NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F031865

Metagenome / Metatranscriptome Family F031865

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031865
Family Type Metagenome / Metatranscriptome
Number of Sequences 181
Average Sequence Length 48 residues
Representative Sequence MSFETLKVSELKKIAEDFAVDTDGLKNKADIIAALAEEGVTWSVYNKT
Number of Associated Samples 161
Number of Associated Scaffolds 181

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 96.57 %
% of genes near scaffold ends (potentially truncated) 93.92 %
% of genes from short scaffolds (< 2000 bps) 82.87 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.66

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (81.215 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater
(20.442 % of family members)
Environment Ontology (ENVO) Unclassified
(47.514 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(63.536 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.16%    β-sheet: 0.00%    Coil/Unstructured: 61.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.66
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 181 Family Scaffolds
PF05065Phage_capsid 25.97
PF04586Peptidase_S78 4.42
PF04860Phage_portal 3.87
PF01844HNH 2.21
PF07498Rho_N 1.66
PF02037SAP 1.10
PF136402OG-FeII_Oxy_3 1.10
PF10142PhoPQ_related 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 181 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 25.97
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 4.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.50 %
UnclassifiedrootN/A10.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035265000|ErSWdraf_F5BXKTZ02G5S13Not Available513Open in IMG/M
2189573028|GS313G0146KB_1113353991079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes777Open in IMG/M
3300000268|M3P_10099935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay918Open in IMG/M
3300000756|JGI12421J11937_10145225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes592Open in IMG/M
3300002161|JGI24766J26685_10007661Not Available2975Open in IMG/M
3300002161|JGI24766J26685_10040433All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1077Open in IMG/M
3300002203|metazooDRAFT_1312580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1724Open in IMG/M
3300002408|B570J29032_109158934All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes616Open in IMG/M
3300002447|JGI24768J34885_10026390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1936Open in IMG/M
3300003412|JGI25912J50252_10137285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes567Open in IMG/M
3300003413|JGI25922J50271_10002385All Organisms → cellular organisms → Bacteria5455Open in IMG/M
3300003413|JGI25922J50271_10058976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes849Open in IMG/M
3300003429|JGI25914J50564_10125922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes624Open in IMG/M
3300004124|Ga0066178_10258223Not Available508Open in IMG/M
3300004769|Ga0007748_10194908All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes727Open in IMG/M
3300004773|Ga0007795_10165162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes621Open in IMG/M
3300004793|Ga0007760_10071992All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300004796|Ga0007763_10134517All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1683Open in IMG/M
3300005517|Ga0070374_10191023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1056Open in IMG/M
3300005585|Ga0049084_10131441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes882Open in IMG/M
3300005662|Ga0078894_10306392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1440Open in IMG/M
3300005662|Ga0078894_11549617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes548Open in IMG/M
3300006040|Ga0073914_10089251Not Available598Open in IMG/M
3300006484|Ga0070744_10163235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes638Open in IMG/M
3300006805|Ga0075464_10627344Not Available662Open in IMG/M
3300007544|Ga0102861_1179103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes579Open in IMG/M
3300007555|Ga0102817_1119235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes584Open in IMG/M
3300007559|Ga0102828_1088821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes745Open in IMG/M
3300007560|Ga0102913_1131161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes811Open in IMG/M
3300007590|Ga0102917_1193469All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes710Open in IMG/M
3300007617|Ga0102897_1043038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1436Open in IMG/M
3300007647|Ga0102855_1213341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes515Open in IMG/M
3300007715|Ga0102827_1084130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes717Open in IMG/M
3300007954|Ga0105739_1013322All Organisms → Viruses → Predicted Viral1635Open in IMG/M
3300007972|Ga0105745_1136474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes744Open in IMG/M
3300008052|Ga0102893_1045846All Organisms → Viruses → Predicted Viral1328Open in IMG/M
3300008107|Ga0114340_1177960All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes747Open in IMG/M
