Basic Information | |
---|---|
Family ID | F031060 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 183 |
Average Sequence Length | 43 residues |
Representative Sequence | PAVAAWSERELAVCARYAAVQIDRRLQANLELAASLRSC |
Number of Associated Samples | 139 |
Number of Associated Scaffolds | 183 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.57 % |
% of genes near scaffold ends (potentially truncated) | 93.99 % |
% of genes from short scaffolds (< 2000 bps) | 85.79 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.923 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.787 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.519 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.623 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 183 Family Scaffolds |
---|---|---|
PF08545 | ACP_syn_III | 16.94 |
PF08541 | ACP_syn_III_C | 14.21 |
PF02627 | CMD | 11.48 |
PF13376 | OmdA | 7.65 |
PF04542 | Sigma70_r2 | 3.28 |
PF01476 | LysM | 3.28 |
PF13620 | CarboxypepD_reg | 2.73 |
PF00754 | F5_F8_type_C | 2.19 |
PF13646 | HEAT_2 | 1.09 |
PF01740 | STAS | 1.09 |
PF10009 | DUF2252 | 0.55 |
PF14534 | DUF4440 | 0.55 |
PF01965 | DJ-1_PfpI | 0.55 |
PF06745 | ATPase | 0.55 |
PF04174 | CP_ATPgrasp_1 | 0.55 |
PF03721 | UDPG_MGDP_dh_N | 0.55 |
PF01288 | HPPK | 0.55 |
PF02371 | Transposase_20 | 0.55 |
PF07238 | PilZ | 0.55 |
PF00486 | Trans_reg_C | 0.55 |
PF08281 | Sigma70_r4_2 | 0.55 |
PF00196 | GerE | 0.55 |
COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
---|---|---|---|
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 11.48 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 11.48 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 3.28 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 3.28 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 3.28 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 3.28 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.55 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.55 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.55 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.55 |
COG2308 | Circularly permuted ATP-grasp protein | General function prediction only [R] | 0.55 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.92 % |
Unclassified | root | N/A | 42.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10138285 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
3300001593|JGI12635J15846_10459908 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100193791 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101726168 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300002914|JGI25617J43924_10206112 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300002917|JGI25616J43925_10294061 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300004080|Ga0062385_10142387 | Not Available | 1227 | Open in IMG/M |
3300005186|Ga0066676_10564884 | Not Available | 771 | Open in IMG/M |
3300005340|Ga0070689_101496673 | Not Available | 611 | Open in IMG/M |
3300005435|Ga0070714_101287252 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300005471|Ga0070698_100483222 | Not Available | 1176 | Open in IMG/M |
3300005518|Ga0070699_100299399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1443 | Open in IMG/M |
3300005518|Ga0070699_100553334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
3300005529|Ga0070741_10232114 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300005536|Ga0070697_101686764 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005553|Ga0066695_10615821 | Not Available | 649 | Open in IMG/M |
3300005557|Ga0066704_10531832 | Not Available | 769 | Open in IMG/M |
3300005617|Ga0068859_100464607 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
3300005718|Ga0068866_10188575 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300005842|Ga0068858_101972879 | Not Available | 577 | Open in IMG/M |
3300005983|Ga0081540_1200634 | Not Available | 726 | Open in IMG/M |
3300006057|Ga0075026_100828750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300006755|Ga0079222_10067802 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
