NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F031748

Metatranscriptome Family F031748

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031748
Family Type Metatranscriptome
Number of Sequences 181
Average Sequence Length 68 residues
Representative Sequence GLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Number of Associated Samples 146
Number of Associated Scaffolds 181

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 16.02 %
% of genes near scaffold ends (potentially truncated) 81.22 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (53.039 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(93.370 % of family members)
Environment Ontology (ENVO) Unclassified
(96.685 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(98.895 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 33.85%    β-sheet: 20.00%    Coil/Unstructured: 46.15%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 181 Family Scaffolds
PF00255GSHPx 96.13

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 181 Family Scaffolds
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 96.13


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.59 %
UnclassifiedrootN/A46.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003555|Ga0008453J51685_106318All Organisms → cellular organisms → Bacteria → Proteobacteria803Open in IMG/M
3300008832|Ga0103951_10212210All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis950Open in IMG/M
3300008998|Ga0103502_10142308All Organisms → cellular organisms → Eukaryota867Open in IMG/M
3300008998|Ga0103502_10160751Not Available816Open in IMG/M
3300009025|Ga0103707_10040505Not Available799Open in IMG/M
3300009028|Ga0103708_100070176All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis817Open in IMG/M
3300009028|Ga0103708_100070766All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis814Open in IMG/M
3300009677|Ga0115104_10089965Not Available629Open in IMG/M
3300018521|Ga0193171_102101All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis830Open in IMG/M
3300018568|Ga0193457_1008058All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis735Open in IMG/M
3300018576|Ga0193373_1004892Not Available860Open in IMG/M
3300018578|Ga0193389_1005270Not Available812Open in IMG/M
3300018579|Ga0192922_1006606All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis820Open in IMG/M
3300018587|Ga0193241_1001421Not Available850Open in IMG/M
3300018590|Ga0193114_1011542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis870Open in IMG/M
3300018590|Ga0193114_1013385Not Available813Open in IMG/M
3300018591|Ga0193398_1001962Not Available797Open in IMG/M
3300018594|Ga0193292_1005219All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis804Open in IMG/M
3300018600|Ga0192851_1018673All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis515Open in IMG/M
3300018604|Ga0193447_1007288Not Available910Open in IMG/M
3300018626|Ga0192863_1016579Not Available958Open in IMG/M
3300018628|Ga0193355_1007415All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis936Open in IMG/M
3300018631|Ga0192890_1028589Not Available784Open in IMG/M
3300018638|Ga0193467_1031352All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis778Open in IMG/M
3300018639|Ga0192864_1023318Not Available883Open in IMG/M
3300018639|Ga0192864_1026317Not Available841Open in IMG/M
3300018651|Ga0192937_1014867Not Available892Open in IMG/M
3300018651|Ga0192937_1016062Not Available862Open in IMG/M
3300018656|Ga0193269_1035068All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis739Open in IMG/M
3300018658|Ga0192906_1021271All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis733Open in IMG/M
3300018659|Ga0193067_1029094All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis825Open in IMG/M
3300018660|Ga0193130_1025512Not Available759Open in IMG/M
3300018666|Ga0193159_1020989Not Available839Open in IMG/M
3300018666|Ga0193159_1023382All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis800Open in IMG/M
3300018666|Ga0193159_1023549Not Available797Open in IMG/M
3300018668|Ga0193013_1023142All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis855Open in IMG/M
3300018668|Ga0193013_1053309All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis552Open in IMG/M
3300018676|Ga0193137_1021574All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis859Open in IMG/M
3300018679|Ga0193390_1046347Not Available780Open in IMG/M
3300018685|Ga0193086_1026288Not Available915Open in IMG/M
3300018686|Ga0192840_1023134Not Available750Open in IMG/M
3300018686|Ga0192840_1032331All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis647Open in IMG/M
3300018691|Ga0193294_1017142All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis831Open in IMG/M
3300018693|Ga0193264_1039389All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis732Open in IMG/M
3300018693|Ga0193264_1045762All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis661Open in IMG/M
3300018694|Ga0192853_1070514All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis565Open in IMG/M
3300018697|Ga0193319_1035408Not Available789Open in IMG/M
3300018699|Ga0193195_1013495All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis856Open in IMG/M
3300018703|Ga0193274_1008170Not Available913Open in IMG/M
3300018705|Ga0193267_1023700All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1071Open in IMG/M
3300018706|Ga0193539_1046377Not Available718Open in IMG/M
3300018708|Ga0192920_1034869All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis940Open in IMG/M
3300018708|Ga0192920_1054556Not Available705Open in IMG/M
3300018709|Ga0193209_1027785All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis829Open in IMG/M
3300018713|Ga0192887_1019641Not Available854Open in IMG/M
3300018715|Ga0193537_1072626All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis683Open in IMG/M
3300018720|Ga0192866_1045132Not Available705Open in IMG/M
3300018721|Ga0192904_1034837All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis797Open in IMG/M
3300018721|Ga0192904_1037563Not Available765Open in IMG/M
3300018731|Ga0193529_1040772Not Available854Open in IMG/M
