717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13271 | Open in IMG/M |
3300017975|Ga0187782_10466920 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300018062|Ga0187784_11389546 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300018085|Ga0187772_11350650 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300020140|Ga0179590_1050513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
3300020199|Ga0179592_10204215 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300020581|Ga0210399_10489956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
3300020582|Ga0210395_10201854 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
3300021151|Ga0179584_1177830 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300021171|Ga0210405_10818615 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300021178|Ga0210408_10075239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2644 | Open in IMG/M |
3300021178|Ga0210408_10479248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
3300021180|Ga0210396_10855221 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300021307|Ga0179585_1113544 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300021401|Ga0210393_11362468 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300021406|Ga0210386_10988077 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300021406|Ga0210386_11314071 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300021407|Ga0210383_11459812 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300021560|Ga0126371_13564190 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300021855|Ga0213854_1041957 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300022498|Ga0242644_1037016 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300022500|Ga0242643_124504 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300022508|Ga0222728_1105315 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300022508|Ga0222728_1116756 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300022508|Ga0222728_1124987 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300022522|Ga0242659_1121215 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300022522|Ga0242659_1139331 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300022525|Ga0242656_1099407 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300022528|Ga0242669_1129533 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300022529|Ga0242668_1135955 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300022531|Ga0242660_1187671 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300022531|Ga0242660_1225398 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300022532|Ga0242655_10333557 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300022533|Ga0242662_10282651 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300022721|Ga0242666_1184769 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300022722|Ga0242657_1220683 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300022724|Ga0242665_10286110 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300022724|Ga0242665_10344728 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300022726|Ga0242654_10372360 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300022726|Ga0242654_10385405 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300022726|Ga0242654_10401979 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300022726|Ga0242654_10413385 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300022726|Ga0242654_10442892 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300024288|Ga0179589_10461633 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300025899|Ga0207642_10077592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 1603 | Open in IMG/M |