3300006854|Ga0075425_100000739 | All Organisms → cellular organisms → Bacteria | 31082 | Open in IMG/M |
3300006854|Ga0075425_102009562 | Not Available | 646 | Open in IMG/M |
3300006914|Ga0075436_100381990 | Not Available | 1019 | Open in IMG/M |
3300007788|Ga0099795_10263940 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300009038|Ga0099829_11142015 | Not Available | 646 | Open in IMG/M |
3300009090|Ga0099827_10686280 | Not Available | 885 | Open in IMG/M |
3300009090|Ga0099827_10903923 | Not Available | 765 | Open in IMG/M |
3300009137|Ga0066709_103881179 | Not Available | 543 | Open in IMG/M |
3300009143|Ga0099792_10821027 | Not Available | 610 | Open in IMG/M |
3300009143|Ga0099792_10870470 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300009143|Ga0099792_11237567 | Not Available | 508 | Open in IMG/M |
3300009624|Ga0116105_1220156 | Not Available | 530 | Open in IMG/M |
3300010159|Ga0099796_10106988 | Not Available | 1060 | Open in IMG/M |
3300010159|Ga0099796_10146676 | Not Available | 926 | Open in IMG/M |
3300010159|Ga0099796_10292851 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300010321|Ga0134067_10135549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
3300010322|Ga0134084_10054210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1189 | Open in IMG/M |
3300010361|Ga0126378_13205001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300010376|Ga0126381_102149611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 803 | Open in IMG/M |
3300011269|Ga0137392_10151890 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
3300011269|Ga0137392_10295429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1339 | Open in IMG/M |
3300011269|Ga0137392_11002548 | Not Available | 686 | Open in IMG/M |
3300011270|Ga0137391_11154448 | Not Available | 622 | Open in IMG/M |
3300012096|Ga0137389_11178345 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300012189|Ga0137388_10421755 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300012189|Ga0137388_10966501 | Not Available | 786 | Open in IMG/M |
3300012198|Ga0137364_11330014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300012201|Ga0137365_10832488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
3300012203|Ga0137399_10100324 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
3300012203|Ga0137399_10998695 | Not Available | 705 | Open in IMG/M |
3300012206|Ga0137380_11381696 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300012208|Ga0137376_10220937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1641 | Open in IMG/M |
3300012211|Ga0137377_11100059 | Not Available | 725 | Open in IMG/M |
3300012350|Ga0137372_10079548 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
3300012357|Ga0137384_11462125 | Not Available | 532 | Open in IMG/M |
3300012361|Ga0137360_10443316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
3300012361|Ga0137360_11058771 | Not Available | 700 | Open in IMG/M |
3300012361|Ga0137360_11102321 | Not Available | 686 | Open in IMG/M |
3300012362|Ga0137361_10862633 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300012362|Ga0137361_11380854 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300012363|Ga0137390_10128852 | Not Available | 2508 | Open in IMG/M |
3300012582|Ga0137358_10915508 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300012924|Ga0137413_10292196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
3300012925|Ga0137419_11130083 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300012925|Ga0137419_11147633 | Not Available | 649 | Open in IMG/M |
3300012927|Ga0137416_10030417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3589 | Open in IMG/M |
3300012927|Ga0137416_10780582 | Not Available | 844 | Open in IMG/M |
3300012929|Ga0137404_12046893 | Not Available | 534 | Open in IMG/M |
3300012930|Ga0137407_10137906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2140 | Open in IMG/M |
3300012930|Ga0137407_12257096 | Not Available | 520 | Open in IMG/M |
3300012930|Ga0137407_12309275 | Not Available | 514 | Open in IMG/M |
3300012944|Ga0137410_11376120 | Not Available | 612 | Open in IMG/M |
3300012971|Ga0126369_10830651 | Not Available | 1007 | Open in IMG/M |