3300008110|Ga0114343_1061895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2086Open in IMG/M
3300008110|Ga0114343_1194705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes593Open in IMG/M
3300008113|Ga0114346_1301671All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes551Open in IMG/M
3300008114|Ga0114347_1041723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales2004Open in IMG/M
3300008114|Ga0114347_1202287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes659Open in IMG/M
3300008114|Ga0114347_1225489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes599Open in IMG/M
3300008259|Ga0114841_1079603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1489Open in IMG/M
3300008261|Ga0114336_1266860All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes670Open in IMG/M
3300008262|Ga0114337_1231225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes725Open in IMG/M
3300008450|Ga0114880_1240570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes573Open in IMG/M
3300008507|Ga0110934_1075136Not Available994Open in IMG/M
3300009024|Ga0102811_1001089Not Available12899Open in IMG/M
3300009159|Ga0114978_10465931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage747Open in IMG/M
3300009163|Ga0114970_10400227All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes763Open in IMG/M
3300009183|Ga0114974_10293253All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage959Open in IMG/M
3300009194|Ga0114983_1129489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes546Open in IMG/M
3300009419|Ga0114982_1111968All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes842Open in IMG/M
3300010157|Ga0114964_10109654All Organisms → Viruses → Predicted Viral1364Open in IMG/M
3300010370|Ga0129336_10579141Not Available600Open in IMG/M
3300011268|Ga0151620_1024848All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2067Open in IMG/M
3300011984|Ga0119931_1035769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes594Open in IMG/M
3300012012|Ga0153799_1092877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes538Open in IMG/M
3300012723|Ga0157604_1002431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1932Open in IMG/M
3300012726|Ga0157597_1257508Not Available572Open in IMG/M
(restricted) 3300013132|Ga0172372_10147048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1872Open in IMG/M
3300013310|Ga0157622_1194428All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage949Open in IMG/M
3300017774|Ga0181358_1042558All Organisms → Viruses → Predicted Viral1740Open in IMG/M
3300020074|Ga0194113_10465422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay915Open in IMG/M
3300020159|Ga0211734_10215603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes695Open in IMG/M
3300020160|Ga0211733_10179378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1342Open in IMG/M
3300020160|Ga0211733_10580078All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1649Open in IMG/M
3300020161|Ga0211726_10353618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage18648Open in IMG/M
3300020190|Ga0194118_10062952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2386Open in IMG/M
3300020221|Ga0194127_10446973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes845Open in IMG/M
3300020222|Ga0194125_10273195All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1140Open in IMG/M
3300020506|Ga0208091_1025789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes670Open in IMG/M
3300020511|Ga0208593_1001991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2858Open in IMG/M
3300020524|Ga0208858_1017039All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1147Open in IMG/M
3300020548|Ga0208856_1046978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay567Open in IMG/M
3300020561|Ga0207934_1020357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1116Open in IMG/M
3300020573|Ga0208485_1009731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2181Open in IMG/M
3300020574|Ga0208221_1007299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2112Open in IMG/M
3300021962|Ga0222713_10333810All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes954Open in IMG/M
3300021963|Ga0222712_10471486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes748Open in IMG/M
3300022190|Ga0181354_1230716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes537Open in IMG/M
3300023184|Ga0214919_10348113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes990Open in IMG/M
3300024306|Ga0255148_1031314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes986Open in IMG/M
3300024346|Ga0244775_10693151All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes821Open in IMG/M
3300024346|Ga0244775_11049221All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay641Open in IMG/M
3300024346|Ga0244775_11091632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes626Open in IMG/M
3300024351|Ga0255141_1012398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1332Open in IMG/M
3300024352|Ga0255142_1008079All Organisms → Viruses1755Open in IMG/M
3300024352|Ga0255142_1012006All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1422Open in IMG/M
