NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F032181

Metagenome Family F032181

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032181
Family Type Metagenome
Number of Sequences 180
Average Sequence Length 43 residues
Representative Sequence MVSNVLEMDQEELVKLLKSFKKKYAGDPEWDEIRAGFPKSWPI
Number of Associated Samples 146
Number of Associated Scaffolds 180

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.67 %
% of genes near scaffold ends (potentially truncated) 16.11 %
% of genes from short scaffolds (< 2000 bps) 77.78 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.889 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(23.333 % of family members)
Environment Ontology (ENVO) Unclassified
(35.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(51.111 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.80%    β-sheet: 0.00%    Coil/Unstructured: 66.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 180 Family Scaffolds
PF04237YjbR 47.78
PF14518Haem_oxygenas_2 8.33
PF00583Acetyltransf_1 6.67
PF00296Bac_luciferase 5.56
PF00890FAD_binding_2 1.11
PF07992Pyr_redox_2 0.56
PF05532CsbD 0.56
PF13673Acetyltransf_10 0.56
PF13304AAA_21 0.56
PF13699DUF4157 0.56
PF00216Bac_DNA_binding 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 180 Family Scaffolds
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 47.78
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 5.56
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.56
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.89 %
UnclassifiedrootN/A1.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c2412762All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300000881|JGI10215J12807_1399678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium614Open in IMG/M
3300000956|JGI10216J12902_111029780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium625Open in IMG/M
3300001164|JGI11823J13286_1006365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium819Open in IMG/M
3300001661|JGI12053J15887_10132519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1324Open in IMG/M
3300001661|JGI12053J15887_10489193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium588Open in IMG/M
3300002907|JGI25613J43889_10067964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium970Open in IMG/M
3300004463|Ga0063356_106170571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium514Open in IMG/M
3300005166|Ga0066674_10169271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1035Open in IMG/M
3300005172|Ga0066683_10662610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium624Open in IMG/M
3300005181|Ga0066678_10103339All Organisms → cellular organisms → Bacteria1729Open in IMG/M
3300005293|Ga0065715_10003774All Organisms → cellular organisms → Bacteria6958Open in IMG/M
3300005294|Ga0065705_10323663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium938Open in IMG/M
3300005328|Ga0070676_10209107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1283Open in IMG/M
3300005334|Ga0068869_101044922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium713Open in IMG/M
3300005344|Ga0070661_101518991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium565Open in IMG/M
3300005444|Ga0070694_101260654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium621Open in IMG/M
3300005445|Ga0070708_100063717All Organisms → cellular organisms → Bacteria3301Open in IMG/M
3300005446|Ga0066686_10058798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2372Open in IMG/M
3300005450|Ga0066682_10237965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1171Open in IMG/M
3300005467|Ga0070706_100005220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi12393Open in IMG/M
3300005468|Ga0070707_100643698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1023Open in IMG/M
3300005518|Ga0070699_100401280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1240Open in IMG/M
3300005518|Ga0070699_101185318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi701Open in IMG/M
3300005518|Ga0070699_101437312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium632Open in IMG/M
3300005539|Ga0068853_101255654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium716Open in IMG/M
3300005552|Ga0066701_10270603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1052Open in IMG/M
3300005558|Ga0066698_10925305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium557Open in IMG/M
3300005559|Ga0066700_10159864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1533Open in IMG/M
3300005568|Ga0066703_10068623All Organisms → cellular organisms → Bacteria2027Open in IMG/M