3300026285|Ga0209438_1073785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
3300026304|Ga0209240_1057134 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
3300026304|Ga0209240_1087245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
3300026309|Ga0209055_1301472 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300026343|Ga0209159_1152853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
3300026499|Ga0257181_1079836 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300026508|Ga0257161_1052749 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300026527|Ga0209059_1156780 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300026527|Ga0209059_1156942 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300026538|Ga0209056_10666573 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300026551|Ga0209648_10009466 | All Organisms → cellular organisms → Bacteria | 8443 | Open in IMG/M |
3300026551|Ga0209648_10143516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1895 | Open in IMG/M |
3300026551|Ga0209648_10502817 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300026551|Ga0209648_10689129 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300027516|Ga0207761_1107960 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300027633|Ga0208988_1170899 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300027651|Ga0209217_1142636 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300027651|Ga0209217_1176989 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300027671|Ga0209588_1229001 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300027826|Ga0209060_10301761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 731 | Open in IMG/M |
3300027846|Ga0209180_10243812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
3300027862|Ga0209701_10066430 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
3300027875|Ga0209283_10280255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
3300027889|Ga0209380_10690622 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300028138|Ga0247684_1061106 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300028800|Ga0265338_10768570 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300029636|Ga0222749_10247604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
3300029701|Ga0222748_1106672 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300030741|Ga0265459_14074364 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300030743|Ga0265461_14008080 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031057|Ga0170834_102743969 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300031057|Ga0170834_104229033 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300031057|Ga0170834_104950543 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300031718|Ga0307474_10015358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5548 | Open in IMG/M |