3300024355|Ga0255157_1032096All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes889Open in IMG/M
3300024356|Ga0255169_1038166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes851Open in IMG/M
3300024494|Ga0255194_1063237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay512Open in IMG/M
3300024496|Ga0255151_1003257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay3183Open in IMG/M
3300024501|Ga0255208_1059726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay533Open in IMG/M
3300024503|Ga0255152_1033989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes942Open in IMG/M
3300024507|Ga0255176_1034676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes969Open in IMG/M
3300024513|Ga0255144_1034867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes858Open in IMG/M
3300024540|Ga0255300_1003768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay2394Open in IMG/M
3300024555|Ga0255280_1026999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1201Open in IMG/M
3300024565|Ga0255273_1061983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes860Open in IMG/M
3300024572|Ga0255268_1133001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes619Open in IMG/M
3300024848|Ga0255229_1080741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300024855|Ga0255281_1046584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes889Open in IMG/M
3300024866|Ga0255272_1107531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes697Open in IMG/M
3300025606|Ga0207954_1118823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes640Open in IMG/M
3300026457|Ga0255160_1051308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes696Open in IMG/M
3300026459|Ga0255170_1025045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1127Open in IMG/M
3300026473|Ga0255166_1035328All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1025Open in IMG/M
3300026570|Ga0255274_1118952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes671Open in IMG/M
3300027121|Ga0255074_1042595All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes564Open in IMG/M
3300027133|Ga0255070_1001452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay5103Open in IMG/M
3300027138|Ga0255064_1010352All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1678Open in IMG/M
3300027211|Ga0208307_1071506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay503Open in IMG/M
3300027234|Ga0208170_1075514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes629Open in IMG/M
3300027292|Ga0255134_1076754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes521Open in IMG/M
3300027302|Ga0255096_1008539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2622Open in IMG/M
3300027311|Ga0208812_1065934All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes738Open in IMG/M
3300027467|Ga0255154_1026308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1353Open in IMG/M
3300027489|Ga0255095_1044375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes820Open in IMG/M
3300027508|Ga0255072_1030720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1124Open in IMG/M
3300027529|Ga0255077_1042549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes841Open in IMG/M
3300027541|Ga0255158_1006646All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2732Open in IMG/M
3300027578|Ga0255075_1065575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes642Open in IMG/M
3300027600|Ga0255117_1056956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes785Open in IMG/M
3300027601|Ga0255079_1024015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1393Open in IMG/M
3300027621|Ga0208951_1189272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes519Open in IMG/M
3300027627|Ga0208942_1101883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes815Open in IMG/M
3300027631|Ga0208133_1083800All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes750Open in IMG/M
3300027644|Ga0209356_1103436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes828Open in IMG/M
3300027688|Ga0209553_1173202All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes719Open in IMG/M
3300027733|Ga0209297_1007939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay5293Open in IMG/M
3300027734|Ga0209087_1120590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1087Open in IMG/M
3300027759|Ga0209296_1389953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes524Open in IMG/M
3300027769|Ga0209770_10060333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1598Open in IMG/M
3300027769|Ga0209770_10400632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay508Open in IMG/M
3300027782|Ga0209500_10392995All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300027785|Ga0209246_10367563Not Available544Open in IMG/M
3300027797|Ga0209107_10287376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes778Open in IMG/M
3300027892|Ga0209550_10088392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2354Open in IMG/M
3300028025|Ga0247723_1052055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1167Open in IMG/M
(restricted) 3300028114|Ga0247835_1105817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1087Open in IMG/M
3300028393|Ga0304728_1112716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1026Open in IMG/M