3300005577|Ga0068857_100051342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3658Open in IMG/M
3300005843|Ga0068860_100269006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1663Open in IMG/M
3300006049|Ga0075417_10006971All Organisms → cellular organisms → Bacteria3963Open in IMG/M
3300006049|Ga0075417_10288562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium794Open in IMG/M
3300006846|Ga0075430_101268563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium606Open in IMG/M
3300006852|Ga0075433_10088290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2739Open in IMG/M
3300006852|Ga0075433_10151028All Organisms → cellular organisms → Bacteria2066Open in IMG/M
3300006852|Ga0075433_11638908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium554Open in IMG/M
3300006871|Ga0075434_100235299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1852Open in IMG/M
3300006876|Ga0079217_10011404All Organisms → cellular organisms → Bacteria2873Open in IMG/M
3300006876|Ga0079217_10412139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium803Open in IMG/M
3300006881|Ga0068865_101475710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium609Open in IMG/M
3300006894|Ga0079215_10020712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2205Open in IMG/M
3300006894|Ga0079215_10694011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium687Open in IMG/M
3300006904|Ga0075424_100178399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2253Open in IMG/M
3300007004|Ga0079218_10461990All Organisms → cellular organisms → Bacteria → Proteobacteria1107Open in IMG/M
3300007004|Ga0079218_13888917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium508Open in IMG/M
3300007255|Ga0099791_10159311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1056Open in IMG/M
3300007265|Ga0099794_10422479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium697Open in IMG/M
3300009012|Ga0066710_100356158All Organisms → cellular organisms → Bacteria2165Open in IMG/M
3300009038|Ga0099829_11393126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium579Open in IMG/M
3300009088|Ga0099830_10962318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium706Open in IMG/M
3300009089|Ga0099828_10037219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3964Open in IMG/M
3300009089|Ga0099828_10184586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1857Open in IMG/M
3300009090|Ga0099827_10005474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi7632Open in IMG/M
3300009098|Ga0105245_13286121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium500Open in IMG/M
3300009156|Ga0111538_10665862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1319Open in IMG/M
3300009174|Ga0105241_11262501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium702Open in IMG/M
3300009801|Ga0105056_1073560Not Available511Open in IMG/M
3300009811|Ga0105084_1106843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium532Open in IMG/M
3300010304|Ga0134088_10442277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium637Open in IMG/M
3300010320|Ga0134109_10267358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium649Open in IMG/M
3300010323|Ga0134086_10138555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium882Open in IMG/M
3300010333|Ga0134080_10516040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium570Open in IMG/M
3300010336|Ga0134071_10475368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium643Open in IMG/M
3300010400|Ga0134122_10915596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium850Open in IMG/M
3300011119|Ga0105246_12301358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium526Open in IMG/M
3300011270|Ga0137391_10423526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1135Open in IMG/M
3300011270|Ga0137391_10620475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium905Open in IMG/M
3300012096|Ga0137389_10322700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1310Open in IMG/M
3300012198|Ga0137364_10099620All Organisms → cellular organisms → Bacteria2043Open in IMG/M
3300012202|Ga0137363_10250412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1439Open in IMG/M
3300012203|Ga0137399_10216233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1561Open in IMG/M
3300012203|Ga0137399_10532052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium987Open in IMG/M
3300012204|Ga0137374_10002167All Organisms → cellular organisms → Bacteria23057Open in IMG/M
3300012204|Ga0137374_10054096All Organisms → cellular organisms → Bacteria4100Open in IMG/M
3300012204|Ga0137374_10112704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2527Open in IMG/M
