Basic Information | |
---|---|
Family ID | F032181 |
Family Type | Metagenome |
Number of Sequences | 180 |
Average Sequence Length | 43 residues |
Representative Sequence | MVSNVLEMDQEELVKLLKSFKKKYAGDPEWDEIRAGFPKSWPI |
Number of Associated Samples | 146 |
Number of Associated Scaffolds | 180 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 86.67 % |
% of genes near scaffold ends (potentially truncated) | 16.11 % |
% of genes from short scaffolds (< 2000 bps) | 77.78 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.889 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.556 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.111 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 180 Family Scaffolds |
---|---|---|
PF04237 | YjbR | 47.78 |
PF14518 | Haem_oxygenas_2 | 8.33 |
PF00583 | Acetyltransf_1 | 6.67 |
PF00296 | Bac_luciferase | 5.56 |
PF00890 | FAD_binding_2 | 1.11 |
PF07992 | Pyr_redox_2 | 0.56 |
PF05532 | CsbD | 0.56 |
PF13673 | Acetyltransf_10 | 0.56 |
PF13304 | AAA_21 | 0.56 |
PF13699 | DUF4157 | 0.56 |
PF00216 | Bac_DNA_binding | 0.56 |
COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
---|---|---|---|
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 47.78 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 5.56 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.56 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.89 % |
Unclassified | root | N/A | 1.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c2412762 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
3300000881|JGI10215J12807_1399678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 614 | Open in IMG/M |
3300000956|JGI10216J12902_111029780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 625 | Open in IMG/M |
3300001164|JGI11823J13286_1006365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 819 | Open in IMG/M |
3300001661|JGI12053J15887_10132519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1324 | Open in IMG/M |
3300001661|JGI12053J15887_10489193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
3300002907|JGI25613J43889_10067964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 970 | Open in IMG/M |
3300004463|Ga0063356_106170571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
3300005166|Ga0066674_10169271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1035 | Open in IMG/M |
3300005172|Ga0066683_10662610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
3300005181|Ga0066678_10103339 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
3300005293|Ga0065715_10003774 | All Organisms → cellular organisms → Bacteria | 6958 | Open in IMG/M |
3300005294|Ga0065705_10323663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 938 | Open in IMG/M |
3300005328|Ga0070676_10209107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1283 | Open in IMG/M |
3300005334|Ga0068869_101044922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 713 | Open in IMG/M |
3300005344|Ga0070661_101518991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 565 | Open in IMG/M |
3300005444|Ga0070694_101260654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 621 | Open in IMG/M |
3300005445|Ga0070708_100063717 | All Organisms → cellular organisms → Bacteria | 3301 | Open in IMG/M |
3300005446|Ga0066686_10058798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2372 | Open in IMG/M |
3300005450|Ga0066682_10237965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1171 | Open in IMG/M |
3300005467|Ga0070706_100005220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 12393 | Open in IMG/M |
3300005468|Ga0070707_100643698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1023 | Open in IMG/M |
3300005518|Ga0070699_100401280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1240 | Open in IMG/M |
3300005518|Ga0070699_101185318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 701 | Open in IMG/M |
3300005518|Ga0070699_101437312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 632 | Open in IMG/M |
3300005539|Ga0068853_101255654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 716 | Open in IMG/M |
3300005552|Ga0066701_10270603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1052 | Open in IMG/M |
3300005558|Ga0066698_10925305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 557 | Open in IMG/M |
3300005559|Ga0066700_10159864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1533 | Open in IMG/M |
3300005568|Ga0066703_10068623 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
3300005577|Ga0068857_100051342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3658 | Open in IMG/M |
3300005843|Ga0068860_100269006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1663 | Open in IMG/M |
3300006049|Ga0075417_10006971 | All Organisms → cellular organisms → Bacteria | 3963 | Open in IMG/M |