3300012971|Ga0126369_12226409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300014501|Ga0182024_10042669 | All Organisms → cellular organisms → Bacteria | 7400 | Open in IMG/M |
3300015053|Ga0137405_1058863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1561 | Open in IMG/M |
3300015053|Ga0137405_1143234 | Not Available | 505 | Open in IMG/M |
3300015241|Ga0137418_10673294 | Not Available | 799 | Open in IMG/M |
3300015242|Ga0137412_10838581 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300015264|Ga0137403_10639785 | Not Available | 926 | Open in IMG/M |
3300015356|Ga0134073_10082982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
3300015373|Ga0132257_103577209 | Not Available | 565 | Open in IMG/M |
3300016357|Ga0182032_11090375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300017823|Ga0187818_10343484 | Not Available | 658 | Open in IMG/M |
3300017943|Ga0187819_10297806 | Not Available | 938 | Open in IMG/M |
3300017955|Ga0187817_10652314 | Not Available | 671 | Open in IMG/M |
3300017961|Ga0187778_11164753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300020579|Ga0210407_10236605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1422 | Open in IMG/M |
3300020579|Ga0210407_10536339 | Not Available | 914 | Open in IMG/M |
3300020580|Ga0210403_10055323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3175 | Open in IMG/M |
3300020580|Ga0210403_10152684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1889 | Open in IMG/M |
3300020580|Ga0210403_10174923 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
3300020580|Ga0210403_10816749 | Not Available | 740 | Open in IMG/M |
3300020581|Ga0210399_10147243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1947 | Open in IMG/M |
3300020581|Ga0210399_11379207 | Not Available | 552 | Open in IMG/M |
3300021046|Ga0215015_10051818 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300021086|Ga0179596_10425653 | Not Available | 671 | Open in IMG/M |
3300021168|Ga0210406_10165432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1851 | Open in IMG/M |
3300021168|Ga0210406_10949013 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300021178|Ga0210408_10604668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 868 | Open in IMG/M |
3300021178|Ga0210408_11015252 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300021401|Ga0210393_11232805 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300021406|Ga0210386_10125757 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
3300021407|Ga0210383_10000388 | All Organisms → cellular organisms → Bacteria | 42003 | Open in IMG/M |
3300021432|Ga0210384_10403251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
3300021433|Ga0210391_10373653 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300021478|Ga0210402_10806452 | Not Available | 864 | Open in IMG/M |
3300021478|Ga0210402_11298792 | Not Available | 655 | Open in IMG/M |
3300021559|Ga0210409_10743925 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300021559|Ga0210409_11173561 | Not Available | 643 | Open in IMG/M |
3300021559|Ga0210409_11441963 | Not Available | 564 | Open in IMG/M |
3300022557|Ga0212123_10061288 | All Organisms → cellular organisms → Bacteria | 3327 | Open in IMG/M |
3300022840|Ga0224549_1062689 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300024286|Ga0247687_1020668 | Not Available | 930 | Open in IMG/M |
3300026294|Ga0209839_10214831 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300026318|Ga0209471_1253679 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300026320|Ga0209131_1341271 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300026323|Ga0209472_1274785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300026327|Ga0209266_1161573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
3300026342|Ga0209057_1109842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
3300026356|Ga0257150_1064388 | Not Available | 551 | Open in IMG/M |
3300026547|Ga0209156_10025996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3403 | Open in IMG/M |
3300026552|Ga0209577_10873960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300026557|Ga0179587_10246602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