3300012204|Ga0137374_11271205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium510Open in IMG/M
3300012206|Ga0137380_10241422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1630Open in IMG/M
3300012206|Ga0137380_10875056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium773Open in IMG/M
3300012207|Ga0137381_10815267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium809Open in IMG/M
3300012207|Ga0137381_11013079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium716Open in IMG/M
3300012350|Ga0137372_11162352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium524Open in IMG/M
3300012351|Ga0137386_10766393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium693Open in IMG/M
3300012355|Ga0137369_10059516All Organisms → cellular organisms → Bacteria3289Open in IMG/M
3300012355|Ga0137369_10249946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1341Open in IMG/M
3300012358|Ga0137368_10706154Not Available633Open in IMG/M
3300012359|Ga0137385_10315698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1342Open in IMG/M
3300012362|Ga0137361_10553704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1055Open in IMG/M
3300012532|Ga0137373_10076204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3007Open in IMG/M
3300012685|Ga0137397_10218347All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300012918|Ga0137396_10294616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1199Open in IMG/M
3300012918|Ga0137396_10668834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium767Open in IMG/M
3300012922|Ga0137394_10482610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1053Open in IMG/M
3300012930|Ga0137407_11107011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium751Open in IMG/M
3300012944|Ga0137410_11475149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium593Open in IMG/M
3300012944|Ga0137410_11475224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi593Open in IMG/M
3300013297|Ga0157378_12660606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium553Open in IMG/M
3300014154|Ga0134075_10021055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2596Open in IMG/M
3300014965|Ga0120193_10095587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium513Open in IMG/M
3300015241|Ga0137418_11211484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium531Open in IMG/M
3300015251|Ga0180070_1052885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium558Open in IMG/M
3300015358|Ga0134089_10026169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2028Open in IMG/M
3300015373|Ga0132257_103665842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium559Open in IMG/M
3300015374|Ga0132255_102993352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi721Open in IMG/M
3300017659|Ga0134083_10191980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium840Open in IMG/M
3300017997|Ga0184610_1021210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1751Open in IMG/M
3300017997|Ga0184610_1078244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1021Open in IMG/M
3300018000|Ga0184604_10009931All Organisms → cellular organisms → Bacteria1977Open in IMG/M
3300018027|Ga0184605_10053755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1718Open in IMG/M
3300018027|Ga0184605_10449622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium568Open in IMG/M
3300018028|Ga0184608_10015815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2661Open in IMG/M
3300018031|Ga0184634_10250432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium812Open in IMG/M
3300018052|Ga0184638_1163301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium799Open in IMG/M
3300018052|Ga0184638_1227186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium651Open in IMG/M
3300018056|Ga0184623_10021007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2895Open in IMG/M
3300018063|Ga0184637_10237530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1113Open in IMG/M
3300018071|Ga0184618_10011746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2667Open in IMG/M
3300018071|Ga0184618_10051019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1504Open in IMG/M
3300018074|Ga0184640_10063848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1546Open in IMG/M
3300018076|Ga0184609_10052042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1751Open in IMG/M
3300018076|Ga0184609_10297696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium754Open in IMG/M
3300018429|Ga0190272_11471891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium690Open in IMG/M