3300006049|Ga0075417_10288562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 794 | Open in IMG/M |
3300006846|Ga0075430_101268563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
3300006852|Ga0075433_10088290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2739 | Open in IMG/M |
3300006852|Ga0075433_10151028 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
3300006852|Ga0075433_11638908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 554 | Open in IMG/M |
3300006871|Ga0075434_100235299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1852 | Open in IMG/M |
3300006876|Ga0079217_10011404 | All Organisms → cellular organisms → Bacteria | 2873 | Open in IMG/M |
3300006876|Ga0079217_10412139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 803 | Open in IMG/M |
3300006881|Ga0068865_101475710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 609 | Open in IMG/M |
3300006894|Ga0079215_10020712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2205 | Open in IMG/M |
3300006894|Ga0079215_10694011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 687 | Open in IMG/M |
3300006904|Ga0075424_100178399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2253 | Open in IMG/M |
3300007004|Ga0079218_10461990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
3300007004|Ga0079218_13888917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
3300007255|Ga0099791_10159311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1056 | Open in IMG/M |
3300007265|Ga0099794_10422479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 697 | Open in IMG/M |
3300009012|Ga0066710_100356158 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
3300009038|Ga0099829_11393126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
3300009088|Ga0099830_10962318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 706 | Open in IMG/M |
3300009089|Ga0099828_10037219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3964 | Open in IMG/M |
3300009089|Ga0099828_10184586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1857 | Open in IMG/M |
3300009090|Ga0099827_10005474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7632 | Open in IMG/M |
3300009098|Ga0105245_13286121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
3300009156|Ga0111538_10665862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1319 | Open in IMG/M |
3300009174|Ga0105241_11262501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 702 | Open in IMG/M |
3300009801|Ga0105056_1073560 | Not Available | 511 | Open in IMG/M |
3300009811|Ga0105084_1106843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
3300010304|Ga0134088_10442277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 637 | Open in IMG/M |
3300010320|Ga0134109_10267358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
3300010323|Ga0134086_10138555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 882 | Open in IMG/M |
3300010333|Ga0134080_10516040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
3300010336|Ga0134071_10475368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 643 | Open in IMG/M |
3300010400|Ga0134122_10915596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 850 | Open in IMG/M |
3300011119|Ga0105246_12301358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
3300011270|Ga0137391_10423526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1135 | Open in IMG/M |
3300011270|Ga0137391_10620475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 905 | Open in IMG/M |
3300012096|Ga0137389_10322700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1310 | Open in IMG/M |
3300012198|Ga0137364_10099620 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
3300012202|Ga0137363_10250412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1439 | Open in IMG/M |
3300012203|Ga0137399_10216233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1561 | Open in IMG/M |
3300012203|Ga0137399_10532052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 987 | Open in IMG/M |
3300012204|Ga0137374_10002167 | All Organisms → cellular organisms → Bacteria | 23057 | Open in IMG/M |
3300012204|Ga0137374_10054096 | All Organisms → cellular organisms → Bacteria | 4100 | Open in IMG/M |
3300012204|Ga0137374_10112704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2527 | Open in IMG/M |
3300012204|Ga0137374_11271205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
3300012206|Ga0137380_10241422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1630 | Open in IMG/M |
3300012206|Ga0137380_10875056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 773 | Open in IMG/M |
3300012207|Ga0137381_10815267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 809 | Open in IMG/M |