3300018731|Ga0193529_1042584Not Available834Open in IMG/M
3300018731|Ga0193529_1042762All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis832Open in IMG/M
3300018733|Ga0193036_1019892All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis862Open in IMG/M
3300018740|Ga0193387_1033893All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis739Open in IMG/M
3300018744|Ga0193247_1056687Not Available828Open in IMG/M
3300018751|Ga0192938_1057310All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis778Open in IMG/M
3300018752|Ga0192902_1050853All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis769Open in IMG/M
3300018752|Ga0192902_1066869Not Available650Open in IMG/M
3300018753|Ga0193344_1036685All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis720Open in IMG/M
3300018764|Ga0192924_1021063Not Available769Open in IMG/M
3300018765|Ga0193031_1035934Not Available795Open in IMG/M
3300018767|Ga0193212_1034901All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis742Open in IMG/M
3300018769|Ga0193478_1034080Not Available816Open in IMG/M
3300018770|Ga0193530_1048408Not Available831Open in IMG/M
3300018780|Ga0193472_1020127All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis727Open in IMG/M
3300018783|Ga0193197_1022413All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis943Open in IMG/M
3300018784|Ga0193298_1044562All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis873Open in IMG/M
3300018785|Ga0193095_1045216All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis881Open in IMG/M
3300018786|Ga0192911_1034603All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis674Open in IMG/M
3300018789|Ga0193251_1100966Not Available755Open in IMG/M
3300018793|Ga0192928_1054888All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis710Open in IMG/M
3300018794|Ga0193357_1032010All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis851Open in IMG/M
3300018796|Ga0193117_1047733All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis722Open in IMG/M
3300018797|Ga0193301_1046030All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis931Open in IMG/M
3300018801|Ga0192824_1056940All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis811Open in IMG/M
3300018804|Ga0193329_1059481All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis753Open in IMG/M
3300018808|Ga0192854_1033047Not Available934Open in IMG/M
3300018808|Ga0192854_1036764Not Available893Open in IMG/M
3300018809|Ga0192861_1050779Not Available792Open in IMG/M
3300018809|Ga0192861_1056228Not Available750Open in IMG/M
3300018809|Ga0192861_1059963All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis724Open in IMG/M
3300018812|Ga0192829_1051153All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis820Open in IMG/M
3300018819|Ga0193497_1060196All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis704Open in IMG/M
3300018823|Ga0193053_1043331All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis726Open in IMG/M
3300018832|Ga0194240_1007265All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis831Open in IMG/M
3300018844|Ga0193312_1023477Not Available796Open in IMG/M
3300018847|Ga0193500_1036790All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis854Open in IMG/M
3300018850|Ga0193273_1020500All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis835Open in IMG/M
3300018854|Ga0193214_1044875All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis856Open in IMG/M
3300018857|Ga0193363_1065429Not Available749Open in IMG/M
3300018858|Ga0193413_1042662All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis753Open in IMG/M
3300018859|Ga0193199_1057567All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis865Open in IMG/M
3300018861|Ga0193072_1054621Not Available789Open in IMG/M
3300018865|Ga0193359_1060503Not Available728Open in IMG/M
3300018865|Ga0193359_1062088All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis718Open in IMG/M
3300018867|Ga0192859_1044913All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis714Open in IMG/M
3300018872|Ga0193162_1064012Not Available717Open in IMG/M
3300018873|Ga0193553_1037872All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1318Open in IMG/M
3300018883|Ga0193276_1060204Not Available786Open in IMG/M
3300018883|Ga0193276_1061085All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis779Open in IMG/M
3300018883|Ga0193276_1065922Not Available748Open in IMG/M
3300018887|Ga0193360_1034438All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1261Open in IMG/M
3300018887|Ga0193360_1075408Not Available809Open in IMG/M
3300018888|Ga0193304_1062050Not Available718Open in IMG/M
3300018897|Ga0193568_1143914All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis711Open in IMG/M
3300018898|Ga0193268_1116428Not Available803Open in IMG/M
3300018901|Ga0193203_10036408Not Available1400Open in IMG/M
3300018905|Ga0193028_1058215Not Available771Open in IMG/M
3300018905|Ga0193028_1065829Not Available721Open in IMG/M
3300018912|Ga0193176_10078737Not Available839Open in IMG/M
3300018919|Ga0193109_10121085Not Available791Open in IMG/M
3300018921|Ga0193536_1192416All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis767Open in IMG/M
3300018921|Ga0193536_1276733All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis558Open in IMG/M
3300018924|Ga0193096_10161100All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis775Open in IMG/M
3300018929|Ga0192921_10084193Not Available1077Open in IMG/M
3300018929|Ga0192921_10103824All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis943Open in IMG/M
3300018929|Ga0192921_10162452Not Available691Open in IMG/M
3300018929|Ga0192921_10200521All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis587Open in IMG/M
3300018934|Ga0193552_10093488Not Available831Open in IMG/M
3300018934|Ga0193552_10096280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis820Open in IMG/M
3300018935|Ga0193466_1047355All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1226Open in IMG/M
3300018940|Ga0192818_10233387All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis530Open in IMG/M
3300018947|Ga0193066_10098620Not Available849Open in IMG/M