3300027074|Ga0208092_101810 | Not Available | 1183 | Open in IMG/M |
3300027502|Ga0209622_1030891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
3300027548|Ga0209523_1020971 | Not Available | 1278 | Open in IMG/M |
3300027565|Ga0209219_1096761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300027603|Ga0209331_1023724 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
3300027605|Ga0209329_1065639 | Not Available | 781 | Open in IMG/M |
3300027635|Ga0209625_1110766 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300027651|Ga0209217_1026554 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
3300027654|Ga0209799_1152896 | Not Available | 525 | Open in IMG/M |
3300027678|Ga0209011_1024484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1946 | Open in IMG/M |
3300027678|Ga0209011_1032425 | Not Available | 1653 | Open in IMG/M |
3300027795|Ga0209139_10006550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 4395 | Open in IMG/M |
3300027846|Ga0209180_10732965 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300027862|Ga0209701_10161014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
3300027875|Ga0209283_10095283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1942 | Open in IMG/M |
3300027875|Ga0209283_10570148 | Not Available | 721 | Open in IMG/M |
3300027882|Ga0209590_10327205 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300027882|Ga0209590_10343922 | Not Available | 961 | Open in IMG/M |
3300027884|Ga0209275_10488231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300027903|Ga0209488_10989062 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300027903|Ga0209488_11204871 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300027910|Ga0209583_10045101 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300028863|Ga0302218_10259324 | Not Available | 560 | Open in IMG/M |
3300030058|Ga0302179_10005430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7013 | Open in IMG/M |
3300030946|Ga0075379_11361430 | Not Available | 524 | Open in IMG/M |
3300031057|Ga0170834_110724321 | Not Available | 1650 | Open in IMG/M |
3300031226|Ga0307497_10312772 | Not Available | 724 | Open in IMG/M |
3300031546|Ga0318538_10109390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1435 | Open in IMG/M |
3300031546|Ga0318538_10115939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
3300031573|Ga0310915_10411381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 961 | Open in IMG/M |
3300031679|Ga0318561_10041646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2267 | Open in IMG/M |
3300031715|Ga0307476_10352676 | Not Available | 1083 | Open in IMG/M |
3300031720|Ga0307469_10177908 | Not Available | 1632 | Open in IMG/M |
3300031754|Ga0307475_10159512 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
3300031754|Ga0307475_10409709 | Not Available | 1089 | Open in IMG/M |
3300031754|Ga0307475_10801468 | Not Available | 747 | Open in IMG/M |
3300031754|Ga0307475_10815319 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300031754|Ga0307475_11181666 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300031819|Ga0318568_10480131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
3300031962|Ga0307479_10280347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1648 | Open in IMG/M |
3300031962|Ga0307479_10900052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
3300032039|Ga0318559_10102170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
3300032041|Ga0318549_10105003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1234 | Open in IMG/M |
3300032180|Ga0307471_103651074 | Not Available | 544 | Open in IMG/M |
3300032783|Ga0335079_10001742 | All Organisms → cellular organisms → Bacteria | 24856 | Open in IMG/M |
3300032805|Ga0335078_10016156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11075 | Open in IMG/M |