3300012207|Ga0137381_11013079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 716 | Open in IMG/M |
3300012350|Ga0137372_11162352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
3300012351|Ga0137386_10766393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 693 | Open in IMG/M |
3300012355|Ga0137369_10059516 | All Organisms → cellular organisms → Bacteria | 3289 | Open in IMG/M |
3300012355|Ga0137369_10249946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1341 | Open in IMG/M |
3300012358|Ga0137368_10706154 | Not Available | 633 | Open in IMG/M |
3300012359|Ga0137385_10315698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1342 | Open in IMG/M |
3300012362|Ga0137361_10553704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1055 | Open in IMG/M |
3300012532|Ga0137373_10076204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3007 | Open in IMG/M |
3300012685|Ga0137397_10218347 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300012918|Ga0137396_10294616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1199 | Open in IMG/M |
3300012918|Ga0137396_10668834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 767 | Open in IMG/M |
3300012922|Ga0137394_10482610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1053 | Open in IMG/M |
3300012930|Ga0137407_11107011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 751 | Open in IMG/M |
3300012944|Ga0137410_11475149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
3300012944|Ga0137410_11475224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 593 | Open in IMG/M |
3300013297|Ga0157378_12660606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
3300014154|Ga0134075_10021055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2596 | Open in IMG/M |
3300014965|Ga0120193_10095587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
3300015241|Ga0137418_11211484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
3300015251|Ga0180070_1052885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 558 | Open in IMG/M |
3300015358|Ga0134089_10026169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2028 | Open in IMG/M |
3300015373|Ga0132257_103665842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 559 | Open in IMG/M |
3300015374|Ga0132255_102993352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 721 | Open in IMG/M |
3300017659|Ga0134083_10191980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 840 | Open in IMG/M |
3300017997|Ga0184610_1021210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1751 | Open in IMG/M |
3300017997|Ga0184610_1078244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1021 | Open in IMG/M |
3300018000|Ga0184604_10009931 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
3300018027|Ga0184605_10053755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1718 | Open in IMG/M |
3300018027|Ga0184605_10449622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
3300018028|Ga0184608_10015815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2661 | Open in IMG/M |
3300018031|Ga0184634_10250432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 812 | Open in IMG/M |
3300018052|Ga0184638_1163301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 799 | Open in IMG/M |
3300018052|Ga0184638_1227186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 651 | Open in IMG/M |
3300018056|Ga0184623_10021007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2895 | Open in IMG/M |
3300018063|Ga0184637_10237530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1113 | Open in IMG/M |
3300018071|Ga0184618_10011746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2667 | Open in IMG/M |
3300018071|Ga0184618_10051019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1504 | Open in IMG/M |
3300018074|Ga0184640_10063848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1546 | Open in IMG/M |
3300018076|Ga0184609_10052042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1751 | Open in IMG/M |
3300018076|Ga0184609_10297696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 754 | Open in IMG/M |
3300018429|Ga0190272_11471891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 690 | Open in IMG/M |
3300018431|Ga0066655_10288011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1065 | Open in IMG/M |
3300018431|Ga0066655_10507217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 800 | Open in IMG/M |
3300018433|Ga0066667_10063569 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
3300019878|Ga0193715_1046477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 934 | Open in IMG/M |
3300019998|Ga0193710_1032878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
3300021080|Ga0210382_10159167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 970 | Open in IMG/M |