3300018952|Ga0192852_10139901All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis826Open in IMG/M
3300018953|Ga0193567_10128007All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis834Open in IMG/M
3300018955|Ga0193379_10111188All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis777Open in IMG/M
3300018957|Ga0193528_10136956All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis908Open in IMG/M
3300018957|Ga0193528_10155931Not Available841Open in IMG/M
3300018958|Ga0193560_10116176Not Available859Open in IMG/M
3300018959|Ga0193480_10137390Not Available787Open in IMG/M
3300018963|Ga0193332_10179808All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis680Open in IMG/M
3300018965|Ga0193562_10096818All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis841Open in IMG/M
3300018969|Ga0193143_10078336Not Available946Open in IMG/M
3300018971|Ga0193559_10264969All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis524Open in IMG/M
3300018973|Ga0193330_10142428All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis751Open in IMG/M
3300018975|Ga0193006_10103516Not Available853Open in IMG/M
3300018978|Ga0193487_10131188All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis879Open in IMG/M
3300018979|Ga0193540_10100369Not Available800Open in IMG/M
3300018980|Ga0192961_10138712Not Available741Open in IMG/M
3300018982|Ga0192947_10104603Not Available939Open in IMG/M
3300018982|Ga0192947_10217200All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis624Open in IMG/M
3300018985|Ga0193136_10093417All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis859Open in IMG/M
3300018986|Ga0193554_10149825Not Available837Open in IMG/M
3300018988|Ga0193275_10158927Not Available690Open in IMG/M
3300018998|Ga0193444_10076651All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis868Open in IMG/M
3300019001|Ga0193034_10048522Not Available860Open in IMG/M
3300019001|Ga0193034_10049053Not Available857Open in IMG/M
3300019002|Ga0193345_10096233All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis832Open in IMG/M
3300019003|Ga0193033_10120768Not Available765Open in IMG/M
3300019011|Ga0192926_10138116Not Available1000Open in IMG/M
3300019011|Ga0192926_10164130All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis927Open in IMG/M
3300019015|Ga0193525_10351715All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis685Open in IMG/M
3300019017|Ga0193569_10218912Not Available833Open in IMG/M
3300019017|Ga0193569_10230955Not Available803Open in IMG/M
3300019017|Ga0193569_10407962All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis522Open in IMG/M
3300019019|Ga0193555_10118906All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis947Open in IMG/M
3300019024|Ga0193535_10132819Not Available810Open in IMG/M
3300019026|Ga0193565_10165085All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis805Open in IMG/M
3300019037|Ga0192886_10107359All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis827Open in IMG/M
3300019051|Ga0192826_10370113Not Available517Open in IMG/M
3300019052|Ga0193455_10230087All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis814Open in IMG/M
3300019136|Ga0193112_1080194All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis772Open in IMG/M
3300019137|Ga0193321_1043099Not Available735Open in IMG/M
3300021879|Ga0063113_137529All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis635Open in IMG/M
3300021892|Ga0063137_1019530Not Available816Open in IMG/M
3300021893|Ga0063142_1003095Not Available792Open in IMG/M
3300021912|Ga0063133_1000101Not Available823Open in IMG/M
3300021912|Ga0063133_1037945All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis694Open in IMG/M
3300021928|Ga0063134_1007948All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis621Open in IMG/M
3300030871|Ga0151494_1050650Not Available684Open in IMG/M
3300031743|Ga0307382_10274476Not Available756Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine93.37%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.42%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.66%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003555Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_17_M020 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018521Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000311 (ERX1782300-ERR1712011)EnvironmentalOpen in IMG/M
3300018568Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002404 (ERX1789617-ERR1719200)EnvironmentalOpen in IMG/M
3300018576Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001942 (ERX1782464-ERR1711929)EnvironmentalOpen in IMG/M
3300018578Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001998 (ERX1782118-ERR1711914)EnvironmentalOpen in IMG/M
3300018579Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000845 (ERX1782161-ERR1712236)EnvironmentalOpen in IMG/M
3300018587Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001485 (ERX1809474-ERR1739843)EnvironmentalOpen in IMG/M
3300018590Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782335-ERR1712116)EnvironmentalOpen in IMG/M
3300018591Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002039 (ERX1782350-ERR1711882)EnvironmentalOpen in IMG/M
3300018594Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809463-ERR1739849)EnvironmentalOpen in IMG/M
3300018600Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000535 (ERX1782170-ERR1711950)EnvironmentalOpen in IMG/M
3300018604Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002362 (ERX1782200-ERR1712077)EnvironmentalOpen in IMG/M
3300018626Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789512-ERR1719180)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018631Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000709 (ERX1789487-ERR1719508)EnvironmentalOpen in IMG/M
3300018638Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002175 (ERX1789495-ERR1719505)EnvironmentalOpen in IMG/M
3300018639Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782310-ERR1712181)EnvironmentalOpen in IMG/M
3300018651Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001512 (ERX1782264-ERR1711863)EnvironmentalOpen in IMG/M