3300032955|Ga0335076_10253920 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.58% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.01% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.46% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.19% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.64% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.64% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.64% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.09% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.09% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.55% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.55% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.55% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.55% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.55% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027074 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030946 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FWIRA_08903900 | 2124908009 | Soil | AYSGKVAGRFSQSFAEWTERESVLCARYAAVQIDRRWQANLALAASIRSC |
JGI12635J15846_101382851 | 3300001593 | Forest Soil | LVDTIGTLAGTRLPAIAAWSKRETTVCARYAAVQIDRRWQANLELAAALRSC* |
JGI12635J15846_104599081 | 3300001593 | Forest Soil | IAAWTEQELAVCARYAAVQVDRRLHANLELAASMRSC* |
JGIcombinedJ26739_1001937911 | 3300002245 | Forest Soil | SVAGRSMPAVGAWSQRELAVCARYAAVQIDRRLQANLELAASLRSC* |
JGIcombinedJ26739_1017261681 | 3300002245 | Forest Soil | SMPAVAAWSERELTICARYAAVQIDQRLQANLELAASLRSC* |
JGI25617J43924_102061122 | 3300002914 | Grasslands Soil | AGTRMPAIAAWSEREAAVCARYAAVQIDRRLQANLELAASXRSC* |
JGI25616J43925_102940612 | 3300002917 | Grasslands Soil | YTLVASIASLAGRSMPAVAAWSERELTICARYAAVQIDRRLQANLELAASLRSC* |
Ga0062385_101423872 | 3300004080 | Bog Forest Soil | AFVGSRMPAIAAWSERERVVCARYAAVQIERRLETNLALAASLRSC* |
Ga0066672_104529843 | 3300005167 | Soil | ALGAVAGRFSTSLAEWSEREKVLCARYAAVQIDKRSQANLALAASLRSC* |
Ga0066676_105648841 | 3300005186 | Soil | DSLVANKIPAIAAWSERERGICARYAAVQVDRRLQANLDLLASLRSC* |
Ga0070689_1014966731 | 3300005340 | Switchgrass Rhizosphere | LIGRHMPSVAAWCDQELTVCARYAAVQIDRRLQANLELAASLRSC* |
Ga0070714_1012872521 | 3300005435 | Agricultural Soil | PAIAAWSQRELTVCARYAAVQIDRRLQANLELAASLRSC* |
Ga0070698_1004832221 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TGLADWAESERVLCARYAAVQVDRRLQANLALAASIRSC* |
Ga0070699_1002993991 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RIAALVEWAESERLLCARYAAVQIDRRLQANLELAASMRSC* |
Ga0070699_1005533342 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LVGTSMPAVGAWTQRELAVCARYAAVQIDRRLQANIALAESLRSC* |
Ga0070741_102321143 | 3300005529 | Surface Soil | SQVPSLAAWSQRERATCARYAAVQIDRRLQANLALVASLRSC* |
Ga0070697_1016867642 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAIGAWSQRELAVCARYAAVQIDRRWQANLELAASLRSC* |
Ga0066695_106158211 | 3300005553 | Soil | PAIAAWSERERGICARYAAVQVDRRLQANLDLLASLRSC* |
Ga0066704_104563283 | 3300005557 | Soil | LGAVAGRFSTSLAEWSEREKVLCARYAAVQIDKRLQANLALAASLRSC* |
Ga0066704_105318322 | 3300005557 | Soil | TGLADWAESERVLCARYAAVQVDRRLQANLALAASIRSY* |
Ga0068859_1004646071 | 3300005617 | Switchgrass Rhizosphere | DGVSALIGRHMPSVAAWCDQELTVCARYAAVQIDRRLQANLELAASLRSC* |
Ga0068866_101885751 | 3300005718 | Miscanthus Rhizosphere | HMPSVAAWCDQELTVCARYAAVQIDRRLQANLELAASLRSC* |
Ga0068858_1019728791 | 3300005842 | Switchgrass Rhizosphere | LANWAERERLLCVRYAAVQVDRRLQSNIALAASIRSC* |
Ga0081540_12006342 | 3300005983 | Tabebuia Heterophylla Rhizosphere | GRFSSEANWAEGERLLCARYAAVQVDRRLQSNLALAAAIRSC* |
Ga0075026_1008287502 | 3300006057 | Watersheds | IEGLDSVFGKMLPAVAAWSERERVICARYAAVQVGRRLQANLELAASMRSC* |
Ga0079222_100678023 | 3300006755 | Agricultural Soil | SLADWCERERVICARYAAVQIGLRLQANLELAAALRSC* |
Ga0075425_10000073924 | 3300006854 | Populus Rhizosphere | TVANWAERERILCARYAAVQVDRRLQSNLALAAAIRSC* |
Ga0075425_1020095621 | 3300006854 | Populus Rhizosphere | GVSVRVGRHMPSVAAWCDQELTVCARYAAVQIDRRLQANLELAASLRSC* |
Ga0075436_1003819903 | 3300006914 | Populus Rhizosphere | FSTSIAEWSEREKVLCARYAAVQIDKRLRANLALAASIRSC* |
Ga0099795_102639401 | 3300007788 | Vadose Zone Soil | SLVQALGAVAGTRLPAMAAWSEREAALCARYAAVQVDRRWQANLELAAAIRSC* |
Ga0066710_1002643711 | 3300009012 | Grasslands Soil | LYYRLIEGLDSLVANKIPAIAAWSERERGICARYAAVQVDRRLQANLDLLASLRSC |
Ga0099829_111420151 | 3300009038 | Vadose Zone Soil | IAAWSEHERVICARYAAVQVDRRLQANLDLLASLRSS* |
Ga0099827_106862802 | 3300009090 | Vadose Zone Soil | FTAWSERERALCARYAAVQVDRRLQANLDLATSLRSC* |