3300021363|Ga0193699_10283459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 691 | Open in IMG/M |
3300022694|Ga0222623_10245560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 691 | Open in IMG/M |
3300025885|Ga0207653_10000793 | All Organisms → cellular organisms → Bacteria | 10639 | Open in IMG/M |
3300025885|Ga0207653_10040889 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
3300025907|Ga0207645_10190131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1349 | Open in IMG/M |
3300025908|Ga0207643_10458701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 811 | Open in IMG/M |
3300025910|Ga0207684_10000041 | All Organisms → cellular organisms → Bacteria | 262530 | Open in IMG/M |
3300025910|Ga0207684_10046291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Merismopediaceae → Synechocystis → unclassified Synechocystis → Synechocystis sp. PCC 7509 | 3690 | Open in IMG/M |
3300025910|Ga0207684_10374836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1224 | Open in IMG/M |
3300025910|Ga0207684_11085530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 667 | Open in IMG/M |
3300025919|Ga0207657_10331634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1202 | Open in IMG/M |
3300025922|Ga0207646_11206200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 663 | Open in IMG/M |
3300025922|Ga0207646_11238047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 653 | Open in IMG/M |
3300025923|Ga0207681_11733627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
3300025933|Ga0207706_10857581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 769 | Open in IMG/M |
3300025981|Ga0207640_11055368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
3300026285|Ga0209438_1007107 | All Organisms → cellular organisms → Bacteria | 3785 | Open in IMG/M |
3300026324|Ga0209470_1031648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2710 | Open in IMG/M |
3300026326|Ga0209801_1333292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 535 | Open in IMG/M |
3300026536|Ga0209058_1070403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1877 | Open in IMG/M |
3300026537|Ga0209157_1059478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1973 | Open in IMG/M |
3300027181|Ga0208997_1030431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 782 | Open in IMG/M |
3300027388|Ga0208995_1032204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 918 | Open in IMG/M |
3300027480|Ga0208993_1072589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 627 | Open in IMG/M |
3300027577|Ga0209874_1113956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 634 | Open in IMG/M |
3300027637|Ga0209818_1062871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 922 | Open in IMG/M |
3300027637|Ga0209818_1070626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 880 | Open in IMG/M |
3300027645|Ga0209117_1003733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5304 | Open in IMG/M |
3300027655|Ga0209388_1013633 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
3300027678|Ga0209011_1095485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 869 | Open in IMG/M |
3300027691|Ga0209485_1139995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 715 | Open in IMG/M |
3300027738|Ga0208989_10061146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1297 | Open in IMG/M |
3300027873|Ga0209814_10028530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2292 | Open in IMG/M |
3300027873|Ga0209814_10250611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 768 | Open in IMG/M |
3300027875|Ga0209283_10058519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2467 | Open in IMG/M |
3300027875|Ga0209283_10272162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1121 | Open in IMG/M |
3300027882|Ga0209590_10015462 | All Organisms → cellular organisms → Bacteria | 3720 | Open in IMG/M |
3300027886|Ga0209486_11316572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
3300028381|Ga0268264_10169295 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
3300028711|Ga0307293_10117466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 845 | Open in IMG/M |
3300028716|Ga0307311_10114741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 760 | Open in IMG/M |
3300028784|Ga0307282_10137979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1150 | Open in IMG/M |
3300028799|Ga0307284_10211815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 764 | Open in IMG/M |
3300028807|Ga0307305_10018177 | All Organisms → cellular organisms → Bacteria | 3146 | Open in IMG/M |
3300028814|Ga0307302_10157102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1103 | Open in IMG/M |
3300028824|Ga0307310_10375967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 702 | Open in IMG/M |
3300028828|Ga0307312_10705319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 668 | Open in IMG/M |