3300018431|Ga0066655_10288011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1065Open in IMG/M
3300018431|Ga0066655_10507217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium800Open in IMG/M
3300018433|Ga0066667_10063569All Organisms → cellular organisms → Bacteria2297Open in IMG/M
3300019878|Ga0193715_1046477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium934Open in IMG/M
3300019998|Ga0193710_1032878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium522Open in IMG/M
3300021080|Ga0210382_10159167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium970Open in IMG/M
3300021363|Ga0193699_10283459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium691Open in IMG/M
3300022694|Ga0222623_10245560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium691Open in IMG/M
3300025885|Ga0207653_10000793All Organisms → cellular organisms → Bacteria10639Open in IMG/M
3300025885|Ga0207653_10040889All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300025907|Ga0207645_10190131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1349Open in IMG/M
3300025908|Ga0207643_10458701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium811Open in IMG/M
3300025910|Ga0207684_10000041All Organisms → cellular organisms → Bacteria262530Open in IMG/M
3300025910|Ga0207684_10046291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Merismopediaceae → Synechocystis → unclassified Synechocystis → Synechocystis sp. PCC 75093690Open in IMG/M
3300025910|Ga0207684_10374836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1224Open in IMG/M
3300025910|Ga0207684_11085530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium667Open in IMG/M
3300025919|Ga0207657_10331634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1202Open in IMG/M
3300025922|Ga0207646_11206200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi663Open in IMG/M
3300025922|Ga0207646_11238047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium653Open in IMG/M
3300025923|Ga0207681_11733627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium522Open in IMG/M
3300025933|Ga0207706_10857581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium769Open in IMG/M
3300025981|Ga0207640_11055368All Organisms → cellular organisms → Bacteria → Proteobacteria717Open in IMG/M
3300026285|Ga0209438_1007107All Organisms → cellular organisms → Bacteria3785Open in IMG/M
3300026324|Ga0209470_1031648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2710Open in IMG/M
3300026326|Ga0209801_1333292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium535Open in IMG/M
3300026536|Ga0209058_1070403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1877Open in IMG/M
3300026537|Ga0209157_1059478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1973Open in IMG/M
3300027181|Ga0208997_1030431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium782Open in IMG/M
3300027388|Ga0208995_1032204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium918Open in IMG/M
3300027480|Ga0208993_1072589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium627Open in IMG/M
3300027577|Ga0209874_1113956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium634Open in IMG/M
3300027637|Ga0209818_1062871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium922Open in IMG/M
3300027637|Ga0209818_1070626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium880Open in IMG/M
3300027645|Ga0209117_1003733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium5304Open in IMG/M
3300027655|Ga0209388_1013633All Organisms → cellular organisms → Bacteria2222Open in IMG/M
3300027678|Ga0209011_1095485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium869Open in IMG/M
3300027691|Ga0209485_1139995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium715Open in IMG/M
3300027738|Ga0208989_10061146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1297Open in IMG/M
3300027873|Ga0209814_10028530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2292Open in IMG/M
3300027873|Ga0209814_10250611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium768Open in IMG/M
3300027875|Ga0209283_10058519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2467Open in IMG/M
3300027875|Ga0209283_10272162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1121Open in IMG/M
3300027882|Ga0209590_10015462All Organisms → cellular organisms → Bacteria3720Open in IMG/M
3300027886|Ga0209486_11316572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium500Open in IMG/M
3300028381|Ga0268264_10169295All Organisms → cellular organisms → Bacteria1975Open in IMG/M
3300028711|Ga0307293_10117466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium845Open in IMG/M