3300031758|Ga0315907_10178732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1787Open in IMG/M
3300031787|Ga0315900_11122610Not Available504Open in IMG/M
3300031857|Ga0315909_10544534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes789Open in IMG/M
3300031951|Ga0315904_10088012All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay3301Open in IMG/M
3300031951|Ga0315904_10242157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1733Open in IMG/M
3300031963|Ga0315901_10066622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay3443Open in IMG/M
3300031963|Ga0315901_10363967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1172Open in IMG/M
3300032050|Ga0315906_10621349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes885Open in IMG/M
3300032050|Ga0315906_11006201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes626Open in IMG/M
3300032092|Ga0315905_10679103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay917Open in IMG/M
3300032092|Ga0315905_11098725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay659Open in IMG/M
3300032093|Ga0315902_11315938All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes508Open in IMG/M
3300032116|Ga0315903_10056792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay3948Open in IMG/M
3300032116|Ga0315903_11046151All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes566Open in IMG/M
3300033992|Ga0334992_0013703All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay5232Open in IMG/M
3300033992|Ga0334992_0014439All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay5071Open in IMG/M
3300034018|Ga0334985_0115113All Organisms → Viruses1879Open in IMG/M
3300034050|Ga0335023_0581284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes571Open in IMG/M
3300034061|Ga0334987_0211356All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1355Open in IMG/M
3300034063|Ga0335000_0500829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes701Open in IMG/M
3300034071|Ga0335028_0654588All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes556Open in IMG/M
3300034073|Ga0310130_0027854All Organisms → Viruses1753Open in IMG/M
3300034082|Ga0335020_0211864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay966Open in IMG/M
3300034093|Ga0335012_0141776All Organisms → Viruses → Predicted Viral1314Open in IMG/M
3300034093|Ga0335012_0179042All Organisms → Viruses → Predicted Viral1136Open in IMG/M
3300034105|Ga0335035_0128844All Organisms → Viruses → Predicted Viral1609Open in IMG/M
3300034105|Ga0335035_0264091Not Available1030Open in IMG/M
3300034106|Ga0335036_0886842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes507Open in IMG/M
3300034120|Ga0335056_0013701All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay5720Open in IMG/M
3300034122|Ga0335060_0030873Not Available3485Open in IMG/M
3300034200|Ga0335065_0476272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes751Open in IMG/M
3300034284|Ga0335013_0489635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes738Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater20.44%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater15.47%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake10.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater7.73%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.18%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton5.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.76%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.76%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.66%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.66%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment1.10%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.10%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.10%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.10%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.55%
LoticEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic0.55%
Drinking Water Treatment PlantEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant0.55%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.55%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.55%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.55%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.55%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.55%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.55%
WastewaterEngineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater0.55%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2035265000Freshwater microbial communities from Swedish Lakes - surface of Lake ErkenEnvironmentalOpen in IMG/M
2189573028Estuarine microbial communities from Columbia River, sample from South Channel ETM site, CMGS313-FOS-0p8-ETM-15mEnvironmentalOpen in IMG/M
3300000268Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2EnvironmentalOpen in IMG/M
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002203Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002447Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion MetagenomeEnvironmentalOpen in IMG/M