3300028878|Ga0307278_10546088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
3300028881|Ga0307277_10218669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 837 | Open in IMG/M |
3300031965|Ga0326597_10083355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3925 | Open in IMG/M |
3300034178|Ga0364934_0249141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 673 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.33% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.33% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.11% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.56% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.44% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.33% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.11% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.11% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.56% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_24127624 | 3300000033 | Soil | MVSNVLGTDQDELMKQLKSFKTKYAGDPEWEQIRAGFPKSWPI* |
JGI10215J12807_13996782 | 3300000881 | Soil | MVSNVLEMDQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI* |
JGI10216J12902_1110297801 | 3300000956 | Soil | MVSNVLDMDQEELAKLLKSFKTKYAKDPEWIELRAGFPKTWPI* |
JGI11823J13286_10063652 | 3300001164 | Forest Soil | MVSNVLETDQEELVTLLKSFRTKYAGDPEWEKIRAGFPKSWPF* |
JGI12053J15887_101325191 | 3300001661 | Forest Soil | MVSNVLEMDEEELMKLLKSFRTKYAGDPEWEKIRAGFPKSWPI* |
JGI12053J15887_104891932 | 3300001661 | Forest Soil | MVSNVLEMDEGELMKLLKSFRTKYAGDPEWEKIRAGFPKSWPI* |
JGI25613J43889_100679642 | 3300002907 | Grasslands Soil | MVSNVLEMDHDELMKLLKSFNTKYAGDPEWDQIRAGFPKSWPL* |
Ga0063356_1061705711 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ETTGMVSNVLDMDQEQLVRLLKSFKTKYAGDPEWHEMRAGLPKSWPI* |
Ga0066674_101692713 | 3300005166 | Soil | MVSNVLDMDQGELVKQLKSFKKKYAGDAEWTEVRAGFPKSWPI* |
Ga0066683_106626101 | 3300005172 | Soil | MVSNVLDMDQAELTKQLKSFKTKYVGDPEWIEIRAGFPKSWPI* |
Ga0066678_101033394 | 3300005181 | Soil | MVSNVLDMDQGELVKQLKSFKTKYAGDAEWTRVRAGFPKSWPI* |
Ga0065715_100037747 | 3300005293 | Miscanthus Rhizosphere | MVSNVLEMDQEELTKLLKSFKTKYADDPEWEQLRAGFPKSWPI* |
Ga0065705_103236632 | 3300005294 | Switchgrass Rhizosphere | MVSNVLEMDQEELTKLLKSFKTKYAADPEWEQIRAGFPKSWPI* |
Ga0070676_102091072 | 3300005328 | Miscanthus Rhizosphere | MVSNVLGTDEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI* |
Ga0068869_1010449223 | 3300005334 | Miscanthus Rhizosphere | TGMVSNVLEMDQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI* |
Ga0070661_1015189911 | 3300005344 | Corn Rhizosphere | MVSNVLGTDEDELIKQLKSLKTKYAGDPEWEEIRAGFPKSWPI* |
Ga0070694_1012606542 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLDMDQEELAKLLKSFKTKYTGDPEWIEIRAGFPKSWPI* |
Ga0070708_1000637172 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDQEDLVALLRSFKKKYADDPEWKRIRAEFPKTWPI* |
Ga0066686_100587986 | 3300005446 | Soil | MVSNVLGMDQAELTKQLKSFKTKYVGDPEWIEIRAGFPKSWPI* |
Ga0066682_102379652 | 3300005450 | Soil | MVSNVLDMDQDKLMKQLKSFKTKYAGDPEWIEIRAGFPKSWPI* |
Ga0070706_1000052209 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDQEELAKLLKSFKTKYAKDPEWLEVRAGFPKTWPI* |
Ga0070707_1006436982 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDQEELVALLRSFKKKYAGDPEWKKIRAEFPKTWPI* |
Ga0070699_1004012802 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDEEELMKLLKSFKTKYADDPEWAQLRAGFPKSWPI* |
Ga0070699_1011853182 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDQAELLTLLKSFKKKYAGDEEWAKIRAGFPKTWPI* |
Ga0070699_1014373121 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLDMDQEELAKLLKSFKTKYAKDPEWIEIRAGFPKTWPI* |
Ga0068853_1012556541 | 3300005539 | Corn Rhizosphere | MVSNVLGTDDDELIKQIKSFKTKYAGDPEWEEIRAGFPKSWPI* |
Ga0066701_102706032 | 3300005552 | Soil | MVSNVLDMDQGELVKQLKSFKKKYAGDAEWIEIRAGFPKSWPI* |
Ga0066698_109253051 | 3300005558 | Soil | MDQAELTKQLKSFKTKYAGDPEWIEIRAGFPKSWPI* |
Ga0066700_101598644 | 3300005559 | Soil | MVSNVLDLDQKDLVKQLKSFKTKYAGDAEWIEIRAGFPKSWPI* |
Ga0066703_100686234 | 3300005568 | Soil | MVSNVLDLDQKELVKQLKSFKTKYDGDADWIEIRARFPKSWPI* |
Ga0068857_1000513427 | 3300005577 | Corn Rhizosphere | MVSNVLGTDEDELIKQLKSFKTKYAGDPEWEEIRAGFPKSWPI* |
Ga0068860_1002690064 | 3300005843 | Switchgrass Rhizosphere | MVSNVLGTDEAELIKQLKSFKTKYAGDPEWEEIRAGFPKSWPI* |
Ga0075417_100069717 | 3300006049 | Populus Rhizosphere | MVSNVLDMDQEELVKLLKSFKTKYADDTEWSEIRAGFPKTWPI* |
Ga0075417_102885623 | 3300006049 | Populus Rhizosphere | MVSNVLEMDQEELVKLLKSFKTKYKGDPEWDDVRTGFPKSWPI* |
Ga0075430_1012685631 | 3300006846 | Populus Rhizosphere | MVSNVLDMDQEELVKQLKSFKTKYAGDPEWDQIRADFPKSWPI* |
Ga0075433_100882904 | 3300006852 | Populus Rhizosphere | MVSNVLGTDEDELIKQIKSFRTKHAGDPEWEEIRAGFPKSWPI* |
Ga0075433_101510284 | 3300006852 | Populus Rhizosphere | MVSNVLEMDQEELMKLLKSFKTKYAEDPEWAQLRAGFPKSWPI* |