3300028716|Ga0307311_10114741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium760Open in IMG/M
3300028784|Ga0307282_10137979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1150Open in IMG/M
3300028799|Ga0307284_10211815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium764Open in IMG/M
3300028807|Ga0307305_10018177All Organisms → cellular organisms → Bacteria3146Open in IMG/M
3300028814|Ga0307302_10157102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1103Open in IMG/M
3300028824|Ga0307310_10375967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium702Open in IMG/M
3300028828|Ga0307312_10705319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium668Open in IMG/M
3300028878|Ga0307278_10546088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium505Open in IMG/M
3300028881|Ga0307277_10218669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium837Open in IMG/M
3300031965|Ga0326597_10083355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3925Open in IMG/M
3300034178|Ga0364934_0249141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium673Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil23.33%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment8.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.11%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.33%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.11%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.11%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.56%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.56%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.56%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001164Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019998Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027181Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027388Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_241276243300000033SoilMVSNVLGTDQDELMKQLKSFKTKYAGDPEWEQIRAGFPKSWPI*
JGI10215J12807_139967823300000881SoilMVSNVLEMDQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI*
JGI10216J12902_11102978013300000956SoilMVSNVLDMDQEELAKLLKSFKTKYAKDPEWIELRAGFPKTWPI*
JGI11823J13286_100636523300001164Forest SoilMVSNVLETDQEELVTLLKSFRTKYAGDPEWEKIRAGFPKSWPF*
JGI12053J15887_1013251913300001661Forest SoilMVSNVLEMDEEELMKLLKSFRTKYAGDPEWEKIRAGFPKSWPI*
JGI12053J15887_1048919323300001661Forest SoilMVSNVLEMDEGELMKLLKSFRTKYAGDPEWEKIRAGFPKSWPI*
JGI25613J43889_1006796423300002907Grasslands SoilMVSNVLEMDHDELMKLLKSFNTKYAGDPEWDQIRAGFPKSWPL*
Ga0063356_10617057113300004463Arabidopsis Thaliana RhizosphereETTGMVSNVLDMDQEQLVRLLKSFKTKYAGDPEWHEMRAGLPKSWPI*
Ga0066674_1016927133300005166SoilMVSNVLDMDQGELVKQLKSFKKKYAGDAEWTEVRAGFPKSWPI*
Ga0066683_1066261013300005172SoilMVSNVLDMDQAELTKQLKSFKTKYVGDPEWIEIRAGFPKSWPI*
Ga0066678_1010333943300005181SoilMVSNVLDMDQGELVKQLKSFKTKYAGDAEWTRVRAGFPKSWPI*
Ga0065715_1000377473300005293Miscanthus RhizosphereMVSNVLEMDQEELTKLLKSFKTKYADDPEWEQLRAGFPKSWPI*
Ga0065705_1032366323300005294Switchgrass RhizosphereMVSNVLEMDQEELTKLLKSFKTKYAADPEWEQIRAGFPKSWPI*
Ga0070676_1020910723300005328Miscanthus RhizosphereMVSNVLGTDEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI*
Ga0068869_10104492233300005334Miscanthus RhizosphereTGMVSNVLEMDQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI*
Ga0070661_10151899113300005344Corn RhizosphereMVSNVLGTDEDELIKQLKSLKTKYAGDPEWEEIRAGFPKSWPI*
Ga0070694_10126065423300005444Corn, Switchgrass And Miscanthus RhizosphereMVSNVLDMDQEELAKLLKSFKTKYTGDPEWIEIRAGFPKSWPI*
Ga0070708_10006371723300005445Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDQEDLVALLRSFKKKYADDPEWKRIRAEFPKTWPI*
Ga0066686_1005879863300005446SoilMVSNVLGMDQAELTKQLKSFKTKYVGDPEWIEIRAGFPKSWPI*
Ga0066682_1023796523300005450SoilMVSNVLDMDQDKLMKQLKSFKTKYAGDPEWIEIRAGFPKSWPI*
Ga0070706_10000522093300005467Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDQEELAKLLKSFKTKYAKDPEWLEVRAGFPKTWPI*
Ga0070707_10064369823300005468Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDQEELVALLRSFKKKYAGDPEWKKIRAEFPKTWPI*
Ga0070699_10040128023300005518Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDEEELMKLLKSFKTKYADDPEWAQLRAGFPKSWPI*
Ga0070699_10118531823300005518Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDQAELLTLLKSFKKKYAGDEEWAKIRAGFPKTWPI*
Ga0070699_10143731213300005518Corn, Switchgrass And Miscanthus RhizosphereMVSNVLDMDQEELAKLLKSFKTKYAKDPEWIEIRAGFPKTWPI*
Ga0068853_10125565413300005539Corn RhizosphereMVSNVLGTDDDELIKQIKSFKTKYAGDPEWEEIRAGFPKSWPI*
Ga0066701_1027060323300005552SoilMVSNVLDMDQGELVKQLKSFKKKYAGDAEWIEIRAGFPKSWPI*