3300018656Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789469-ERR1719513)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018660Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000589 (ERX1782392-ERR1711993)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018668Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002464 (ERX1782441-ERR1712149)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018679Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001998 (ERX1782283-ERR1711917)EnvironmentalOpen in IMG/M
3300018685Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782360-ERR1712233)EnvironmentalOpen in IMG/M
3300018686Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)EnvironmentalOpen in IMG/M
3300018691Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001616 (ERX1782222-ERR1712214)EnvironmentalOpen in IMG/M
3300018693Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001288 (ERX1789601-ERR1719212)EnvironmentalOpen in IMG/M
3300018694Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000539 (ERX1782273-ERR1712042)EnvironmentalOpen in IMG/M
3300018697Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001662 (ERX1789701-ERR1719308)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018703Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782405-ERR1712108)EnvironmentalOpen in IMG/M
3300018705Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001290 (ERX1789614-ERR1719477)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018708Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782185-ERR1711899)EnvironmentalOpen in IMG/M
3300018709Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782278-ERR1712213)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018715Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789494-ERR1719339)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018721Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789483-ERR1719260)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018733Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890)EnvironmentalOpen in IMG/M
3300018740Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789647-ERR1719307)EnvironmentalOpen in IMG/M
3300018744Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001503 (ERX1789402-ERR1719489)EnvironmentalOpen in IMG/M
3300018751Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001514 (ERX1789607-ERR1719173)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018753Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001764 (ERX1789594-ERR1719358)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018767Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000075 (ERX1782420-ERR1711944)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018784Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789528-ERR1719403)EnvironmentalOpen in IMG/M
3300018785Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789545-ERR1719351)EnvironmentalOpen in IMG/M
3300018786Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000682 (ERX1789372-ERR1719517)EnvironmentalOpen in IMG/M
3300018789Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001380 (ERX1809763-ERR1740128)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018797Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001622 (ERX1809762-ERR1740131)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018804Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001738 (ERX1789642-ERR1719208)EnvironmentalOpen in IMG/M
3300018808Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000925 (ERX1782319-ERR1711931)EnvironmentalOpen in IMG/M
3300018809Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789406-ERR1719516)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018847Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003005 (ERX1789704-ERR1719166)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018857Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001828 (ERX1789640-ERR1719290)EnvironmentalOpen in IMG/M
3300018858Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789628-ERR1719293)EnvironmentalOpen in IMG/M
3300018859Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000012 (ERX1789645-ERR1719429)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018887Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789534-ERR1719462)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018897Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002777EnvironmentalOpen in IMG/M
3300018898Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789568-ERR1719317)EnvironmentalOpen in IMG/M
3300018901Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018912Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243)EnvironmentalOpen in IMG/M
3300018919Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003043 (ERX1789401-ERR1719342)EnvironmentalOpen in IMG/M
3300018921Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789458-ERR1719341)EnvironmentalOpen in IMG/M
3300018924Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000046 (ERX1789468-ERR1719259)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018935Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002175 (ERX1789599-ERR1719494)EnvironmentalOpen in IMG/M
3300018940Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018952Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000539 (ERX1782281-ERR1712142)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018959Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789530-ERR1719318)EnvironmentalOpen in IMG/M
3300018963Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789664-ERR1719481)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018971Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003148EnvironmentalOpen in IMG/M
3300018973Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001742 (ERX1789408-ERR1719300)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019002Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001764 (ERX1789384-ERR1719347)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019015Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002109 (ERX1789583-ERR1719280)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019026Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002719EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019052Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019137Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001664 (ERX1782291-ERR1711942)EnvironmentalOpen in IMG/M