Ga0075433_116389081 | 3300006852 | Populus Rhizosphere | MVSNVLDMDQEELAKLLKSFKTKYAKDPEWLELRAGFPKTWPI* |
Ga0075434_1002352994 | 3300006871 | Populus Rhizosphere | MVSNVLEMDQEELTKLLKSFKTKYAEDPEWAQLRAGFPKSWPI* |
Ga0079217_100114043 | 3300006876 | Agricultural Soil | MVSNVLDMDQEELVKLLKSFKTKYADDAEWSDIRADFPKTWPI* |
Ga0079217_104121392 | 3300006876 | Agricultural Soil | MVSNVLEMDHEALVKLLKSFKTKYAGDTEWAEIRAGFPKTWPI* |
Ga0068865_1014757101 | 3300006881 | Miscanthus Rhizosphere | SLGFEETTGMVSNVLEMDQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI* |
Ga0079215_100207122 | 3300006894 | Agricultural Soil | MVSNVLDMDQEELVKLLKSFKTKYADDAEWSEIRAGFPKTWPI* |
Ga0079215_106940111 | 3300006894 | Agricultural Soil | HEALVKLLKSFKTKYAGDTEWAEIRAGFPKTWPI* |
Ga0075424_1001783991 | 3300006904 | Populus Rhizosphere | MDQEELAKLLKSFKTKYAKDPEWIEIRAGFPKAWPI* |
Ga0079218_104619901 | 3300007004 | Agricultural Soil | MVSNVLEMDQEELVKQLKSFKTKYAGDTEWAEVRAGFPKTWPI* |
Ga0079218_138889172 | 3300007004 | Agricultural Soil | MVSNVLDMDHEELVKLLKSFKTKYAGDTEWTEIRAGFPKTWPI* |
Ga0099791_101593112 | 3300007255 | Vadose Zone Soil | MVSNVLDMDQEELVKLLKSFKGKYARDPEWIEIRAGFPKTWPI* |
Ga0099794_104224792 | 3300007265 | Vadose Zone Soil | MVSNVLEMDQEELVKLLKSFKTKYAGDPAWNEIRAGFPKSWPI* |
Ga0066710_1003561584 | 3300009012 | Grasslands Soil | MVSNVLEMDQEELVKQLKSFKTKYAGDGEWIALRAGFPKSWPI |
Ga0099829_113931261 | 3300009038 | Vadose Zone Soil | MVSNVLDMDQEELVTLLKSFKAKYARDPEWIEIRAGFPKTWPI* |
Ga0099830_109623182 | 3300009088 | Vadose Zone Soil | MVSNVLEIDQEELVKLLQSFKTKYAGDTEWNEIRAGLPKSWPI* |
Ga0099828_100372196 | 3300009089 | Vadose Zone Soil | MVSNVLEMDQEELLTLLKSFKKKYAGDEEWAKIRAGFPKAWPI* |
Ga0099828_101845863 | 3300009089 | Vadose Zone Soil | MVSNVLDMDQEELVKLLKSFKAKYARDPEWIEIRAGFPKTWPI* |
Ga0099827_100054748 | 3300009090 | Vadose Zone Soil | MVSNVLDMDQDELMKQLKSFKTKYTSDPEWIEIRAGFPKSWPI* |
Ga0105245_132861212 | 3300009098 | Miscanthus Rhizosphere | GFEETTGMVSNVLGTDEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI* |
Ga0111538_106658623 | 3300009156 | Populus Rhizosphere | MVSNVLGTDEDELIKQIKSFRTKYAGDPEWEEIRAGFPKSWPI* |
Ga0105241_112625012 | 3300009174 | Corn Rhizosphere | MVSNVLGTDEDELMKQIKSFKTKYAGDPEWEEIRAGFPKSWPI* |
Ga0105056_10735602 | 3300009801 | Groundwater Sand | MVSNVLDMDQEELVKLLTSFKTKYAEDTEWIEIRAGFPKTWPI* |
Ga0105084_11068432 | 3300009811 | Groundwater Sand | MVSNVLDMDQEELVTLLKSFKTKYAEDTEWIEIRAGFPKTWPI* |
Ga0134088_104422772 | 3300010304 | Grasslands Soil | MVSNVLDMDQDELMKQLKSFKTKYAGDPEWIEIRAGFPKSWPI* |
Ga0134109_102673582 | 3300010320 | Grasslands Soil | MVSNVLDMDQGELVKQLKSFKKKYGGDAEWTEVRAGFPKSWPI* |
Ga0134086_101385552 | 3300010323 | Grasslands Soil | MVSNVLDMDQDKLMKQLKSFKTKYAGDGEWIALRAGFPKSWPI* |
Ga0134080_105160402 | 3300010333 | Grasslands Soil | MVSNVLEMDQEELVKQLKSFKKKYAGDAEWTEVRAGFPKSWPI* |
Ga0134071_104753681 | 3300010336 | Grasslands Soil | MVSNVLDMDQDELMKQLKSFKTKYAGDPEWMEIRAGFPKSWPI* |
Ga0134122_109155963 | 3300010400 | Terrestrial Soil | MVSNVLEMGQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI* |
Ga0105246_123013581 | 3300011119 | Miscanthus Rhizosphere | FEETTGMVSNVLGTDDDELIKQIKSFKTKYAGDPEWEEIRAGFPKSWPI* |
Ga0137391_104235262 | 3300011270 | Vadose Zone Soil | MVSNVLDMDQKELVTLLKSFKAKYARDPEWIEIRAGFPKTWPI* |
Ga0137391_106204752 | 3300011270 | Vadose Zone Soil | MVSNVLEIDQEELVKLLQSFRARYAGDAEWNAVRAGFPKTWPI* |
Ga0137389_103227003 | 3300012096 | Vadose Zone Soil | MVSNVLEMDQEELLTLLKSFKKKYAGDEEWAKIRAGFPKSWPI* |
Ga0137364_100996204 | 3300012198 | Vadose Zone Soil | MVSNVLDMDQGELVKQLKSFKKKYAGDAEWTEIRAGFPKSWPI* |
Ga0137363_102504122 | 3300012202 | Vadose Zone Soil | MVSNVLDMDQGELVKQLKSFKTKYAGDAEWIEIRAGFPKSWPI* |
Ga0137399_102162332 | 3300012203 | Vadose Zone Soil | MDQEDLVKLLKSFKKKYAGDPDWDEIRAGFPKSWPI* |
Ga0137399_105320522 | 3300012203 | Vadose Zone Soil | MVSNVLDIDEDELAKRLKSFKTKYKDDPEWEKIRAGFPKSWPI* |
Ga0137374_1000216727 | 3300012204 | Vadose Zone Soil | MVSNVLEMDQTELVALLKSFKKKYAGDPEWKKVRAEFPKSWPI* |
Ga0137374_100540962 | 3300012204 | Vadose Zone Soil | MVSNVLEMDQEALMKLLKSFKKKYAGDPEWDGIRAGFPKSWPI* |
Ga0137374_101127043 | 3300012204 | Vadose Zone Soil | MVSNVLDMDQEELVKLLKSFKTKYNGDPEWDQIRADFPKSWPI* |
Ga0137374_112712052 | 3300012204 | Vadose Zone Soil | MVSNVLEMDTEELMALLKSFKTKYGGDPEWEQIRAGFPKSWPI* |
Ga0137380_102414223 | 3300012206 | Vadose Zone Soil | MVSNVLEMDQEELVKQLKSFKTKYAGDAEWTRVRAGFPKSWPI* |
Ga0137380_108750562 | 3300012206 | Vadose Zone Soil | MVSNVLDMDQDELTKQLKSFKTKYAGDAEWIALRAGFPKSWPI* |
Ga0137381_108152672 | 3300012207 | Vadose Zone Soil | MVSNVLDMDQDELTKQLKSFKTKYAGDPEWIEIRTGFPKSWPI* |
Ga0137381_110130792 | 3300012207 | Vadose Zone Soil | MDQGELVKQLKSFKTKYSGDAEWTRVRAGFPKSWPI* |
Ga0137372_111623522 | 3300012350 | Vadose Zone Soil | MVSNVLDMDQGELMKQLKSFKTKYAGDPEWIEIRTGFPKSWPI* |
Ga0137386_107663932 | 3300012351 | Vadose Zone Soil | MVSNVLEMDQEELVKQLKSFKTKYAGDPEWIEIRTGFPKSWPI* |