Ga0066698_1092530513300005558SoilMDQAELTKQLKSFKTKYAGDPEWIEIRAGFPKSWPI*
Ga0066700_1015986443300005559SoilMVSNVLDLDQKDLVKQLKSFKTKYAGDAEWIEIRAGFPKSWPI*
Ga0066703_1006862343300005568SoilMVSNVLDLDQKELVKQLKSFKTKYDGDADWIEIRARFPKSWPI*
Ga0068857_10005134273300005577Corn RhizosphereMVSNVLGTDEDELIKQLKSFKTKYAGDPEWEEIRAGFPKSWPI*
Ga0068860_10026900643300005843Switchgrass RhizosphereMVSNVLGTDEAELIKQLKSFKTKYAGDPEWEEIRAGFPKSWPI*
Ga0075417_1000697173300006049Populus RhizosphereMVSNVLDMDQEELVKLLKSFKTKYADDTEWSEIRAGFPKTWPI*
Ga0075417_1028856233300006049Populus RhizosphereMVSNVLEMDQEELVKLLKSFKTKYKGDPEWDDVRTGFPKSWPI*
Ga0075430_10126856313300006846Populus RhizosphereMVSNVLDMDQEELVKQLKSFKTKYAGDPEWDQIRADFPKSWPI*
Ga0075433_1008829043300006852Populus RhizosphereMVSNVLGTDEDELIKQIKSFRTKHAGDPEWEEIRAGFPKSWPI*
Ga0075433_1015102843300006852Populus RhizosphereMVSNVLEMDQEELMKLLKSFKTKYAEDPEWAQLRAGFPKSWPI*
Ga0075433_1163890813300006852Populus RhizosphereMVSNVLDMDQEELAKLLKSFKTKYAKDPEWLELRAGFPKTWPI*
Ga0075434_10023529943300006871Populus RhizosphereMVSNVLEMDQEELTKLLKSFKTKYAEDPEWAQLRAGFPKSWPI*
Ga0079217_1001140433300006876Agricultural SoilMVSNVLDMDQEELVKLLKSFKTKYADDAEWSDIRADFPKTWPI*
Ga0079217_1041213923300006876Agricultural SoilMVSNVLEMDHEALVKLLKSFKTKYAGDTEWAEIRAGFPKTWPI*
Ga0068865_10147571013300006881Miscanthus RhizosphereSLGFEETTGMVSNVLEMDQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI*
Ga0079215_1002071223300006894Agricultural SoilMVSNVLDMDQEELVKLLKSFKTKYADDAEWSEIRAGFPKTWPI*
Ga0079215_1069401113300006894Agricultural SoilHEALVKLLKSFKTKYAGDTEWAEIRAGFPKTWPI*
Ga0075424_10017839913300006904Populus RhizosphereMDQEELAKLLKSFKTKYAKDPEWIEIRAGFPKAWPI*
Ga0079218_1046199013300007004Agricultural SoilMVSNVLEMDQEELVKQLKSFKTKYAGDTEWAEVRAGFPKTWPI*
Ga0079218_1388891723300007004Agricultural SoilMVSNVLDMDHEELVKLLKSFKTKYAGDTEWTEIRAGFPKTWPI*
Ga0099791_1015931123300007255Vadose Zone SoilMVSNVLDMDQEELVKLLKSFKGKYARDPEWIEIRAGFPKTWPI*
Ga0099794_1042247923300007265Vadose Zone SoilMVSNVLEMDQEELVKLLKSFKTKYAGDPAWNEIRAGFPKSWPI*
Ga0066710_10035615843300009012Grasslands SoilMVSNVLEMDQEELVKQLKSFKTKYAGDGEWIALRAGFPKSWPI
Ga0099829_1139312613300009038Vadose Zone SoilMVSNVLDMDQEELVTLLKSFKAKYARDPEWIEIRAGFPKTWPI*
Ga0099830_1096231823300009088Vadose Zone SoilMVSNVLEIDQEELVKLLQSFKTKYAGDTEWNEIRAGLPKSWPI*
Ga0099828_1003721963300009089Vadose Zone SoilMVSNVLEMDQEELLTLLKSFKKKYAGDEEWAKIRAGFPKAWPI*
Ga0099828_1018458633300009089Vadose Zone SoilMVSNVLDMDQEELVKLLKSFKAKYARDPEWIEIRAGFPKTWPI*
Ga0099827_1000547483300009090Vadose Zone SoilMVSNVLDMDQDELMKQLKSFKTKYTSDPEWIEIRAGFPKSWPI*
Ga0105245_1328612123300009098Miscanthus RhizosphereGFEETTGMVSNVLGTDEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI*
Ga0111538_1066586233300009156Populus RhizosphereMVSNVLGTDEDELIKQIKSFRTKYAGDPEWEEIRAGFPKSWPI*
Ga0105241_1126250123300009174Corn RhizosphereMVSNVLGTDEDELMKQIKSFKTKYAGDPEWEEIRAGFPKSWPI*
Ga0105056_107356023300009801Groundwater SandMVSNVLDMDQEELVKLLTSFKTKYAEDTEWIEIRAGFPKTWPI*
Ga0105084_110684323300009811Groundwater SandMVSNVLDMDQEELVTLLKSFKTKYAEDTEWIEIRAGFPKTWPI*
Ga0134088_1044227723300010304Grasslands SoilMVSNVLDMDQDELMKQLKSFKTKYAGDPEWIEIRAGFPKSWPI*
Ga0134109_1026735823300010320Grasslands SoilMVSNVLDMDQGELVKQLKSFKKKYGGDAEWTEVRAGFPKSWPI*
Ga0134086_1013855523300010323Grasslands SoilMVSNVLDMDQDKLMKQLKSFKTKYAGDGEWIALRAGFPKSWPI*
Ga0134080_1051604023300010333Grasslands SoilMVSNVLEMDQEELVKQLKSFKKKYAGDAEWTEVRAGFPKSWPI*
Ga0134071_1047536813300010336Grasslands SoilMVSNVLDMDQDELMKQLKSFKTKYAGDPEWMEIRAGFPKSWPI*
Ga0134122_1091559633300010400Terrestrial SoilMVSNVLEMGQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI*
Ga0105246_1230135813300011119Miscanthus RhizosphereFEETTGMVSNVLGTDDDELIKQIKSFKTKYAGDPEWEEIRAGFPKSWPI*
Ga0137391_1042352623300011270Vadose Zone SoilMVSNVLDMDQKELVTLLKSFKAKYARDPEWIEIRAGFPKTWPI*
Ga0137391_1062047523300011270Vadose Zone SoilMVSNVLEIDQEELVKLLQSFRARYAGDAEWNAVRAGFPKTWPI*
Ga0137389_1032270033300012096Vadose Zone SoilMVSNVLEMDQEELLTLLKSFKKKYAGDEEWAKIRAGFPKSWPI*
Ga0137364_1009962043300012198Vadose Zone SoilMVSNVLDMDQGELVKQLKSFKKKYAGDAEWTEIRAGFPKSWPI*
Ga0137363_1025041223300012202Vadose Zone SoilMVSNVLDMDQGELVKQLKSFKTKYAGDAEWIEIRAGFPKSWPI*
Ga0137399_1021623323300012203Vadose Zone SoilMDQEDLVKLLKSFKKKYAGDPDWDEIRAGFPKSWPI*
Ga0137399_1053205223300012203Vadose Zone SoilMVSNVLDIDEDELAKRLKSFKTKYKDDPEWEKIRAGFPKSWPI*
Ga0137374_10002167273300012204Vadose Zone SoilMVSNVLEMDQTELVALLKSFKKKYAGDPEWKKVRAEFPKSWPI*
Ga0137374_1005409623300012204Vadose Zone SoilMVSNVLEMDQEALMKLLKSFKKKYAGDPEWDGIRAGFPKSWPI*
Ga0137374_1011270433300012204Vadose Zone SoilMVSNVLDMDQEELVKLLKSFKTKYNGDPEWDQIRADFPKSWPI*
Ga0137374_1127120523300012204Vadose Zone SoilMVSNVLEMDTEELMALLKSFKTKYGGDPEWEQIRAGFPKSWPI*