3300031718|Ga0307474_10566276 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300031740|Ga0307468_100929893 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300031799|Ga0318565_10145881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
3300031823|Ga0307478_10374322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
3300031823|Ga0307478_10376489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
3300031894|Ga0318522_10163493 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300031897|Ga0318520_10970278 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300031942|Ga0310916_11466015 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300032076|Ga0306924_10608768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
3300032174|Ga0307470_10384333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
3300032174|Ga0307470_11364448 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300032180|Ga0307471_101251107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300032205|Ga0307472_100301253 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300032261|Ga0306920_102618578 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300032515|Ga0348332_13355329 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300032515|Ga0348332_14413433 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300032782|Ga0335082_10205667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1867 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.44% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.22% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.78% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.22% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.22% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.22% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.22% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.67% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.11% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.11% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.11% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.11% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.56% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004118 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF208 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004136 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF214 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004606 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010062 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010113 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_01130240 | 2199352025 | Soil | VLRAGRNFIVTGCEIFNESGSLAAKALLTFSAASAHTLAK |
JGI12635J15846_101592121 | 3300001593 | Forest Soil | RVKADARVLRAGRNFVVTECTIWNQNGSLAAKALLTFGAASGHAIHKD* |
JGI12635J15846_107891812 | 3300001593 | Forest Soil | RVLRTGRNFVVTECEIFDRKGRLAAKALLTFGAAGGHSLRG* |
JGI12053J15887_101396061 | 3300001661 | Forest Soil | IKADGRVLRAGTNFVVAECEIFNEDGSLAAKALLTFGAAAGHSIRK* |
JGI12627J18819_101675683 | 3300001867 | Forest Soil | VLRAGRNFIVTECEIFNENGSLAAKALLTFGATAGHSLYK* |
JGI26341J46601_101284841 | 3300003219 | Bog Forest Soil | RVKADARVLRKGRNFIVTECEIFNETGSMAAKALLTFSAAGANTLGK* |