Ga0137369_100595165 | 3300012355 | Vadose Zone Soil | MVSNVLEMDQEALTKLLKSFKKKYAGDPEWDGIRAGFPKSWPI* |
Ga0137369_102499463 | 3300012355 | Vadose Zone Soil | MVSNVLEMDQEELVKQLKSFKTKYKGDPEWVEVRADFPKSWPI* |
Ga0137368_107061542 | 3300012358 | Vadose Zone Soil | MVSNVLDMDQEELMKLLKSFKTKYKGDPEWDEVRADFPKSWPI* |
Ga0137385_103156983 | 3300012359 | Vadose Zone Soil | MVSNVLDMDQDELTKQLKSFKTKYAGDAEWTRVRAGFPKSWPI* |
Ga0137361_105537041 | 3300012362 | Vadose Zone Soil | MVSNVLDMDQGELVKQLKSFKTKYAGDAEWTRVRAGFPKTWPI* |
Ga0137373_100762043 | 3300012532 | Vadose Zone Soil | MVSNVLDMDQEELVKLLKSFKTKYNGDPEWDQIRVDFPKSWPI* |
Ga0137397_102183472 | 3300012685 | Vadose Zone Soil | MVSNVLDMDQEDLVKLLKSFKKKYADDPDWDEIRAGFPKSWPI* |
Ga0137396_102946162 | 3300012918 | Vadose Zone Soil | MVSNVLEMEQEELMKLLKSFRTKYAGDPDWEKIRAGFPKSWPI* |
Ga0137396_106688343 | 3300012918 | Vadose Zone Soil | MVSNVLDIDEDELAKRLKSFKTKYKDDPEWEKIRAGFPKSW |
Ga0137394_104826102 | 3300012922 | Vadose Zone Soil | MVSNVLDMDQEDLVKLLKSFKKKYAGDPDWDEIRAGFPKSWPI* |
Ga0137407_111070113 | 3300012930 | Vadose Zone Soil | MVSNVLEMDHDELMKLLKSFNTKYAGDPEWDQIRAGFPKSW |
Ga0137410_114751492 | 3300012944 | Vadose Zone Soil | MVSNVLDMDQKELVKLLKSFKAKYARDPEWIEIRAGFPKTWPI* |
Ga0137410_114752242 | 3300012944 | Vadose Zone Soil | SNVLDIDEDELAKRLKSFKTKYKDDPEWEKTRAGFPKSWPI* |
Ga0157378_126606062 | 3300013297 | Miscanthus Rhizosphere | GMVSNVLGTDEDELMKQIKSFKTKYAGDPEWEEIRAGFPKSWPI* |
Ga0134075_100210554 | 3300014154 | Grasslands Soil | MVSNVLDMDQAELTKQLKSFKTKYAGDPEWIEIRAGFPKSWPI* |
Ga0120193_100955872 | 3300014965 | Terrestrial | MVSNVLEMDQGELVKLLKSFKTKYAGDPEWAEVRAGFPKSWPI* |
Ga0137418_112114842 | 3300015241 | Vadose Zone Soil | MVSNVLETDQEELMKLLKSFRTKYAGDPEWEKIRAGFPKSWPF* |
Ga0180070_10528851 | 3300015251 | Soil | MVSNVLDIDQKELVEQLKSFKKKYAGDAEWDELRAGFPKTWPI* |
Ga0134089_100261693 | 3300015358 | Grasslands Soil | MVSNVLEMDQEELVKQLKSFKTKYVGDPEWIEIRAGFPKSWPI* |
Ga0132257_1036658421 | 3300015373 | Arabidopsis Rhizosphere | MVSNVLEMDQEKLVKLLKSFKTKYAGDPEWEKIRAGFPKSWPI* |
Ga0132255_1029933522 | 3300015374 | Arabidopsis Rhizosphere | MVSNVLEMDQEKLVKLLKSFKTKYAGDPEWEKIRAGLPRSWPI* |
Ga0134083_101919801 | 3300017659 | Grasslands Soil | MVSNVLEMDQEELVKQLKSFKTKYVGDPEWIEIRAGFPKSWPI |
Ga0184610_10212103 | 3300017997 | Groundwater Sediment | MVSNVLDIDQEELVEQLKSFKKKYAGDAEWGEIRAGFPKSWPI |
Ga0184610_10782442 | 3300017997 | Groundwater Sediment | MVSNVLDMDQEELVKLLKSFKTKYAEDTEWSEIRAGFPKTWPI |
Ga0184604_100099314 | 3300018000 | Groundwater Sediment | MVSNVLETDQEELMKLLKSFKTKYAKDPEWDEIRAGFPKSWPI |
Ga0184605_100537552 | 3300018027 | Groundwater Sediment | MVSNVLDMDQEDLVKLLKSFKKKYAGDPDWDEIRAGFPKSWPI |
Ga0184605_104496222 | 3300018027 | Groundwater Sediment | MVSNVLETDQEELMKLLKSFKTKYAGDPEWEQVRAGFPKSWPI |
Ga0184608_100158153 | 3300018028 | Groundwater Sediment | MVSNVLEMDQEKLMKLLKSFKTKYAEDPEWEQIRAGFPKSWPI |
Ga0184634_102504322 | 3300018031 | Groundwater Sediment | MVSNVLDIDQEELVRQLKSFKTKYAGDPEWDEIRAGFPKTWPI |
Ga0184638_11633011 | 3300018052 | Groundwater Sediment | MVSNVLEMDAEELMKLLKSFKTKYAEDPEWEQIRAGFPKSWPI |
Ga0184638_12271862 | 3300018052 | Groundwater Sediment | MVSNVLEMDQEELMKLLTSFKTKYAEDPEWEQLRAGFPKSWPI |
Ga0184623_100210073 | 3300018056 | Groundwater Sediment | MVSNVLDMDQEELVKLLKSFKTKYAGDTEWSEIRAGFPKTWPI |
Ga0184637_102375302 | 3300018063 | Groundwater Sediment | MVSNVLDIDQEELLEQLTSFKKKYAGDAEWDEIRAGFPKSWPI |
Ga0184618_100117464 | 3300018071 | Groundwater Sediment | MVSNVLETDQEELMKLLKSFKTKYAGDPEWEQLRAGFPKSWPI |
Ga0184618_100510192 | 3300018071 | Groundwater Sediment | MVSNVLEMDQEELMKLLKSFKTKYAEDPEWEQIRTGFPKSWPI |
Ga0184640_100638483 | 3300018074 | Groundwater Sediment | MVSNVLDMDEEELVKQLKSFKTKYAQDPEWDDIRAGFPKSWPI |
Ga0184609_100520423 | 3300018076 | Groundwater Sediment | MVSNVLEMDQEELMKLLKSFKTKYAEDPEWEQLRAGFPKSWPI |
Ga0184609_102976962 | 3300018076 | Groundwater Sediment | MVSNVLDMDQEELVKLLKSFKTKYAEDTEWSEIRSGFPKTWPI |
Ga0190272_114718912 | 3300018429 | Soil | MVSNVLDMDQEELVKLLKSFKTKYAEDVEWSEIRAGFPKTWPI |
Ga0066655_102880112 | 3300018431 | Grasslands Soil | MVSNVLDMDQGELVKQLKSFKKKYAGDAEWTEVRAGFPKSWPI |
Ga0066655_105072173 | 3300018431 | Grasslands Soil | MVSNVLDMDQAELTKQLKSFKTKYVGDPEWIEIRAGFPKSWPI |
Ga0066667_100635693 | 3300018433 | Grasslands Soil | MVSNVLDMDQGELVKQLKSFKKKYAGDAEWIEIRAGFPKSWPI |
Ga0193715_10464772 | 3300019878 | Soil | MVSNVLEMDEEELMKLLKSFKTKYAEDPEWAQLRAGFPKSWPI |
Ga0193710_10328782 | 3300019998 | Soil | MVSNVLETDQEELMKLLKSFKTKYAGDPEWEQIRAGFPKSWPI |
Ga0210382_101591673 | 3300021080 | Groundwater Sediment | MVSNVLETDQEELVKLLKSFKTTYAGDAEWEQLRADLPKSWPI |
Ga0193699_102834591 | 3300021363 | Soil | MVSNVLEMDEEELMKLLKSFKTKYADDPEWDEIRAGLPKSWPL |
Ga0222623_102455603 | 3300022694 | Groundwater Sediment | NVLETDQEELMKLLKSFKTKYAGDPEWEQIRAGFPKSWPI |