Ga0137380_1024142233300012206Vadose Zone SoilMVSNVLEMDQEELVKQLKSFKTKYAGDAEWTRVRAGFPKSWPI*
Ga0137380_1087505623300012206Vadose Zone SoilMVSNVLDMDQDELTKQLKSFKTKYAGDAEWIALRAGFPKSWPI*
Ga0137381_1081526723300012207Vadose Zone SoilMVSNVLDMDQDELTKQLKSFKTKYAGDPEWIEIRTGFPKSWPI*
Ga0137381_1101307923300012207Vadose Zone SoilMDQGELVKQLKSFKTKYSGDAEWTRVRAGFPKSWPI*
Ga0137372_1116235223300012350Vadose Zone SoilMVSNVLDMDQGELMKQLKSFKTKYAGDPEWIEIRTGFPKSWPI*
Ga0137386_1076639323300012351Vadose Zone SoilMVSNVLEMDQEELVKQLKSFKTKYAGDPEWIEIRTGFPKSWPI*
Ga0137369_1005951653300012355Vadose Zone SoilMVSNVLEMDQEALTKLLKSFKKKYAGDPEWDGIRAGFPKSWPI*
Ga0137369_1024994633300012355Vadose Zone SoilMVSNVLEMDQEELVKQLKSFKTKYKGDPEWVEVRADFPKSWPI*
Ga0137368_1070615423300012358Vadose Zone SoilMVSNVLDMDQEELMKLLKSFKTKYKGDPEWDEVRADFPKSWPI*
Ga0137385_1031569833300012359Vadose Zone SoilMVSNVLDMDQDELTKQLKSFKTKYAGDAEWTRVRAGFPKSWPI*
Ga0137361_1055370413300012362Vadose Zone SoilMVSNVLDMDQGELVKQLKSFKTKYAGDAEWTRVRAGFPKTWPI*
Ga0137373_1007620433300012532Vadose Zone SoilMVSNVLDMDQEELVKLLKSFKTKYNGDPEWDQIRVDFPKSWPI*
Ga0137397_1021834723300012685Vadose Zone SoilMVSNVLDMDQEDLVKLLKSFKKKYADDPDWDEIRAGFPKSWPI*
Ga0137396_1029461623300012918Vadose Zone SoilMVSNVLEMEQEELMKLLKSFRTKYAGDPDWEKIRAGFPKSWPI*
Ga0137396_1066883433300012918Vadose Zone SoilMVSNVLDIDEDELAKRLKSFKTKYKDDPEWEKIRAGFPKSW
Ga0137394_1048261023300012922Vadose Zone SoilMVSNVLDMDQEDLVKLLKSFKKKYAGDPDWDEIRAGFPKSWPI*
Ga0137407_1110701133300012930Vadose Zone SoilMVSNVLEMDHDELMKLLKSFNTKYAGDPEWDQIRAGFPKSW
Ga0137410_1147514923300012944Vadose Zone SoilMVSNVLDMDQKELVKLLKSFKAKYARDPEWIEIRAGFPKTWPI*
Ga0137410_1147522423300012944Vadose Zone SoilSNVLDIDEDELAKRLKSFKTKYKDDPEWEKTRAGFPKSWPI*
Ga0157378_1266060623300013297Miscanthus RhizosphereGMVSNVLGTDEDELMKQIKSFKTKYAGDPEWEEIRAGFPKSWPI*
Ga0134075_1002105543300014154Grasslands SoilMVSNVLDMDQAELTKQLKSFKTKYAGDPEWIEIRAGFPKSWPI*
Ga0120193_1009558723300014965TerrestrialMVSNVLEMDQGELVKLLKSFKTKYAGDPEWAEVRAGFPKSWPI*
Ga0137418_1121148423300015241Vadose Zone SoilMVSNVLETDQEELMKLLKSFRTKYAGDPEWEKIRAGFPKSWPF*
Ga0180070_105288513300015251SoilMVSNVLDIDQKELVEQLKSFKKKYAGDAEWDELRAGFPKTWPI*
Ga0134089_1002616933300015358Grasslands SoilMVSNVLEMDQEELVKQLKSFKTKYVGDPEWIEIRAGFPKSWPI*
Ga0132257_10366584213300015373Arabidopsis RhizosphereMVSNVLEMDQEKLVKLLKSFKTKYAGDPEWEKIRAGFPKSWPI*
Ga0132255_10299335223300015374Arabidopsis RhizosphereMVSNVLEMDQEKLVKLLKSFKTKYAGDPEWEKIRAGLPRSWPI*
Ga0134083_1019198013300017659Grasslands SoilMVSNVLEMDQEELVKQLKSFKTKYVGDPEWIEIRAGFPKSWPI
Ga0184610_102121033300017997Groundwater SedimentMVSNVLDIDQEELVEQLKSFKKKYAGDAEWGEIRAGFPKSWPI
Ga0184610_107824423300017997Groundwater SedimentMVSNVLDMDQEELVKLLKSFKTKYAEDTEWSEIRAGFPKTWPI
Ga0184604_1000993143300018000Groundwater SedimentMVSNVLETDQEELMKLLKSFKTKYAKDPEWDEIRAGFPKSWPI
Ga0184605_1005375523300018027Groundwater SedimentMVSNVLDMDQEDLVKLLKSFKKKYAGDPDWDEIRAGFPKSWPI
Ga0184605_1044962223300018027Groundwater SedimentMVSNVLETDQEELMKLLKSFKTKYAGDPEWEQVRAGFPKSWPI
Ga0184608_1001581533300018028Groundwater SedimentMVSNVLEMDQEKLMKLLKSFKTKYAEDPEWEQIRAGFPKSWPI
Ga0184634_1025043223300018031Groundwater SedimentMVSNVLDIDQEELVRQLKSFKTKYAGDPEWDEIRAGFPKTWPI
Ga0184638_116330113300018052Groundwater SedimentMVSNVLEMDAEELMKLLKSFKTKYAEDPEWEQIRAGFPKSWPI
Ga0184638_122718623300018052Groundwater SedimentMVSNVLEMDQEELMKLLTSFKTKYAEDPEWEQLRAGFPKSWPI
Ga0184623_1002100733300018056Groundwater SedimentMVSNVLDMDQEELVKLLKSFKTKYAGDTEWSEIRAGFPKTWPI
Ga0184637_1023753023300018063Groundwater SedimentMVSNVLDIDQEELLEQLTSFKKKYAGDAEWDEIRAGFPKSWPI
Ga0184618_1001174643300018071Groundwater SedimentMVSNVLETDQEELMKLLKSFKTKYAGDPEWEQLRAGFPKSWPI
Ga0184618_1005101923300018071Groundwater SedimentMVSNVLEMDQEELMKLLKSFKTKYAEDPEWEQIRTGFPKSWPI
Ga0184640_1006384833300018074Groundwater SedimentMVSNVLDMDEEELVKQLKSFKTKYAQDPEWDDIRAGFPKSWPI
Ga0184609_1005204233300018076Groundwater SedimentMVSNVLEMDQEELMKLLKSFKTKYAEDPEWEQLRAGFPKSWPI
Ga0184609_1029769623300018076Groundwater SedimentMVSNVLDMDQEELVKLLKSFKTKYAEDTEWSEIRSGFPKTWPI
Ga0190272_1147189123300018429SoilMVSNVLDMDQEELVKLLKSFKTKYAEDVEWSEIRAGFPKTWPI
Ga0066655_1028801123300018431Grasslands SoilMVSNVLDMDQGELVKQLKSFKKKYAGDAEWTEVRAGFPKSWPI
Ga0066655_1050721733300018431Grasslands SoilMVSNVLDMDQAELTKQLKSFKTKYVGDPEWIEIRAGFPKSWPI
Ga0066667_1006356933300018433Grasslands SoilMVSNVLDMDQGELVKQLKSFKKKYAGDAEWIEIRAGFPKSWPI
Ga0193715_104647723300019878SoilMVSNVLEMDEEELMKLLKSFKTKYAEDPEWAQLRAGFPKSWPI
Ga0193710_103287823300019998SoilMVSNVLETDQEELMKLLKSFKTKYAGDPEWEQIRAGFPKSWPI
Ga0210382_1015916733300021080Groundwater SedimentMVSNVLETDQEELVKLLKSFKTTYAGDAEWEQLRADLPKSWPI