JGI26343J46809_10073953 | 3300003223 | Bog Forest Soil | GRVLRTGRNFVVTECEIYKEDGAMVAKALLTFGAARGHSIAPQ* |
JGIcombinedJ51221_100895773 | 3300003505 | Forest Soil | LRAGRNFVVTECEIFTEDGKLAAKALLTFGAAAGHTIRR* |
Ga0062384_1002011871 | 3300004082 | Bog Forest Soil | LADAKVLRKGRNFIVTECDIFLADGSLAAKAILTFSAAIGQVL* |
Ga0058886_13278252 | 3300004118 | Forest Soil | RVLRAGRNFVVAECEIFNESGSLAAKALLTFGAAAGHSIDR* |
Ga0058889_13989592 | 3300004136 | Forest Soil | EGRVLRTGRNFVVTECEIYKEDGALAAKALLTFGAARGHSIARK* |
Ga0068962_12345131 | 3300004606 | Peatlands Soil | LRAGRNFIVTECEIFNESGSLAAKALLTFSAAAAHTLAK* |
Ga0058899_100456273 | 3300004631 | Forest Soil | VLRAGRNFVVTECEIFTEDGKLAAKALLTFGAAAGHAIRR* |
Ga0062388_1029739101 | 3300004635 | Bog Forest Soil | IKADARVLRAGRNFVVTECEIFNESGSLAAKALLTFGARTGHSLRK* |
Ga0066388_1057537082 | 3300005332 | Tropical Forest Soil | VLRTGRNFVVTECDIFDCAGTMAAKALLTFGAAAGHSLQGN* |
Ga0068869_1001861031 | 3300005334 | Miscanthus Rhizosphere | SVLRTGRNFAVAECELVDSRGKLAAKALLTFGAAGGHSLK* |
Ga0070709_108695942 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ARVLRAGRNFVVVECELIDAQGKLAAKALMTFGAAGGHSLK* |
Ga0066687_108357772 | 3300005454 | Soil | VLRTGRNFVVTECEIFNQKGVMAAKALLTFGAAGGHSLSPA* |
Ga0070741_105097053 | 3300005529 | Surface Soil | RNFVVTECEIWTAEGVLAAKALLTFGAAAGHSLQRG* |
Ga0070741_112362062 | 3300005529 | Surface Soil | AECDIRNEAGSLAAKALLTFGAAAGFSLARAPQDR* |
Ga0070734_103970652 | 3300005533 | Surface Soil | EGRVLRAGRNFVVAECDIRNEGGSLAAKALLTFGAAAGFSLTRALQDR* |
Ga0066692_103943091 | 3300005555 | Soil | DARVLRKGRNFIVTECEIFNETGTLAAKALLTFSAAGGNTLRK* |
Ga0066699_108503851 | 3300005561 | Soil | RADAHVLRAGRNFVVSECEIWNEDKSLAAKALLTFGAAAGHAIQKKQEPPQ* |
Ga0066702_108698742 | 3300005575 | Soil | ATVLRTGRNFVVTECEIFDTTGTLAAKALLTFGAAGGHSLQK* |
Ga0066691_1000017519 | 3300005586 | Soil | RVLRAGRNFVVTECEIFNESGSLAAKALLTFGATAGHSLYK* |
Ga0070761_103425363 | 3300005591 | Soil | AGRNFVVTECEIYKEDGTLAAKALLTFGAARGHSMEAR* |
Ga0070761_106284771 | 3300005591 | Soil | NGRNFIVTECEIFNESGSLAAKALLTFSAAAGHSLRK* |
Ga0070764_101333003 | 3300005712 | Soil | GKVLRTGRNFVVTECEIYKEDGTLAAKALLTFGAARGHSISTQ* |
Ga0068866_103508893 | 3300005718 | Miscanthus Rhizosphere | TGRNFAVAECELVDSRGKLAAKALLTFGAAGGHSLK* |
Ga0066903_1050857263 | 3300005764 | Tropical Forest Soil | RNFVVAECEILNEDRSLAAKALLTFGAAAGHSIRK* |
Ga0070715_108031172 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RAGRNFVVTECEIYNEGGSLAAKALLTFGATAGHALHK* |
Ga0066665_114652612 | 3300006796 | Soil | IKADARVLRAGRNFVVTECEIFNENGSLAAKALLTFGATAGHSLYK* |
Ga0099794_106045801 | 3300007265 | Vadose Zone Soil | ARVLRKGRNFIVAECEIFNETGTLAAKALLTFSAAGANTLGK* |
Ga0099795_101155651 | 3300007788 | Vadose Zone Soil | NFVVTECEIFNEDGSLAAKALLTFGAAAGHSLYK* |
Ga0099828_105144651 | 3300009089 | Vadose Zone Soil | EARVLRAGRNFIVSECDIFNDEGKLAAKALMTFSAAQGYKLAK* |
Ga0099828_106511403 | 3300009089 | Vadose Zone Soil | DARVLRTGRNFVVAECEIVNEDGSLAAKALLTFGAVAGHSMQQ* |
Ga0116225_14104171 | 3300009524 | Peatlands Soil | KVLRAGRNFIVTECDIFNETGSLAAKAILTFSAAAGHILKK* |
Ga0116219_104913601 | 3300009824 | Peatlands Soil | RSGRNFIVTECEIFNETGSLAAKALLTFSAAAGHILKK* |
Ga0127426_1031511 | 3300010062 | Grasslands Soil | GRIKADARVLRAGRNFVVTECEIFNEAGSLAAKALLTFGATAGHSLYK* |
Ga0127446_10588582 | 3300010104 | Grasslands Soil | GRNFIVTECEIFNENGSLAAKALLTFGATAGHSLYK* |