3300003412Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DDEnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300003429Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004124Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004773Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1MEnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006040Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_30-Apr-14EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007617Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02EnvironmentalOpen in IMG/M
3300007647Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008507Wastewater microbial communities from the domestic sewers in Singapore - Site 2EngineeredOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300011984Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107EnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012708Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012723Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012726Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013310Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020511Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020524Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020548Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020561Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020573Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020574Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024351Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024355Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300024356Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8dEnvironmentalOpen in IMG/M
3300024494Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300024496Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300024501Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8dEnvironmentalOpen in IMG/M
3300024503Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300024507Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300024513Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300024540Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024555Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024565Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024572Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024848Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024855Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024866Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025606Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes)EnvironmentalOpen in IMG/M
3300026457Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300026459Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300026473Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300026570Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027133Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300027138Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300027211Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027234Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027292Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8dEnvironmentalOpen in IMG/M
3300027302Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300027311Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027467Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8hEnvironmentalOpen in IMG/M
3300027489Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8dEnvironmentalOpen in IMG/M
3300027508Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027529Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027541Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8hEnvironmentalOpen in IMG/M
3300027578Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027601Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027627Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034109Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ErSWdraft_102280802035265000FreshwaterMSFETLKVSELKKIAEDFAVDTDNLKNKADVIAALTEEGVTFAVYQKTLKKY
GS313G0146KB_003485302189573028Marine EstuarineMSFDTLKVAELKVIAEDFAVDTEGLKNKKDIIAALSEEGVSWSVYQKT
M3P_1009993513300000268LoticMSFETLKVAELRKIAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIKDI
JGI12421J11937_1014522513300000756Freshwater And SedimentMSFETLKVAELRKIAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIKDIEDATD
JGI24766J26685_1000766143300002161Freshwater And SedimentMSFDTLKVAELKKIAEDFAVDTNGLKNKADVIAALAEEGVTWSVYQQTIKKLEDEAEEI
JGI24766J26685_1004043323300002161Freshwater And SedimentMSFETMKVAELKKIAEDFAVDTEGLKNKADIIATLSEEGVTFAVYAKTLDIKEEEAD
metazooDRAFT_131258033300002203LakeMSFDTLKVKELKHVAENFAVETEGLKNKADIIAALAE
B570J29032_10915893423300002408FreshwaterMSFDTLKVADLKAIAEEFAVETDGLKNKQDIIAALA
JGI24768J34885_1002639013300002447Freshwater And SedimentMSFDTLKVAELKSIAEEFAVETEGLKNKQDIIAALAEEGV
JGI25912J50252_1013728513300003412Freshwater LakeMSFDTLKVKDLKALAADFAVDVDGLKNKADIIASLSEEGVTWSVYQGT
JGI25922J50271_1000238513300003413Freshwater LakeMSFDTLKVKELKTLAADFAVDVDGLKNKADVIAALTEEGVTWSVYQGTLKNIEN
JGI25922J50271_1005897613300003413Freshwater LakeMSFETLKVSEIKKIAEDFAVDTDGLKNKADIIAALAEEGVTW
JGI25914J50564_1012592213300003429Freshwater LakeMSFDTLKVAELKVIATDFAVDTEGLKNKKDIIAALAEEGVTWSVYQSTV