Ga0193699_1028345913300021363SoilMVSNVLEMDEEELMKLLKSFKTKYADDPEWDEIRAGLPKSWPL
Ga0222623_1024556033300022694Groundwater SedimentNVLETDQEELMKLLKSFKTKYAGDPEWEQIRAGFPKSWPI
Ga0207653_10000793133300025885Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDQEELTKLLKSFKTKYADDPEWEQLRAGFPKSWPI
Ga0207653_1004088943300025885Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDQEELTKLLKSFKTKYAGDAEWEQLRAGFPKSWPI
Ga0207645_1019013133300025907Miscanthus RhizosphereMVSNVLGTDEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI
Ga0207643_1045870123300025908Miscanthus RhizosphereMVSNVLGTDEDELIKQLKSFKTKYAGDPEWEEIRAGFPKSWPI
Ga0207684_10000041833300025910Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDQEELAKLLKSFKTKYAKDPEWLEVRAGFPKTWPI
Ga0207684_1004629173300025910Corn, Switchgrass And Miscanthus RhizosphereMVSNVLDMDQEELAKLLKSFKTKYTGDPEWIEIRAGFPKSWPI
Ga0207684_1037483613300025910Corn, Switchgrass And Miscanthus RhizosphereMVSNVLDMDQEELAKLLKSFKTKYAKDPEWIQIRAGFPKAWPI
Ga0207684_1108553023300025910Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDEEELMKLLKSFKTKYADDPEWAQLRAGFPKSWPI
Ga0207657_1033163433300025919Corn RhizosphereMVSNVLGTDDDELIKQIKSFKTKYAGDPEWEEIRAGFPKSWPI
Ga0207646_1120620013300025922Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDQEELVALLRSFKKKYAGDPEWKKIRAEFPKTWPI
Ga0207646_1123804723300025922Corn, Switchgrass And Miscanthus RhizosphereMVSNVLEMDQEELAKLLKSFKTKYAKDPEWLEVRAGFPKAWPI
Ga0207681_1173362723300025923Switchgrass RhizosphereDEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI
Ga0207706_1085758113300025933Corn RhizosphereSNVLGTDDDELIKQIKSFKTKYAGDPEWEEIRAGFPKSWPI
Ga0207640_1105536813300025981Corn RhizosphereSNVLGTDEDELMKQIKSFKAKYAGDPEWEEIRAGFPKSWPI
Ga0209438_100710773300026285Grasslands SoilMVSNVLEMDHDELMKLLKSFNTKYAGDPEWDQIRAGFPKSWPL
Ga0209470_103164843300026324SoilMVSNVLDMDQAELTKQLKSFKTKYAGDPEWIEIRAGFPKSWPI
Ga0209801_133329223300026326SoilMVSNVLDMDQGELVKQLKSFKTKYAGDAEWTRVRAGFPKSWPI
Ga0209058_107040333300026536SoilMVSNVLGMDQAELTKQLKSFKTKYVGDPEWIEIRAGFPKSWPI
Ga0209157_105947853300026537SoilMDQDKLMKQLKSFKTKYAGDPEWIEIRAGFPKSWPI
Ga0208997_103043123300027181Forest SoilMVSNVLEMDEEELMKLLKSFRTKYAGDPEWEKIRAGFPKSWPI
Ga0208995_103220433300027388Forest SoilMVSNVLEMDEEELMKLLKSFRTKYAGDPEWEKVRAGFPKSWPM
Ga0208993_107258913300027480Forest SoilMVSNVLETDQEELVTLLKSFRTKYAGDPEWEKIRAGFPKSWPI
Ga0209874_111395623300027577Groundwater SandMVSNVLDMDQEELVKLLKSFKTKYAEDTEWIEIRAGFPKTWPI
Ga0209818_106287123300027637Agricultural SoilMVSNVLEMDHEALVKLLKSFKTKYAGDTEWAEIRAGFPKTWPI
Ga0209818_107062623300027637Agricultural SoilMVSNVLDMDQEELVKLLKSFKTKYADDAEWSDIRADFPKTWPI
Ga0209117_100373353300027645Forest SoilMVSNVLEMDQEALVRLLKSFGTTYAGDPEWEKIRAGFPKAWPL
Ga0209388_101363343300027655Vadose Zone SoilMVSNVLDMDQEELVKLLKSFKGKYARDPEWIEIRAGFPKTWPI
Ga0209011_109548523300027678Forest SoilMVSNVLEMDQEGLVTLLKSFRTKYAGDPEWEQIRAGFPK
Ga0209485_113999513300027691Agricultural SoilMVSNVLEMDQEELVKQLKSFKTKYAGDTEWAEVRAGFPKTWPI
Ga0208989_1006114623300027738Forest SoilMVSNVLETDQEELVTLLKSFRTKYAGDPEWEKIRAGFPKSWPF
Ga0209814_1002853023300027873Populus RhizosphereMVSNVLDMDQEELVKLLKSFKTKYADDTEWSEIRAGFPKTWPI
Ga0209814_1025061113300027873Populus RhizosphereTTGMVSNVLEMDQEELVKLLKSFKTKYKGDPEWDDVRTGFPKSWPI
Ga0209283_1005851913300027875Vadose Zone SoilSLGFEETTGMVSNVLDMDQEELVKLLKSFKAKYARDPEWIEIRAGFPKTWPI
Ga0209283_1027216223300027875Vadose Zone SoilMVSNVLEMDQEELLTLLKSLKKKYAGDEEWAKIRAGFPKSWPI
Ga0209590_1001546233300027882Vadose Zone SoilMVSNVLDVDQDELMKQLKSFKTKYTSDPEWIEIRAGFPKSWPI
Ga0209486_1131657213300027886Agricultural SoilMVSNVLDMDHEELVKLLKSFKTKYAGDTEWTEIRAGFPKTWPI
Ga0268264_1016929513300028381Switchgrass RhizosphereMVSNVLGTDEAELIKQLKSFKTKYAGDPEWEEIRAGFPKSWPI
Ga0307293_1011746613300028711SoilSNVLEMDEEELMKLLKSFKTKYAEDPEWAQLRAGFPKSWPI
Ga0307311_1011474133300028716SoilDEEELMKLLKSFKTKYAGDPEWAQLRAGFPKSWPI
Ga0307282_1013797923300028784SoilMVSNVLDMDQEDLVKLLKSFKAKYAGDPEWGEIRAGFPKSWPI
Ga0307284_1021181523300028799SoilMVSNVLEMDEEELMKLLKSFKPKYAEDPEWAQLRAGFPKSWPI
Ga0307305_1001817743300028807SoilMVSNVLEMDQEELMKLLKSFKTKYAEDPEWEQIRAGFPKSWPI
Ga0307302_1015710223300028814SoilMVSNVLEVDQEELMKLLKSFKTKYAEDPEWEQLRAGFPKSWPI
Ga0307310_1037596713300028824SoilDQEELMKLLKSFKTKYAEDPEWDQIRTGFPKSWPI
Ga0307312_1070531913300028828SoilMVSNVLDMDQEDLVKLLKSFKKKYAGDPEWGEIRAGFPKSWPI
Ga0307278_1054608823300028878SoilMVSNVLEMDQEELMKLLKSFKAKYAEDPEWEQIRTGFPKSWPI
Ga0307277_1021866933300028881SoilSNVLDMDQEDLVKLLKSFKKKYAGDPDWDEIRAGFPKSWPI
Ga0326597_1008335573300031965SoilMVSNVLEMDQEELVKLLKSFKKKYAGDPEWDEIRAGFPKSWPI
Ga0364934_0249141_364_4953300034178SedimentMVSNVLEMDQEALVEQLKSFKMKYTGDAEWDEIRAGFPRSWPI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.