3300021879Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0008453J51685_10631813300003555SeawaterFKLGIDKMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY*
Ga0103951_1021221023300008832MarineHGECCHSLSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY*
Ga0103502_1014230833300008998MarineMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY*
Ga0103502_1016075113300008998MarineMHMGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY*
Ga0103707_1004050513300009025Ocean WaterEFEAISKLGVDKMRVGAALLGLLPSVASILVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY*
Ga0103708_10007017633300009028Ocean WaterRSLSSTGLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY*
Ga0103708_10007076633300009028Ocean WaterMTTMHMGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY*
Ga0115104_1008996513300009677MarineKMKVGAALLGLLPSAASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY*
Ga0193171_10210133300018521MarineHGECCHSLSSTGLKMQPGAALLGLLPVVAGTLVYSDCRGGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193457_100805813300018568MarineSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGKGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193373_100489213300018576MarineMGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193389_100527033300018578MarineDKMKVGGALMGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0192922_100660633300018579MarineHGECCHSLSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193241_100142133300018587MarineMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193114_101154233300018590MarineHGECCHSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193114_101338533300018590MarineHGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193398_100196213300018591MarineKVGGALMGLLPAVASVLVYSDCSEGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVAS
Ga0193292_100521923300018594MarineTWECCRSLSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192851_101867323300018600MarineMGEYKEGADPELIFKLGIDKMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193447_100728813300018604MarineRSIRKEVCLNTFPGLGVEKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0192863_101657923300018626MarineLGLLPAVASALVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193355_100741523300018628MarineMGVQCCHSLSSTGLKMQPGAALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192890_102858923300018631MarineFKLGVDKMRVGGALLGLLPSVASILVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193467_103135213300018638MarineCHSLPSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192864_102331833300018639MarineLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0192864_102631733300018639MarineMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0192937_101486733300018651MarineHGEYKEGADPELIFKLGVDKMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0192937_101606233300018651MarineMHMGGALLGLLPAVAATLVYSDCRDGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193269_103506813300018656MarineHSLPSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192906_102127123300018658MarineSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193067_102909433300018659MarineHGECCGSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGKGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193130_102551213300018660MarineVTTMHLGGALLGLLPAVAATLVYSDCRDGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193159_102098913300018666MarineMHMGGALLGLLPAVAATLVYYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193159_102338223300018666MarineHGECCRSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193159_102354933300018666MarineEELVRTMHMGGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193013_102314233300018668MarineHGECCHSLSSTGLKMQPGAALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193013_105330923300018668MarineALMGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193137_102157423300018676MarineHGECYHSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193390_104634713300018679MarineGALMGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193086_102628823300018685MarineMGLLPAVASVLVYSDCSEGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0192840_102313423300018686MarineLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0192840_103233123300018686MarineKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193294_101714233300018691MarineTWGQCCHSLSSTGLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVYLSELAGKVVLLTNVASY
Ga0193264_103938923300018693MarineMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193264_104576213300018693MarineGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192853_107051423300018694MarineHLLKMKVGGALLGLLPAVASVQVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193319_103540813300018697MarineLPGLGVDKMKVGGALMGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193195_101349523300018699MarineHGECCHSLSSSLKMQPGAALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193274_100817023300018703MarineLNTFPGLGVEKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193267_102370013300018705MarineSLPSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193539_104637723300018706MarineTMHMGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0192920_103486923300018708MarineMGECCHSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192920_105455613300018708MarineTWGVTTMHMGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193209_102778523300018709MarineHGECCHSLSSTGLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192887_101964123300018713MarineMGGLGVEKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193537_107262623300018715MarineLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192866_104513213300018720MarinePELLFKLGVDKMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0192904_103483733300018721MarineHSLSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