Ga0066178_1025822323300004124Freshwater LakeMSFETLKISELKKIAEDFAVDADGLKTKADIVAALAEEGVTWSV
Ga0007748_1019490823300004769Freshwater LakeMSFETLKISELKKIAEDFAVDADGLKTKADIIAALAEEGVTW
Ga0007795_1016516213300004773FreshwaterMSFETLKVSELKKVAEDFGVDLEESKSKKDIIAALAEEGVSWGVYEKTIQI
Ga0007760_1007199223300004793Freshwater LakeFDTLKVKDLKALAADFAVDVDGLKNKADIIASLSEEGAAFF*
Ga0007763_1013451723300004796Freshwater LakeMSFDTLTVAELKEIATEFAVDTEGLKNKKEIIAAMAEEGVTYSVYQKTVQAIEEAK*
Ga0070374_1019102313300005517Freshwater LakeMSFDTLKVKDLKALAADFAVDVDGLKNKADIIASLSEE
Ga0049084_1013144113300005585Freshwater LenticMSFDTLKVKDLKALAADFAVDVEGLKNKADIIASLSEEGVTWSVYQGTLKNIENAKE
Ga0078894_1030639233300005662Freshwater LakeMSFETLKVSEIKKIAEDFAVDTDGLKSKADIIAALAEEGVTWS
Ga0078894_1154961713300005662Freshwater LakeMDIPRKGEYMSFETLKVAEIKKIAEDFAVDLDGLKGKADIIAALADEGVTWAVYQKTIKDIEESIEEDE
Ga0073914_1008925123300006040SandVSFETLKISELKKIAEDFGVETEQSKNKTDVIAALAEEGVTWAVYQKTIKDITEALEEAP
Ga0070744_1016323523300006484EstuarineMSFDTLKVSEVKKIAEDFAVDTDGLKSKADIIAALAEEGVTWSVYNKT
Ga0075464_1062734423300006805AqueousMSFETLKVAELRKIAEDFAVDTDGLKNKTDIVAALAEE
Ga0102861_117910323300007544EstuarineMSFETLKVAELKKIAEDFAVDADGLKNKADIIAALAEEG
Ga0102817_111923523300007555EstuarineMSFETLKVAELRQIAEDFAVDTDGIKSKADIVAALAEEG
Ga0102828_108882123300007559EstuarineMSFDTLKVAELKKIAEDFAVETTSLKNKNDIIAALSEE
Ga0102913_113116113300007560EstuarineMSFETLKVAELRKVAEDFAVDTDGIKSKTDIVAALAEEGVTWSVYQKTIKDI
Ga0102917_119346923300007590EstuarineMSFDTLKVSELKKVAEDFGVETQGLKNKTDVIAALTEEGVTWSVYQKTLKSIEDVKDE
Ga0102897_104303813300007617EstuarineMSFETLKVAELRKVAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIKDIEDATDEFS
Ga0102855_121334113300007647EstuarineMSFDTLKVKELKTLAADFAVDVDGLKNKADIIASLSEEG
Ga0102827_108413023300007715EstuarineMSFDTLKVAELKVIAEDFAVDTEGLKNKKDIIAALSEEGVSWSVYQKTKQ
Ga0105739_101332213300007954Estuary WaterMSFDTLKVAELKVIATDFAVDTENLKNKKDIIAALSEEGVTWSVYQSTR
Ga0105745_113647413300007972Estuary WaterMSFDTLKVSELKKVAEDFGVETQGLKNKTDVIAALTEEGVTWSVYQKTLKSIEDVKDEDKIE
Ga0102893_104584623300008052EstuarineMSFETLKVAELRKIAEDFAVDTDGIKNKADVIAALAEEG
Ga0114340_117796023300008107Freshwater, PlanktonMSFETLKVAELRKIAEDFAVDTDGIKSKTDIVAALAEERVTWSVYQKTIKDMEDATDEF
Ga0114343_106189533300008110Freshwater, PlanktonMSFETLKVSELKKIAEDFGVDIESLKNKADIIAALSEEGVSWSVYKKTLGEN*
Ga0114343_119470513300008110Freshwater, PlanktonMSFETLKVSELKQIAEDFAVETEGLKNKADIIAALAEEGVTWSVYNKTIEK
Ga0114346_130167123300008113Freshwater, PlanktonMSFDTLKVTELKKLAEDFGVDTGTLKNKADVIAALSEEGVTWSVYQKTLQTMKDVSEEDTIEVLPKFDH
Ga0114347_104172313300008114Freshwater, PlanktonMSFETLKVSELKKIAEDFGVDIESLKNKADIIAALSEEGVSWSVYKKTLGE
Ga0114347_120228723300008114Freshwater, PlanktonMSFETLKVKELKKIAEDFAVDTDGLKNKADIVAALAEE
Ga0114347_122548913300008114Freshwater, PlanktonMSFETLKVAELRKIAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTVKDIEE
Ga0114841_107960313300008259Freshwater, PlanktonMSFETLKVSELKQIAEDFAVETEGLKNKADIIAALAEEGVTWSVYNKTIEKMEEDSEDM
Ga0114336_126686023300008261Freshwater, PlanktonMSFDTLKVGELKAIAEEFAVDTAGLKNKQDVIAAL
Ga0114337_123122513300008262Freshwater, PlanktonMSFETLKVAELRKIAEDFAVDTDGIKNKADVIAALAEEGVTWSVYQKTIKDVEEAAE
Ga0114880_124057013300008450Freshwater LakeMFFDTLKISELKKIAEDFGVDIEDKKNKADIVAALAEEGVT
Ga0110934_107513613300008507WastewaterMSFDTLKVAELRNVAESFGVDFEGAKNKKDIIAMLAEEGVTYEVY
Ga0102811_1001089163300009024EstuarineLKVSELKKIAEDFAVETEGLKNKADIIAALAEEGVTWSVYNKTIEKMEEDEEDMS
Ga0114978_1046593113300009159Freshwater LakeMSFDTLKVAELKKIAEDFAVDADGLKNKADIIAALAEEGVTWSVYNSTIKKIEEE
Ga0114970_1040022723300009163Freshwater LakeMSFETLKVAELKKIAEDFAVDADGLKNKADIIAALAEEGVTWSVYNSTIKKIEE
Ga0114974_1029325313300009183Freshwater LakeMSFDTLKVAELKKIAEDFAVDADGLKNKADIIAALAEEGVTWSVYNSTIKKIEE
Ga0114983_112948923300009194Deep SubsurfaceMSFDTLKVAELKVIATDFAVDTEGLKNKKDIIAAVAEEGVTWSVYQ
Ga0114982_111196823300009419Deep SubsurfaceVSFETLKISELKKIAEDFAVETQGLKNKADIIAALAEEGVTWSVYSRPLSKSKRN*
Ga0114964_1010965423300010157Freshwater LakeMSFDTLTVAELKEIATEFAVDTEGLKNKKDVIAAMAEEGVTYSVYAKTL
Ga0129336_1057914123300010370Freshwater To Marine Saline GradientVSFETLKISELKKVAEDFGVNTEELKNKTDIIAALSEEGVTWAVYQKTIKDIE
Ga0151620_102484813300011268FreshwaterMSFDTLKVKDLKALAANFAVDVDGLKNKADVIAALAE
Ga0119931_103576913300011984Drinking Water Treatment PlantMSFETLKVAELKQIAEDFAVDIEGLGGKKDIIAALAEEGVT
Ga0153799_109287723300012012FreshwaterMSFDTLKVKELKTLAADFAVDVDGLKNKADVIAALAEEGVTWSVYQGTLKNIENAKEDADEILPRL
Ga0157595_114900233300012708FreshwaterMSFETLKLSEIKKIAEDFGVDIQTLKSKNDIIASLA
Ga0157604_100243133300012723FreshwaterMSFETLKVSDLKKIAEDFGVDINNLKNKTDIIAALSEEGVTWRFTKRP*
Ga0157597_125750813300012726FreshwaterEITVSFETLKISELRKIAEDFGVDTEALKNKNDIVASLADEGVTWAVYQKNN*
(restricted) Ga0172372_1014704833300013132FreshwaterMSFETLKVSELKQIAEDFAVNTDGLKNKADVIAALAEEGVTWSVYNKTMD
Ga0157622_119442813300013310FreshwaterFETLKVAELRKIAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKNY*
Ga0181358_104255833300017774Freshwater LakeMSFETLKVAELRKVAEDFAVDTDGLKNKADIVAALTEEGVTWSVYQKTIKDIEKAADEFSED
Ga0194113_1046542223300020074Freshwater LakeMSFETLKVSELKQIAEDFAVNTDGLKNKADVIAALAEEGVTWSV
Ga0211734_1021560323300020159FreshwaterMSFETLKVSELKKIAEDFAVDTDNLKNKADVIAAL
Ga0211733_1017937823300020160FreshwaterMSFDTLKVAELKKIAEDFAVETIGLKNKNDVIAALSEE