Ga0127444_10575632 | 3300010113 | Grasslands Soil | SEARVLRAGRNFVVTECEIWNEDKSMAAKALLTFGAAAGHSIHE* |
Ga0134067_100102211 | 3300010321 | Grasslands Soil | RNFVVTECEIWNEDKSMAAKALLTFGAAAGHSIHE* |
Ga0126376_116080531 | 3300010359 | Tropical Forest Soil | RKGRNFIVAECEIFNEDGSLAAKSLLTFSAARGNTLQK* |
Ga0126377_101693794 | 3300010362 | Tropical Forest Soil | RAGRNFVVTECEVFDGRGTLSAKALLTFGAAAGHTMERAANSRQ* |
Ga0126381_1010695283 | 3300010376 | Tropical Forest Soil | FVVSECEIWNEDKSLAAKALLTFGAAAGHSIEDQPQ* |
Ga0126345_11202312 | 3300010858 | Boreal Forest Soil | ARVLRKGRNFIVTECEIFNETGTLAAKALLTFSAAGGDTLRK* |
Ga0126352_12587192 | 3300010859 | Boreal Forest Soil | GRVLRTGRNFVVTECEIRNQNGSLAAKALLTFGAMSGQSFER* |
Ga0138592_10100561 | 3300011069 | Peatlands Soil | SGRNFIVAECEIFNETGTLAAKALLTFSAASDSILKK* |
Ga0138568_10911552 | 3300011080 | Peatlands Soil | LRAGRNFVVTECEIFNEDGSLAAKALLTFGARSGHSLHK* |
Ga0150983_147640991 | 3300011120 | Forest Soil | DARILRTGRNFVVAECEIFDGKGTLAAKALLTYGAAGGHALQK* |
Ga0150983_164426822 | 3300011120 | Forest Soil | VLRAGRNFIVTECEIFNETGSLAAKALLTFSAAATHTLAK* |
Ga0137392_112421042 | 3300011269 | Vadose Zone Soil | LRAGRNFIVTECDIFTAEGKLAAKALMTFSAAQGYKLAK* |
Ga0137391_100437421 | 3300011270 | Vadose Zone Soil | NFVVTECEIFNRKGALAAKALLTFGAAGGHSLQR* |
Ga0137389_103190611 | 3300012096 | Vadose Zone Soil | AGRNFVVTECEIFNENGSLAAKALLTFGATAGHSLSK* |
Ga0137363_107031833 | 3300012202 | Vadose Zone Soil | GRIKADGSVLRAGRNFVVAECEIFNEDGSLAAKALLTFGAAAGHAIRK* |
Ga0137399_104924821 | 3300012203 | Vadose Zone Soil | NFIVAECEIFNETGTLAAKALMTFSAAGGNTLRK* |
Ga0137399_105109303 | 3300012203 | Vadose Zone Soil | GRNFVVTECEIFDQKGRLAAKALLTFGAAGGHSLQR* |
Ga0137399_106252773 | 3300012203 | Vadose Zone Soil | PGGRIKADGRVLRAGRNFVAAECEIFNEDGSLAAKALLTFGAAAGHSIRK* |
Ga0137399_114089692 | 3300012203 | Vadose Zone Soil | LRKGRNFIVAECEIFNETGTLAAKALMTFSAAGGNTLGK* |
Ga0137384_113922131 | 3300012357 | Vadose Zone Soil | NFVVAECEIWNEDRSLAAKALLTFGAAAGHSMGDKRF* |
Ga0137360_112204102 | 3300012361 | Vadose Zone Soil | AGRNFVVTECEIFNEDGSLAAKALLTFGATAGHSLYK* |
Ga0137390_112748923 | 3300012363 | Vadose Zone Soil | RNFVVTECEIFNENGSLAAKALLTFGAKSGHSLHK* |
Ga0134027_10207492 | 3300012364 | Grasslands Soil | GRIKADARVLRAGRNFIVPECEIFNENGSLAAKALLTFGATAGHSLYK* |
Ga0134027_11241592 | 3300012364 | Grasslands Soil | VLRAGRNFVVTECEIFNEDGSLAAKALLTFGATAGHSLYK* |
Ga0134042_10025493 | 3300012373 | Grasslands Soil | RNFIVTECEIFNENGSLAAKALLTFGATAGHSLYK* |
Ga0134032_10209111 | 3300012376 | Grasslands Soil | NFIVTECEIFNENGSLAAKALLTFGATAGHSLYK* |
Ga0134031_11854901 | 3300012388 | Grasslands Soil | GRNFIVTECEIFNEDGSLAAKALLTFGAAAGHSLYK* |
Ga0134061_12807734 | 3300012399 | Grasslands Soil | AGRNFVVAECEIWNEDKSLAAKALLTFGAAAGHSIQE* |
Ga0150984_1078097681 | 3300012469 | Avena Fatua Rhizosphere | DAHVLRTGRNFVVTECDIFDRKGSLAAKALLTFGAAGGHSLQK* |
Ga0150984_1082823362 | 3300012469 | Avena Fatua Rhizosphere | ADARVLRTGRNFVVCECEILDKKGTLAAKALLTFGAAGGHSLEK* |
Ga0137397_100499201 | 3300012685 | Vadose Zone Soil | NFVVTECEIFNQNGSLAAKALLTFGAKAGHSLHK* |
Ga0137396_105204301 | 3300012918 | Vadose Zone Soil | NFVVTECEIFNEDGSLAAKALLTFGATAGHSLYK* |
Ga0137359_109192403 | 3300012923 | Vadose Zone Soil | DARVLRAGRNFIVTECEIFNEDGSLAAKALLTFGATAGHSLYK* |