192904_103756323300018721MarineMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193529_104077233300018731MarineHGEYKEGADPELIFKLGVDKMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193529_104258423300018731MarineMHMGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193529_104276213300018731MarineIHGECCHSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193036_101989223300018733MarineHGECCGSLSSSLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193387_103389323300018740MarineSLSSTGLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193247_105668713300018744MarineMKVGGALLGLLPAVASALVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0192938_105731013300018751MarineSSSLKMQPGAALLGLLPAVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192902_105085313300018752MarineSLSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192902_106686923300018752MarineGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193344_103668513300018753MarineSSTGLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192924_102106323300018764MarineTWGVRTMHMGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193031_103593433300018765MarineMGVTTMHMGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193212_103490123300018767MarineHGECCHSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGKGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193478_103408033300018769MarinePELIFKLGIDKMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193530_104840813300018770MarineKEGSDPELLCKLGVDKMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193472_102012723300018780MarineSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193197_102241333300018783MarineHGECCGSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193298_104456223300018784MarineMQPGTALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193095_104521613300018785MarineQCCGSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192911_103460323300018786MarineSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193251_110096613300018789MarineMKVGGALLGLLPAVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVATY
Ga0192928_105488813300018793MarineLKMQPGAALLGLLPAVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193357_103201033300018794MarineQECCHSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGKGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193117_104773313300018796MarineLSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193301_104603013300018797MarineSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192824_105694023300018801MarineVQCCGSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193329_105948113300018804MarineLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGKGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192854_103304723300018808MarineMGRSIRKEVCLNTFPGLGVEKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0192854_103676413300018808MarineLPGLGVDKMKVGGALIGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0192861_105077913300018809MarineIFKLGVDKMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0192861_105622823300018809MarineAALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0192861_105996323300018809MarineSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192829_105115333300018812MarineGSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGKGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193497_106019613300018819MarineSLSSSLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193053_104333113300018823MarinePSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0194240_100726513300018832MarineHGECCHSLSSSGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193312_102347713300018844MarineALLGLLPAVSSVLVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193500_103679033300018847MarineALKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193273_102050033300018850MarineHGEIVQCCHSLPSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193214_104487523300018854MarineHSLSSTGLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193363_106542923300018857MarineMKVGGALMGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193413_104266213300018858MarineMQPGTALLGLLPVVAGTLVYSDCREGKGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193199_105756733300018859MarineHSLSSSLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193072_105462123300018861MarineMHLGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193359_106050323300018865MarineDKMRVGAALLGLLPSVASILVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193359_106208813300018865MarineTGPKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192859_104491313300018867MarineLSSTGLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193162_106401223300018872MarineLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193553_103787213300018873MarineHGECCHSFSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193276_106020423300018883MarineVEKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193276_106108523300018883MarineGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193276_106592213300018883MarineMHLGGALLGLLPVVSATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193360_103443813300018887MarineMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193360_107540823300018887MarineMGLLPAVASVLIYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193304_106205023300018888MarineLGLLPAVSSVLVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193568_114391423300018897MarineRSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193268_111642833300018898MarineKVGGALLGLLPAVASALVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVAS
Ga0193203_1003640813300018901MarineHGECCHSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193028_105821523300018905MarinePELLCKLGVDKMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193028_106582923300018905MarineLVTTMHMGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193176_1007873713300018912MarineGLLPAVSSVLVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193109_1012108513300018919MarineDFNALKEGGALIGLLPAVAAVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193536_119241613300018921MarineSSLKMLPGATLLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193536_127673323300018921MarineLGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193096_1016110013300018924MarineSLKMQPGAALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192921_1008419313300018929MarineMQPPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192921_1010382413300018929MarineHGECCHSLSSSVKMQLGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192921_1016245213300018929MarineKEYKEGADPELIFKLGVDKMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0192921_1020052113300018929MarineVQCCHSLSSSLKMQPPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193552_1009348833300018934MarineMHVGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193552_1009628013300018934MarineTWECCHSLSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193466_104735513300018935MarineHSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192818_1023338723300018940MarineMGLLGLLPAVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193066_1009862033300018947MarineMGLLPAVVSVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0192852_1013990133300018952MarineHGECCNSLSSTGLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193567_1012800713300018953MarineKGLKMLPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193379_1011118813300018955MarineGLKMQPGTALLGLLPVVAGTLVYSDCREGKGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193528_1013695613300018957MarineHGKQWYNESTWECYRSLSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193528_1015593113300018957MarineHGDPSQGVFKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193560_1011617613300018958MarineKEGADPELIFKLGIDKMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193480_1013739033300018959MarineDKMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193332_1017980823300018963MarineLLGLLPVVASTLIYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193562_1009681813300018965MarineHGECCHSLSSSLKMQPGATLLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193143_1007833613300018969MarineMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193559_1026496923300018971MarineLRVDKMRVGAALLGLLPSVASILVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193330_1014242823300018973MarineSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGKGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193006_1010351613300018975MarineMRSIRKEVCLNTFPGLGVEKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0193487_1013118833300018978MarineCHSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193540_1010036933300018979MarineTWGVTTMHMGGALLGLLPAVAATLVYSDCRDGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0192961_1013871213300018980MarineMGWKLGVDRMKVGGALLGLLPAVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0192947_1010460333300018982MarineWEYKEGGVLQLISKLGVAKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVATY
Ga0192947_1021720013300018982MarineWEYKEGGVLQLISKLGVDKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVATY
Ga0193136_1009341713300018985MarineHGECYHSLSSSLKMQPGAALLGLLPVVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193554_1014982513300018986MarineMGKLGVDNMRVGGALLGLLPSVASILVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193275_1015892723300018988MarineHGGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193444_1007665133300018998MarineTWGQCCHSLSSTGPKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193034_1004852213300019001MarineHGECCHSLSSTGLKMQPGAALLGLLPAVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193034_1004905333300019001MarineHGECCHSLSSSLKMQPGAALLGLLPLVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193345_1009623333300019002MarinePCCHSLSSTGLKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193033_1012076813300019003MarineKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVAS
Ga0192926_1013811633300019011MarineMSELSPGVKMQLGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192926_1016413013300019011MarineMQLGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193525_1035171523300019015MarineSSLKMQPGAALLGLLPAVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193569_1021891213300019017MarineKEGADPELLCKLGVDKMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193569_1023095533300019017MarineLKMKVGGALLGLLPAVASVLVYSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0193569_1040796223300019017MarineHMGGALLGLLPAVAATLVYSDCREGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVAS
Ga0193555_1011890613300019019MarineSSTALKMQPGTALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193535_1013281913300019024MarineMTMHMGGALLGLLPAVAATLVYSDCRDGEGSLYDHSLTSLEGSTNVSLSEYSGKVVLLTNVASY
Ga0193565_1016508533300019026MarineCCHSLSSSLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192886_1010735933300019037MarineHGECYRSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0192826_1037011313300019051MarineTWGQCCGSLSSTGLKMQPGTALLGLLPVVAGTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193455_1023008723300019052MarinePGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193112_108019423300019136MarineWYQRRVHGECCHSLSSTGLKMQPGAALLGLLPVVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0193321_104309913300019137MarineSVLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELSGKVVLLTNVASY
Ga0063113_13752913300021879MarineLGVDKMKVGAALLGLLPSVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0063137_101953013300021892MarineADPELLCKLGVDKMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELTGKVVLLTNVASY
Ga0063142_100309513300021893MarineKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVAS
Ga0063133_100010113300021912MarineEGADPELLCKLGVDKMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0063133_103794513300021912MarineSLSSSLKMQPGAALLGLLPAVASTLVYSDCREGEGSLYDHSLTLLMDSRNVSLSELAGKVVLLTNVASY
Ga0063134_100794813300021928MarineDPELLCKLGVDKMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0151494_105065023300030871MarineDKMKVGAALLGLLPSVASVLVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY
Ga0307382_1027447613300031743MarineAEPELIWKLEVGRMKVGGALLGLLPAVASILVSSDCREGEGSLYDHSLTLLMDGRNVSLSELSGKVVLLTNVASY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.