Ga0211733_1058007833300020160FreshwaterMSFETLKVAELKKIAEDFAVDADGLKNKADIIAALAE
Ga0211726_10353618213300020161FreshwaterMSFDTLKVGELKAIAEDFAVETEGLKNKQDIIAALSEEGVTYE
Ga0194118_1006295233300020190Freshwater LakeMSFDTLKVAELKQIAEDFAVNIEEQKGKKDIIAALAEEGVTWAIYQKSKAIEEEELEM
Ga0194127_1044697313300020221Freshwater LakeMSFDTLKVKDLKQIAEDFAVETAGLKNKTDVIAAF
Ga0194125_1027319513300020222Freshwater LakeMSFDTLKVSELKKIAEDFAVETEGLKTKAGIVAALADEGVTWSVYQNTLDK
Ga0208091_102578923300020506FreshwaterVSFETLKISELRKIAEDFGVDTEALKNKNDIVASLADEGVTWAVYQKTIKD
Ga0208593_100199113300020511FreshwaterMSFDTLKVADLKAIAEEFAVETDGLKNKQDIIAALAEEGVTYAVYEKTLKDVEDAKE
Ga0208858_101703923300020524FreshwaterMSFETLKVSEIKKIAEDFAVDTDGLKSKADIIAALAEEGVTWSVYNKTMDKMEEEDMT
Ga0208856_104697823300020548FreshwaterMSFDTLKVKDLKALAADFAVDVDGLKNKADVIAALTEEGVTWSVYQGTLKNIENAKED
Ga0207934_102035723300020561FreshwaterMSFDTLKVAELKVIATDFAVDTEGLKNKKDIIAALAEE
Ga0208485_100973113300020573FreshwaterMSFDTLKVKDLKTLAADFAVDVDGLKNKADVIAALTEEGVTWSVYQGTLKNIENAKED
Ga0208221_100729933300020574FreshwaterMSFETLKVAELRKIAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIKDIEDAT
Ga0222713_1033381023300021962Estuarine WaterMTFETMKVAELKKIAEDFAVDTEGLKNKADIIAALAEEGVTFAVYAKTVDVKEDEAEMNE
Ga0222712_1047148613300021963Estuarine WaterMSFETLKVAELRKVAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIKDIE
Ga0181354_123071613300022190Freshwater LakeMSFDTLKVGELKTIAEDFGVETSQLKNKQDIIAALSEEGVTYSVYEKTKKAVEDAKE
Ga0214919_1034811313300023184FreshwaterMSFDTLKVAELKKIAEDFAVETTSLKNKNDIIAALSEEGVTWAVYEQTIKKIEEEAEEI
Ga0255148_103131423300024306FreshwaterMSFETLKIAELKKIAEDFGVEIDGLKNKTDIIAALSEEGVTWSVYEKTLEKSEE
Ga0244775_1069315123300024346EstuarineMSFETLKVSEIKKIAEDFAVDTDGLKSKADIIAALAEEGVTWSVYNKTMDK
Ga0244775_1104922113300024346EstuarineMDIPRKGEYMSFETLKVAEIKKIAEDFAVDLDGLKGKADIIAALADEGVTWAVYQKTIKDIEESIEEDEYEI
Ga0244775_1109163213300024346EstuarineMSFDTLKVKDLKSLAADFAVDANGLKNKAEIIAALSEEGVTWSVYQSTL
Ga0255141_101239823300024351FreshwaterMSFETLKIAELREIAESFAVETDGLKNKANIIAALAEEGVTWAVYQKTL
Ga0255142_100807913300024352FreshwaterMSFETLKIAELKKIAEDFGVEIDGLKNKTDIIAALSEEGVTWSVYEKTLEKSEEEDDMAT
Ga0255142_101200623300024352FreshwaterMSFETLKVSELKKIAEDFGVEINGLKNKIDIIAALSEEGVTWAVYQKTVKDVEEAED
Ga0255157_103209613300024355FreshwaterMSFETLKVSELKQIAEDFAVTTDGLKNKADIIAALS
Ga0255169_103816623300024356FreshwaterMSFDTLKVAELKQIAEDFAVDIEGISGKKDIIAAL
Ga0255194_106323713300024494FreshwaterMSFDTLKVKDLKQIAEDFAVDTDGLKNKADIVAALAEEGVTWSVYQNTLKNIEDSKEEA
Ga0255151_100325713300024496FreshwaterMSFDTLKVKELKQIAEDFAVDTEGLKNKADVIAALAEEGVTWSV
Ga0255208_105972613300024501FreshwaterMSFDTLKVKDLKQIAEDFAVDTDGLKNKADIVAALAEEGVTWSVYQNTLKNIEDS
Ga0255152_103398913300024503FreshwaterMSFDTLKVAELKQIAEDFAVDIEGISGKKDIIAALS
Ga0255176_103467623300024507FreshwaterMSFETLKVSELKQIAEDFAVTTDGLKNKADIIAALSEEG
Ga0255144_103486723300024513FreshwaterMSFETLKVSELKKIAEDFGVEINGLKNKIDIIAALSEEG
Ga0255300_100376833300024540FreshwaterMSFDTLKVKDLKQIAEDFAVDTDGLKNKADIVAALAEEGVTWSVYQNTLK
Ga0255280_102699923300024555FreshwaterMSFDTLKVKELKQIAEDFAVDTEGLKNKADVIAALA
Ga0255273_106198313300024565FreshwaterMSFETLKIAELKKIAEDFGVEIEGLKNKTDIIAALSEEGVTWSVYEKTLEKLKEEDD
Ga0255268_113300123300024572FreshwaterMSFETLKVSELKKVAEDFGVEIDGLKNKTDIIAALSEEGVTWAVYQKTVNDLEEAED
Ga0255229_108074113300024848FreshwaterETLKVAELRKIAEDFAVDTDGIKSKTDIVAALAEEGVTWSVYQKNY
Ga0255281_104658423300024855FreshwaterMSFETLKVSELKKIAEDFAVDTDGLKNKADIIAALAEEGVTWSVYNKT
Ga0255272_110753113300024866FreshwaterMSFDTLKVKELKHVAENFAVETEGLKNKADIIAALAEEGVTW
Ga0207954_111882313300025606FreshwaterMSFETLKVSELKKVAEDFGVDLEESKSKKDIIAALAEEG
Ga0255160_105130823300026457FreshwaterMSFETLKVSELKKIAEDFGVEINGLKNKIDIIAALSEEGVTWAVYQKTVNDLEEAEDMSV
Ga0255170_102504523300026459FreshwaterMSFETLKVSELKKVAEDFGVEIDGLKNKTDIIAALSEEGVTWAVYQKTV
Ga0255166_103532823300026473FreshwaterMSFETLKVSELKKVAEDFGVEIDGLKNKTDIIAALSEEGVTWAVYQKT
Ga0255274_111895223300026570FreshwaterMSFDTLKVKELKQIAEDFAVDTEGLKNKADVIAALAEEGV
Ga0255269_101681433300026573FreshwaterMSFETLKIAELREIAESFAVETDGLKNKANIIAALAEEGVTWAVYQKTLNTIKEASEDAF
Ga0255074_104259523300027121FreshwaterMSFETLKVAELRKIAEDFAVETEGLKNKADIIAALSEEGV
Ga0255070_100145213300027133FreshwaterMSFETLKVSELKKIAEDFAVETEGLKNKADIIAALAEEGVTWSVYNKT
Ga0255064_101035233300027138FreshwaterMSFETLKVSELKKIAEDFAVETEGLKNKADIIAALAEEGVTWSVYN
Ga0208307_107150613300027211EstuarineMSFDTLKVKDLKALAADFAVDVDGLKNKADIIASLSEEGVTWSVYQGTLKNIENAKEDSDEI
Ga0208170_107551413300027234EstuarineMSFDTLKVAELKVIAEDFAVDTEGLKNKKDIIAALSEEGVSWSVYQKTKQEI
Ga0255134_107675423300027292FreshwaterMSFETLKVAELRKIAEDFAVDTDGLKNKADIVAALAEEGVTWS
Ga0255096_100853933300027302FreshwaterMSFETLKISELRKIAEDFAVDTEGLKTKVDIIASLAEEG
Ga0208812_106593423300027311EstuarineMSFETLKVAELRKIAEDFAVDTDGIKSKTDIVAALAEEG
Ga0255154_102630823300027467FreshwaterMSFETLKIAELREIAESFAVETDGLKNKANIIAALAEEGVTWAVYQKTLNT
Ga0255095_104437523300027489FreshwaterMSFETLKISELRKIAEDFAVDTEGLKTKVDIIASLAEEGVTWSVYN
Ga0255072_103072013300027508FreshwaterMSFETLKVAELRKIAEDFAVDTDGIKSKADIVATLAEEGV
Ga0255077_104254923300027529FreshwaterMSFETLKVAELKKIAEDFAVDADGLKNKADIIAALAEE
Ga0255158_100664633300027541FreshwaterMSFETLKIAELREIAESFAVETDGLKNKANIIAALAEEGVTWAV
Ga0255075_106557523300027578FreshwaterMSFETLKVSELKKIAEDFAVETEGLKNKADIIAALAEEGVTWSVYNK