Ga0207653_1000079313 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDQEELTKLLKSFKTKYADDPEWEQLRAGFPKSWPI |
Ga0207653_100408894 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI |
Ga0207645_101901313 | 3300025907 | Miscanthus Rhizosphere | MVSNVLGTDEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI |
Ga0207643_104587012 | 3300025908 | Miscanthus Rhizosphere | MVSNVLGTDEDELIKQLKSFKTKYAGDPEWEEIRAGFPKSWPI |
Ga0207684_1000004183 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDQEELAKLLKSFKTKYAKDPEWLEVRAGFPKTWPI |
Ga0207684_100462917 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLDMDQEELAKLLKSFKTKYTGDPEWIEIRAGFPKSWPI |
Ga0207684_103748361 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLDMDQEELAKLLKSFKTKYAKDPEWIQIRAGFPKAWPI |
Ga0207684_110855302 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDEEELMKLLKSFKTKYADDPEWAQLRAGFPKSWPI |
Ga0207657_103316343 | 3300025919 | Corn Rhizosphere | MVSNVLGTDDDELIKQIKSFKTKYAGDPEWEEIRAGFPKSWPI |
Ga0207646_112062001 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDQEELVALLRSFKKKYAGDPEWKKIRAEFPKTWPI |
Ga0207646_112380472 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMDQEELAKLLKSFKTKYAKDPEWLEVRAGFPKAWPI |
Ga0207681_117336272 | 3300025923 | Switchgrass Rhizosphere | DEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI |
Ga0207706_108575811 | 3300025933 | Corn Rhizosphere | SNVLGTDDDELIKQIKSFKTKYAGDPEWEEIRAGFPKSWPI |
Ga0207640_110553681 | 3300025981 | Corn Rhizosphere | SNVLGTDEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI |
Ga0209438_10071077 | 3300026285 | Grasslands Soil | MVSNVLEMDHDELMKLLKSFNTKYAGDPEWDQIRAGFPKSWPL |
Ga0209470_10316484 | 3300026324 | Soil | MVSNVLDMDQAELTKQLKSFKTKYAGDPEWIEIRAGFPKSWPI |
Ga0209801_13332922 | 3300026326 | Soil | MVSNVLDMDQGELVKQLKSFKTKYAGDAEWTRVRAGFPKSWPI |
Ga0209058_10704033 | 3300026536 | Soil | MVSNVLGMDQAELTKQLKSFKTKYVGDPEWIEIRAGFPKSWPI |
Ga0209157_10594785 | 3300026537 | Soil | MDQDKLMKQLKSFKTKYAGDPEWIEIRAGFPKSWPI |
Ga0208997_10304312 | 3300027181 | Forest Soil | MVSNVLEMDEEELMKLLKSFRTKYAGDPEWEKIRAGFPKSWPI |
Ga0208995_10322043 | 3300027388 | Forest Soil | MVSNVLEMDEEELMKLLKSFRTKYAGDPEWEKVRAGFPKSWPM |
Ga0208993_10725891 | 3300027480 | Forest Soil | MVSNVLETDQEELVTLLKSFRTKYAGDPEWEKIRAGFPKSWPI |
Ga0209874_11139562 | 3300027577 | Groundwater Sand | MVSNVLDMDQEELVKLLKSFKTKYAEDTEWIEIRAGFPKTWPI |
Ga0209818_10628712 | 3300027637 | Agricultural Soil | MVSNVLEMDHEALVKLLKSFKTKYAGDTEWAEIRAGFPKTWPI |
Ga0209818_10706262 | 3300027637 | Agricultural Soil | MVSNVLDMDQEELVKLLKSFKTKYADDAEWSDIRADFPKTWPI |
Ga0209117_10037335 | 3300027645 | Forest Soil | MVSNVLEMDQEALVRLLKSFGTTYAGDPEWEKIRAGFPKAWPL |
Ga0209388_10136334 | 3300027655 | Vadose Zone Soil | MVSNVLDMDQEELVKLLKSFKGKYARDPEWIEIRAGFPKTWPI |
Ga0209011_10954852 | 3300027678 | Forest Soil | MVSNVLEMDQEGLVTLLKSFRTKYAGDPEWEQIRAGFPK |
Ga0209485_11399951 | 3300027691 | Agricultural Soil | MVSNVLEMDQEELVKQLKSFKTKYAGDTEWAEVRAGFPKTWPI |
Ga0208989_100611462 | 3300027738 | Forest Soil | MVSNVLETDQEELVTLLKSFRTKYAGDPEWEKIRAGFPKSWPF |
Ga0209814_100285302 | 3300027873 | Populus Rhizosphere | MVSNVLDMDQEELVKLLKSFKTKYADDTEWSEIRAGFPKTWPI |
Ga0209814_102506111 | 3300027873 | Populus Rhizosphere | TTGMVSNVLEMDQEELVKLLKSFKTKYKGDPEWDDVRTGFPKSWPI |
Ga0209283_100585191 | 3300027875 | Vadose Zone Soil | SLGFEETTGMVSNVLDMDQEELVKLLKSFKAKYARDPEWIEIRAGFPKTWPI |
Ga0209283_102721622 | 3300027875 | Vadose Zone Soil | MVSNVLEMDQEELLTLLKSLKKKYAGDEEWAKIRAGFPKSWPI |
Ga0209590_100154623 | 3300027882 | Vadose Zone Soil | MVSNVLDVDQDELMKQLKSFKTKYTSDPEWIEIRAGFPKSWPI |
Ga0209486_113165721 | 3300027886 | Agricultural Soil | MVSNVLDMDHEELVKLLKSFKTKYAGDTEWTEIRAGFPKTWPI |
Ga0268264_101692951 | 3300028381 | Switchgrass Rhizosphere | MVSNVLGTDEAELIKQLKSFKTKYAGDPEWEEIRAGFPKSWPI |
Ga0307293_101174661 | 3300028711 | Soil | SNVLEMDEEELMKLLKSFKTKYAEDPEWAQLRAGFPKSWPI |
Ga0307311_101147413 | 3300028716 | Soil | DEEELMKLLKSFKTKYAGDPEWAQLRAGFPKSWPI |
Ga0307282_101379792 | 3300028784 | Soil | MVSNVLDMDQEDLVKLLKSFKAKYAGDPEWGEIRAGFPKSWPI |
Ga0307284_102118152 | 3300028799 | Soil | MVSNVLEMDEEELMKLLKSFKPKYAEDPEWAQLRAGFPKSWPI |
Ga0307305_100181774 | 3300028807 | Soil | MVSNVLEMDQEELMKLLKSFKTKYAEDPEWEQIRAGFPKSWPI |
Ga0307302_101571022 | 3300028814 | Soil | MVSNVLEVDQEELMKLLKSFKTKYAEDPEWEQLRAGFPKSWPI |
Ga0307310_103759671 | 3300028824 | Soil | DQEELMKLLKSFKTKYAEDPEWDQIRTGFPKSWPI |
Ga0307312_107053191 | 3300028828 | Soil | MVSNVLDMDQEDLVKLLKSFKKKYAGDPEWGEIRAGFPKSWPI |
Ga0307278_105460882 | 3300028878 | Soil | MVSNVLEMDQEELMKLLKSFKAKYAEDPEWEQIRTGFPKSWPI |
Ga0307277_102186693 | 3300028881 | Soil | SNVLDMDQEDLVKLLKSFKKKYAGDPDWDEIRAGFPKSWPI |
Ga0326597_100833557 | 3300031965 | Soil | MVSNVLEMDQEELVKLLKSFKKKYAGDPEWDEIRAGFPKSWPI |
Ga0364934_0249141_364_495 | 3300034178 | Sediment | MVSNVLEMDQEALVEQLKSFKMKYTGDAEWDEIRAGFPRSWPI |
⦗Top⦘ |