Ga0137419_116339472 | 3300012925 | Vadose Zone Soil | RAGRNFVVTECEIFNEDGSLAAKALLTFGATAGHSLYK* |
Ga0137416_107469481 | 3300012927 | Vadose Zone Soil | RNFVVAECEIFNEDGSLAAKALLTFGAAAGHSIRK* |
Ga0126369_127118972 | 3300012971 | Tropical Forest Soil | RVLRAGRNFVVAECEILNEDQSLAAKALLTFGAATGHSIREQQE* |
Ga0181522_107780453 | 3300014657 | Bog | NFIVTECEIFNESGSLAAKALLTFSAAAGHTIGK* |
Ga0137414_10959521 | 3300015051 | Vadose Zone Soil | NFIVAECEIFNETGTLAAKALMTFSAAGGNTLGK* |
Ga0137411_10843932 | 3300015052 | Vadose Zone Soil | VLRAGRNFVVTECEIFNQNGSLAAKALLTFGAKAGHSLHK* |
Ga0182036_112627311 | 3300016270 | Soil | RNFIVTECDIFNESGSLAAKALLTFSAASAHTLAK |
Ga0182041_119624212 | 3300016294 | Soil | RAGRNFIVTECEIFNESGSLAAKALLTFSAAAAHTLAK |
Ga0187824_101000281 | 3300017927 | Freshwater Sediment | NFVVTECEIYKEDGTMAAKALLTFGAARGHSIAPQ |
Ga0187806_12309892 | 3300017928 | Freshwater Sediment | GRNFIVTECEILNEDGSLAAKALLTFGAASGHSIEK |
Ga0187801_100387833 | 3300017933 | Freshwater Sediment | VLRSGRNFVVTECEIYNESGSMAAKALLTFSAAAGHNLRK |
Ga0187780_1000271720 | 3300017973 | Tropical Peatland | LRAGRNFVVTECEIYNESGSMAAKALLTFGAAAGHSMKD |
Ga0187782_104669201 | 3300017975 | Tropical Peatland | RVLRAGRNFVVTECEIFNESGSMAAKALLTFGAAAGHSMG |
Ga0187784_113895462 | 3300018062 | Tropical Peatland | RSGRNFIVTECEIYNESGAMAAKALLTFSAAAGHTMRG |
Ga0187772_113506501 | 3300018085 | Tropical Peatland | TGRNFIVTECEIFNESGSLAAKALLTFSAAGGYAIRK |
Ga0179590_10505133 | 3300020140 | Vadose Zone Soil | RVLRKGRNFIVTECEIFNETGTLAAKALLTFSAAGGNTLRK |
Ga0179592_102042153 | 3300020199 | Vadose Zone Soil | HKIAEAHVLRTGRNFVVTECEVFDRKGTLAAKALLTFGAAGGHSLAK |
Ga0210399_104899561 | 3300020581 | Soil | LRTGRNFVVTECEIYKEDGSLAAKALLTFGAARGHSIARK |
Ga0210395_102018543 | 3300020582 | Soil | RVLRAGRNFVVTECEILTGDGKLAAKALLTFGAAAKNSMEV |
Ga0179584_11778302 | 3300021151 | Vadose Zone Soil | AGRNFVVTECEIFNESGSLAAKALLTFGATAGHSLYK |
Ga0210405_108186151 | 3300021171 | Soil | ADAQVLRKGRNFIVTECEIFNETGSLAAKALLTFSAAGGNTLRK |
Ga0210408_100752395 | 3300021178 | Soil | VGRNSVVAECEIRIQNGSLAAKALLTFGAAVGHTLGK |
Ga0210408_104792481 | 3300021178 | Soil | RVLRKGRNFIVTECEIFNETGSLAAKALLTFSAAGGNTLRK |
Ga0210396_108552211 | 3300021180 | Soil | GGTIKADARVLRGGRNFIVTECEIFNESGSLAAKALLTFSAAAGHNLGP |
Ga0179585_11135442 | 3300021307 | Vadose Zone Soil | VLRAGRNFVVTECEIFNEDGSLAAKALLTFGATAGHSLYK |
Ga0210393_113624682 | 3300021401 | Soil | RTGRNFGVTECEIYKEDGTLAAKALLTFGAARGHSIARK |
Ga0210386_109880771 | 3300021406 | Soil | LRTGRNFVVTECEIFDRKGRLAAKALLTFGAAGGHSLQG |
Ga0210386_113140711 | 3300021406 | Soil | PVPGGRIKAEGRVLRGGRNFIATECEIFNESGSLAAKALLTFSAAAGHTLKK |
Ga0210383_114598122 | 3300021407 | Soil | EGKVLRTGRNFVVTECEIYKEDGTMAAKALLTFGAARGHSIAPR |
Ga0126371_135641902 | 3300021560 | Tropical Forest Soil | RNFIVTECEIFNEDGSLAAKSLLTFSAARGNTLHK |
Ga0213854_10419571 | 3300021855 | Watersheds | KADARVLRAGRNFVVTECEIFNENGSLAAKALLTFGAKGGHSLSK |
Ga0242644_10370162 | 3300022498 | Soil | VKADARVLRKGRNFIVTECEIYNESGTMAAKALLTFSAAGGNTLRK |
Ga0242643_1245042 | 3300022500 | Soil | RVLRKGRNFIVTECEIYNESGTMAAKALLTFSAAGGNTLRK |
Ga0222728_11053152 | 3300022508 | Soil | RVLRKGRNFIVTECEIFNETGALAAKALLTFSAAGGNTLRR |
Ga0222728_11167562 | 3300022508 | Soil | RVLRKGRNFIVTECEIFNETGTLAAKALLTFSAAGANTLGK |
Ga0222728_11249871 | 3300022508 | Soil | GRVLRTGRNFVVTECEIYKEDGSLAAKALLTFGAARGHSIARK |