Ga0255117_105695613300027600FreshwaterMSFETLKISELKKIAEDFAVDADGLKTKADIIASLAEEGVTWSVYN
Ga0255079_102401513300027601FreshwaterMSFETLKVAELRKIAEDFAVDTDGIKSKADIVAALT
Ga0208951_118927213300027621Freshwater LenticMSFDTLKVAELKKIAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIKDIEDATDEFSENAE
Ga0208942_110188323300027627Freshwater LenticVSFETLKISELKKIAEDFGVETEQSKNKTDVIAALAEEGVTWAVYQKTIKDITE
Ga0208133_108380013300027631EstuarineMSFETLKVAELRKIAEDFAVDTDGIKSKTDIVAALAEEGVTWSVYQKT
Ga0209356_110343623300027644Freshwater LakeMSFETLKVAELKKIAEDFAVDADGLKNKADVIAALAEEGVTWSVYNST
Ga0209553_117320213300027688Freshwater LakeMSFETLKVAELRKIAEDFAVDTEGLKNKNDIIAALAEEGVTWSVYN
Ga0209297_100793913300027733Freshwater LakeMSFETLKVAELKKIAEDFAVDTEGLKNKADLIAALSEEGVTYS
Ga0209087_112059013300027734Freshwater LakeMSFETLKVAELRKVAEDFAVDTDGLKNKADIVAALTEEGVTWSVYQK
Ga0209296_138995323300027759Freshwater LakeMSFETLKVAELRKVAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIKDIEDATDEFSENAE
Ga0209770_1006033333300027769Freshwater LakeMSFETLKVAELRKIAEDFAVDTDGIKSKADIVAALAEEGVT
Ga0209770_1040063213300027769Freshwater LakeMSFDTLKVGELKTIAEDFAVEIEGLKNKQDIIAALAEEGVTYEVYAKTL
Ga0209500_1039299513300027782Freshwater LakeMSFDTLKVAELKKIAEDFAVDADGLKNKADIIAALAE
Ga0209246_1036756313300027785Freshwater LakeMSFETLKVAELKKIAEDFAVDADGLKNKADVIAALAEEGVTWSVYNSTIKKIEEETEDMSIEV
Ga0209107_1028737623300027797Freshwater And SedimentMSFETLKVSEIKKIAEDFAVDTDGLKSKADIIAALAEEGVTWSVY
Ga0209550_1008839213300027892Freshwater LakeMSFDTLKVAELKTIAEDFAVDTDGLKNKKDIIAALAEEGVTYSVYAKTLQT
Ga0247723_105205513300028025Deep Subsurface SedimentMSFDTLKVAELKVIATDFAVDTEGLKNKKDIIAALAEEGV
(restricted) Ga0247835_110581723300028114FreshwaterMSFETLKVSEVKKIAEDFAVDTDGLKSKADIIAALAEEGVTWSVYNKTMDNMEEEDMTVE
Ga0304728_111271613300028393Freshwater LakeMSFETLKVAELRKVAEDFAVDTDGLKNKTDIVAALA
Ga0315907_1017873213300031758FreshwaterMSFDTLKISELKKIAEDFGVDIEDKKNKADIVAALAEEGVTWSIYAKTLEDLEEDMSAD
Ga0315900_1112261023300031787FreshwaterVSFETLKISELKKIAEDFAVETQGLKNKADIIAALAEEGVTWSVYSKTI
Ga0315909_1054453413300031857FreshwaterMSFETLKVSEIKKIAEDFAVDTDGLKSKADIIAALAEEGVTW
Ga0315904_1008801213300031951FreshwaterMSFDTLKIAELKQIAEDFAVDITDQKGKKDIIAAL
Ga0315904_1024215733300031951FreshwaterMSFDTLKISELKKIAEDFGVDIEDKKNKADIVAALAEEGVTWSIYA
Ga0315901_1006662213300031963FreshwaterMSFDTLKVAELKKIAEDFAVDTNGLKNKADVIAALAEEGVT
Ga0315901_1036396713300031963FreshwaterMSFETLKISEIKKIAEDFAVDIDGLKSKADIIAALAE
Ga0315906_1062134923300032050FreshwaterMSFETLKVSELHKIAEDFAVSTESLKSKKDIIAAL
Ga0315906_1100620113300032050FreshwaterVSFETLKISELKKIAEDFAVETQGLKNKADIIAALAEEGVTWSVYSKTIK
Ga0315905_1067910323300032092FreshwaterMSFETLKVSEIKKIAEDFAVDVDGLKSKADIIAALAEEGVTWSVYNKTLDNMEEEDMSV
Ga0315905_1109872513300032092FreshwaterMSFDTLKVKELKTLAADFAVDVDGLKNKADVIAALTEEGVTWSVYQGTLKN
Ga0315902_1131593823300032093FreshwaterMSFETLKVAELRKIAEDFAVDTDGIKNKADIIAAL
Ga0315903_1005679243300032116FreshwaterMSFDTLKISELKKIAEDFGVDIEDKKNKADIVAALAEEGVTWSIYAKTLEDLEEEDMSV
Ga0315903_1104615113300032116FreshwaterMSFDTLKVAELKKIAEDFAVDTNGLKNKADVIAALAEEGVTWSVYQQTIEKL
Ga0334992_0013703_3_1163300033992FreshwaterMSFDTLKVKDLKTLAADFAVDVDGLKNKADVIAALTEE
Ga0334992_0014439_1_1503300033992FreshwaterMSFETLKVAELRKIAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIK
Ga0334985_0115113_1737_18773300034018FreshwaterMSFDTLKVSEVKKIAEDFAVDTDGLKSKADIIAALAEEGVTWSVYNK
Ga0335004_0650653_440_5503300034021FreshwaterMSFETLKLSELKQAAEDFGVDASDLKGKADIIAALTE
Ga0335023_0581284_2_1093300034050FreshwaterMSFDTLKVAELKKIAEDFAVETTSLKNKNDIIAALS
Ga0334987_0211356_2_1333300034061FreshwaterMSFETLKVSEVKKIAEDFAVDTDGLKSKADIIAALAEEGVTWSV
Ga0335000_0500829_1_1653300034063FreshwaterMSFETLKVSELKKIAEDFAVDTDGLKNKADIIAALAEEGVTWSVYNKTIEKMEED
Ga0335028_0654588_1_1803300034071FreshwaterVSFETLKISELKKVAEDFGVDTEELKNKTDIIAALSEEGVTWAVYQKTIKDIEDNLEEAP
Ga0310130_0027854_2_1633300034073Fracking WaterMSFETLKVSELKTIAEDFGVEIDGLKNKTDIIAALSEEGVTWAVYQKTVKDIEE
Ga0335020_0211864_815_9643300034082FreshwaterMSFDTLKVAELKKIAEDFAVDVESLKNKNDIIAALSEEGVTWAVYSKTIK
Ga0335012_0141776_1_1143300034093FreshwaterMSFDTLKVAELKKIAEDFAVDTNSLKNKNDIIAALSEE
Ga0335012_0179042_997_11343300034093FreshwaterMSFDTLKVAELKKIAEDFAVETTSLKNKNDIIAALAEEGVTWAVYE
Ga0335035_0128844_1493_16093300034105FreshwaterMSFDTLKVKDLKTLAADFAVDVDGLKNKADVIAALTEEG
Ga0335035_0264091_902_10303300034105FreshwaterMSFDTLKVAELKKIAEDFAVETTSLKNKNDIIAALAEEGVTWA
Ga0335036_0886842_359_5053300034106FreshwaterMSFETLKVSEIKKIAEDFAVDTDGLKSKADIIAALAEEGVTWSVYNKTL
Ga0335051_0126655_1_1173300034109FreshwaterMSFETLKLSELKQAAEDFGVDASDLKGKADIIAALTEDG
Ga0335056_0013701_3_1193300034120FreshwaterMSFDTLKVTELKKLAEDFGVETGTLKNKADVIAALSEEG
Ga0335060_0030873_3295_34833300034122FreshwaterMSFDTLKVTELKKLAEDFGVETGTLKNKADVIAALSEEGVTWSVYQKTLQTIKDVSEEDKIEV
Ga0335065_0008548_7175_72793300034200FreshwaterMSFETLKLSEIKKIAEDFGVDIQTLKSKNDIIASL
Ga0335065_0476272_2_1663300034200FreshwaterMSFDTLKVAELKKIAEDFAVETTSLKNKNDIIAALAEEGVTWAVYEQTIKNIEEE
Ga0335013_0489635_579_7373300034284FreshwaterMSFETLKVAELRKIAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIKDIE
Ga0335048_0254656_1_1203300034356FreshwaterMSFETLKLSELKQAAEDFGVDASDLKGKADIIAALTEDGV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.