Ga0242659_11212152 | 3300022522 | Soil | RNFVVTECEIYKEDGAMAAKALLTFGAARGHSIAPK |
Ga0242659_11393311 | 3300022522 | Soil | ARVLRTGRNFVVTECEIYKEDGTLAAKALLTFGAARGHSIARK |
Ga0242656_10994072 | 3300022525 | Soil | RNFVVTECEIFDRKGRLAAKALLTFGAAGGHSFQG |
Ga0242669_11295332 | 3300022528 | Soil | RNFIVTECEIYNESGTMAAKALLTFSAAGGNTLRK |
Ga0242668_11359552 | 3300022529 | Soil | RNFVVTECEIYKEDGKMAAKALLTFGAARGHSIAPR |
Ga0242660_11876711 | 3300022531 | Soil | HVLRTGRNFVVAECEIFDRKGRLAAKALLTFGAASGHSLQG |
Ga0242660_12253982 | 3300022531 | Soil | AGGRIRAEARVLRSGRNFVVTECEIFDRKRTPAAKALLTFGAAGGHSLQK |
Ga0242655_103335571 | 3300022532 | Soil | AEARVLRSGRNFVVTECEIFDRKRTLAAKALLTFGAAGGHSLQK |
Ga0242662_102826511 | 3300022533 | Soil | RTGRNFVVTECEIYNESGEMAAKALLTFGATAGHSLEKT |
Ga0242666_11847691 | 3300022721 | Soil | RVLRKGRNFIVAECEIFNETGTLAAKALLTFSAAGGNTLRT |
Ga0242657_12206831 | 3300022722 | Soil | RNFVVTECEIYKEDGTLAAKALLTFGAARGHSITRK |
Ga0242665_102861102 | 3300022724 | Soil | KAEGRVLRTGRNFVVTECEIYKEDGAMAAKALLTFGAARGHSIAPK |
Ga0242665_103447281 | 3300022724 | Soil | RVLRKGRNFIVTECEIFNESGTMAAKALLTFSAAGGNTLRK |
Ga0242654_103723602 | 3300022726 | Soil | ARVLRKGRNFIVTECEIFNETGTLAAKALLTFSAAGGNTLRK |
Ga0242654_103854052 | 3300022726 | Soil | ADARVLRAGRNFIVTECEIFNENGSLAAKALLTFGATAGHSLYK |
Ga0242654_104019792 | 3300022726 | Soil | AEGRVLRTGRNFVVTECEIRNQNGSLAAKALLTFGAMSGQSFER |
Ga0242654_104133852 | 3300022726 | Soil | VLRKGRNFIVTECEIFNETGTLAAKALLTFSAAGGNTLRK |
Ga0242654_104428922 | 3300022726 | Soil | RVLRTGRNFVVTECEIYKEDGTLAAKALLTFGAARGHSITQK |
Ga0179589_104616332 | 3300024288 | Vadose Zone Soil | KADARVLRKGRNFIVTECEIFNETGTLAAKAMLTFSAAGGNTLRK |
Ga0207642_100775923 | 3300025899 | Miscanthus Rhizosphere | SVLRTGRNFAVAECELVDSRGKLAAKALLTFGAAGGHSLK |
Ga0209438_10737851 | 3300026285 | Grasslands Soil | GRNFVVTECEVFDRKGTLAAKALLTFGAAGGHSLAK |
Ga0209240_10571341 | 3300026304 | Grasslands Soil | LRAGRNFVVTECEIFNARGGLAAKALLTFGAAGGHSIDHADYLREK |
Ga0209240_10872451 | 3300026304 | Grasslands Soil | RVLRAGRNFVVAECEIRNEDKSLAAKALLTFGAAAGHSMGDKLF |
Ga0209055_13014722 | 3300026309 | Soil | SECEIWNEDKSLAAKALLTFGAAAGHAIQQKQEPPQ |
Ga0209159_11528533 | 3300026343 | Soil | ARVLRAGRNFVVAECEIWNEDKSLAAKALLTFGAAAGHSIQE |
Ga0257181_10798361 | 3300026499 | Soil | ADGRVLRAGRNFVVAECEIFNEDGSLAAKALLTFGAAAGHSIQK |
Ga0257161_10527493 | 3300026508 | Soil | RAGRNFVVTECEIFNEDGSLAAKALLTFGATAGHSLYK |
Ga0209059_11567801 | 3300026527 | Soil | NFVVSECEIWNEDKSLAAKALLTFGAAAGHAIQQKQEPPQ |
Ga0209059_11569423 | 3300026527 | Soil | NFVVSECEIWNEDKSLAAKALLTFGAAAGHAIQKKQEPPQ |
Ga0209056_106665731 | 3300026538 | Soil | IKADARVLRAGRNFVVTECEIFNENGSLAAKALLTFGATAGHSLYK |
Ga0209648_100094661 | 3300026551 | Grasslands Soil | IKADARVLRAGRNFVVTECEIFNENGSLAAKALLTFGATAGHSLSK |
Ga0209648_101435161 | 3300026551 | Grasslands Soil | KADARVLRKGRNFIVAECEIFNETGALAAKALMTFSAAGGNTLGK |
Ga0209648_105028171 | 3300026551 | Grasslands Soil | ARVLRAGRNFIVAECEIFNEDGSLAAKSLLTFGATAGHSLYK |
Ga0209648_106891292 | 3300026551 | Grasslands Soil | VLRAGRNFVVTECDIFNEGGSLAAKALLTFGATAGHSLQK |
Ga0207761_11079601 | 3300027516 | Tropical Forest Soil | KAEARVLRSGRNFIVSECEIFNESGSLAAKALMTFSAAAGYTISKK |
Ga0208988_11708991 | 3300027633 | Forest Soil | TGRNFVVTECEIFDRKGMLAAKALLTFGAAGGYSLQR |
Ga0209217_11426362 | 3300027651 | Forest Soil | LRTGRNFVVTECDIFDGKGLLAAKALLTFGAASGHSLEK |
Ga0209217_11769891 | 3300027651 | Forest Soil | TGRNFVVTECEIFDRKGALAAKALLTFGAAGGHSLQK |
Ga0209588_12290012 | 3300027671 | Vadose Zone Soil | VLRTGRNFVVTECEVFDHKGALAAKALLTFGAAGGHSLQK |
Ga0209060_103017612 | 3300027826 | Surface Soil | EGRVLRAGRNFVVAECDIRNEGGSLAAKALLTFGAAAGFSLTRALQDR |
Ga0209180_102438121 | 3300027846 | Vadose Zone Soil | DARVLRVGRNFVVAECKIRTEEGSLAAKALLTFGAAVGHTLRK |
Ga0209701_100664304 | 3300027862 | Vadose Zone Soil | DARVLRAGRNFVVTECEIFNENGSLAAKALLTFGATAGHSLSK |
Ga0209283_102802553 | 3300027875 | Vadose Zone Soil | DARVLRAGRNFVVTECEIFNEDGSLAAKALLTFGAKSGHSLRK |
Ga0209380_106906221 | 3300027889 | Soil | GRNFVVTECEIYKEDGTLAAKALLTFGAARGHSIARK |
Ga0247684_10611061 | 3300028138 | Soil | KAEGKVLRAGRNFVVTECEVFNARGGLAAKALLTFGAAGGHSIDRAADVAEN |
Ga0265338_107685701 | 3300028800 | Rhizosphere | AEGKVLRTGRNFVVTECEIYLEDGTLAAKALLTFGAARGHSIEAR |
Ga0222749_102476043 | 3300029636 | Soil | RVLRSGRNFVVTECEIFDRKRTLAAKALLTFGAAGGHSLQK |
Ga0222748_11066721 | 3300029701 | Soil | RNFVVTECEIYKEDGTLAAKALLTFGAARGHSISPQ |
Ga0265459_140743641 | 3300030741 | Soil | RNFVVAECEIWNADGSLAAKSLLTFGAAAGHSIRN |
Ga0265461_140080801 | 3300030743 | Soil | TGRNFVVTECEIYKEDGTLAAKALLTFGAARGHSITRK |
Ga0170834_1027439692 | 3300031057 | Forest Soil | RNFVVTECEIYKEDGTMAAKALLTFGAARGHSISPQ |
Ga0170834_1042290331 | 3300031057 | Forest Soil | WLLDFSSRYYARVLRKGRNFIVTECEIFNETGTLAAKAMLTFSAAGGNTLRK |
Ga0170834_1049505432 | 3300031057 | Forest Soil | FVHFLVFIFICVKADARVLRKGRNFIVTECEIFNETGTLAAKALLTFSAAGANTLRK |
Ga0307474_100153589 | 3300031718 | Hardwood Forest Soil | HVLRTGRNFVVTECDIFDRQGALAAKALLTYGAAGGHSLRK |
Ga0307474_105662763 | 3300031718 | Hardwood Forest Soil | EGRVLRTGRNFVVTECEIRNQDESLAAKALLTFGAMSGQSFSAKK |
Ga0307468_1009298931 | 3300031740 | Hardwood Forest Soil | DARVLRKGRNFIVTECEIFNETGTLAAKALLTFSAAGNTLRK |
Ga0318565_101458811 | 3300031799 | Soil | RNFVVAECEVWNEDNSLAAKALLTFGAAAGHSLHKQQE |
Ga0307478_103743223 | 3300031823 | Hardwood Forest Soil | VKADARVLRKGRNFIVTECEIFNETGSLAAKALLTFSAAGDNTLRK |
Ga0307478_103764891 | 3300031823 | Hardwood Forest Soil | GRIRAIARVLRAGRNFVVTECEILRSDGTLAAKALLTFGAAVKHSLGG |
Ga0318522_101634933 | 3300031894 | Soil | VLRAGRNFIVTECDIFNESGSLAAKALLTFSAATGHAIRK |
Ga0318520_109702781 | 3300031897 | Soil | LRVGRNFIVTECDIFNQSGSLAAKALLTFSAAAGHTIRK |
Ga0310916_114660151 | 3300031942 | Soil | KADARVLRVGRNFVVAECEVFNESGSLAAKALLTFSAAAGHSIRR |
Ga0306924_106087683 | 3300032076 | Soil | LRKGRNFIVTECEILNEDGSMAAKALLTFSAARGSSMG |
Ga0307470_103843331 | 3300032174 | Hardwood Forest Soil | VLRKGRNFIVAECEIFNETGTLAAKALLTFSAAGGNTLGK |
Ga0307470_113644482 | 3300032174 | Hardwood Forest Soil | TGRNFVVTECEVFDRKGTLAAKALLTFGAAGGHSLA |
Ga0307471_1012511071 | 3300032180 | Hardwood Forest Soil | GRIKADGRVLRAGRNFVVAECEILNEDGSLAAKALLTFGAAAGHSIHK |
Ga0307472_1003012533 | 3300032205 | Hardwood Forest Soil | DARGLRAGRNFIVTECEIFNENGSLAAKALLTFGATARHSLYK |
Ga0306920_1026185781 | 3300032261 | Soil | RAGRNFVVAECEILNEDQSLAAKALLTFGAAAGHSIQE |
Ga0348332_133553291 | 3300032515 | Plant Litter | TAEAWVLRNGRNFVVTECDIFNESGSLAAKALLTFTAAAGHKMEK |
Ga0348332_144134331 | 3300032515 | Plant Litter | AEGRVLRTGRNFVVTECEIFKEDGSMAAKALLTFGAARGHSIVRQ |
Ga0335082_102056674 | 3300032782 | Soil | KAEARVLRSGRNFIVTECEIFNESGSMAAKALMTFSAARGHALPKR |
⦗Top⦘ |