Ga0099827_109039232 | 3300009090 | Vadose Zone Soil | GLANWAESERVLCARYAAVQVDRRLQANLQLAASMRSC* |
Ga0066709_1038811791 | 3300009137 | Grasslands Soil | GRFSTSLAEWSEREKVLCARYAAVQIDKRLQANLALAASLRSC* |
Ga0099792_108210272 | 3300009143 | Vadose Zone Soil | TLAVWSERERVLCARYAAVQVGLRLQANLDLAASLRSC* |
Ga0099792_108704701 | 3300009143 | Vadose Zone Soil | AVASLVGSSMPGVGAWTQRELAVCARYAAVQIDRRLQANLELAESLRSC* |
Ga0099792_112375671 | 3300009143 | Vadose Zone Soil | KIPSFSAWSERERIVCARYAAVQVDRRLQANLDLVASLGSC* |
Ga0116105_12201562 | 3300009624 | Peatland | FAAWSDRERLVCARYAAVQIDRRLESNLALSASLRSC* |
Ga0126380_103391111 | 3300010043 | Tropical Forest Soil | MFAKLASRFSQSMVEWTERERVLCARYAAVQIDRRLQANLALAASIRSC* |
Ga0099796_101069881 | 3300010159 | Vadose Zone Soil | LVDGVASLVGSSMPGVGAWTQRELAVCARYAAVQIDRRLQANLELAESLRSC* |
Ga0099796_101466762 | 3300010159 | Vadose Zone Soil | AWSEREQVLCARYAAVQVDRRLQANLDLAASLRSC* |
Ga0099796_102928511 | 3300010159 | Vadose Zone Soil | RAYYSLVDSISSLIGRSLPAVGAWSQRELAVCARYAAVQIDRRLQANLELAESLRSC* |
Ga0134067_101355491 | 3300010321 | Grasslands Soil | LAACSEQERAICARYAAVQVGRRLQANLELAASLRSC* |
Ga0134084_100542101 | 3300010322 | Grasslands Soil | MPALAAWSEQERAICARYAAVQVGRRLQANLELAASLRSC* |
Ga0126378_132050011 | 3300010361 | Tropical Forest Soil | MFPVLAAWSERERVICARYAAVQIDRRLQTNLELAASLRSC* |
Ga0126381_1021496111 | 3300010376 | Tropical Forest Soil | AWSEQERVLCARYTAVQVERRLEANLAQAASLRSC* |
Ga0137392_101518903 | 3300011269 | Vadose Zone Soil | AVAAWSERELTICARYAAVQIDRRLQANLELAASLRSC* |
Ga0137392_102954291 | 3300011269 | Vadose Zone Soil | MEAWCERERLVCARYAAVQIDRRFQANLALAASLRDC* |
Ga0137392_110025481 | 3300011269 | Vadose Zone Soil | VWSERERAICARYAAVLVDRRLQANLDLAASLRSC* |
Ga0137391_111544482 | 3300011270 | Vadose Zone Soil | SLVANKIPAIAAWSEHERVICARYAAVQVDRRLQANLDLLASLRSS* |
Ga0137389_111783451 | 3300012096 | Vadose Zone Soil | SSMPAVGAWTQRELAVCARYAAVQIDRRLQANLELAESLRSC* |
Ga0137388_104217551 | 3300012189 | Vadose Zone Soil | LFLVRVYYRILDAINFLAGRGMPAIAAWSERELAVCARYAAVQIDRRWQANLELAASLRSC* |
Ga0137388_109665011 | 3300012189 | Vadose Zone Soil | SQIPALTAWIEQERTICARYAAVLIDRRLQANLALAASLRSC* |
Ga0137364_113300142 | 3300012198 | Vadose Zone Soil | VWSESERVICARYAAVQVDRRLQANLDLAASLYTC* |
Ga0137365_108324882 | 3300012201 | Vadose Zone Soil | PALAAWSEQERAICARYAAVQVGRRLQANLELAASLRSC* |
Ga0137399_101003241 | 3300012203 | Vadose Zone Soil | VYYRLVDAVASLVGSSMPAVGAWSQRELAVCARYAAVQIDRRLQANLELAESLRSC* |
Ga0137399_109986951 | 3300012203 | Vadose Zone Soil | KFSPSIAEWSERERVLCARYAAVQIDRRLQANLALAASIRSC* |
Ga0137380_113816962 | 3300012206 | Vadose Zone Soil | AWSERERVICVRYAAVQVGRRLQTNLELAASLRSC* |
Ga0137376_102209373 | 3300012208 | Vadose Zone Soil | SSWSERERIICTRYAAVQVDRRLQANLDLVASLRSC* |
Ga0137377_111000592 | 3300012211 | Vadose Zone Soil | FAVWSEHERVLCARYAAVQVDRRLQANLDLAASLRSC* |
Ga0137387_102530393 | 3300012349 | Vadose Zone Soil | HAICALGAVAGKFSPSIAEWSERERVLCARYAAVQIDRRLQANLALAASIRSC* |
Ga0137372_100795483 | 3300012350 | Vadose Zone Soil | AIAAWSERERGICARYAAVQVDRRLQANLDLLASLRSC* |
Ga0137384_114621252 | 3300012357 | Vadose Zone Soil | DWAESERVLCARYAAVQVDRRLQANLALAASIRSC* |
Ga0137360_104433161 | 3300012361 | Vadose Zone Soil | ALVEGIASLAGRSMPAVAAWSERELAVCARYAAVQIDRRLQANLELAASLRSC* |
Ga0137360_110587712 | 3300012361 | Vadose Zone Soil | LAGSRIPAIAAWSNRERGICARYAAVQVDRRLQANLELTASLRSC* |
Ga0137360_111023212 | 3300012361 | Vadose Zone Soil | LATGRIAMLAAWAESERVLCAHYAAVQIDRRLQANLELAASMRSC* |
Ga0137361_108626331 | 3300012362 | Vadose Zone Soil | YYALVEGIASLAGRSMPAVAAWSERELAVCARYAAVQIDRRLQANLELAASLRSC* |
Ga0137361_113808542 | 3300012362 | Vadose Zone Soil | IGSLAGRGMPAIGAWSQRELAVCARYAAVQIDRRWQANLELAASLRSC* |
Ga0137390_101288521 | 3300012363 | Vadose Zone Soil | MPAIAAWSEREAAVCARYAAVQIDRRLQANLELAASLRSC* |
Ga0137358_109155082 | 3300012582 | Vadose Zone Soil | SLVGRSMPAVAAWSERELTICARYAAVQIDQRLQANLELAASLRSC* |
Ga0137413_102921962 | 3300012924 | Vadose Zone Soil | VGAWTQRELAVCARYAAVQIDRRLQANLELAESLRSC* |
Ga0137419_111300832 | 3300012925 | Vadose Zone Soil | ASLAGSSMPGVGAWTQRELAVCARYAAVQIDRRLQANLELAESLRSC* |
Ga0137419_111476331 | 3300012925 | Vadose Zone Soil | IAALANWAESERVLCARYAAVQVDRRLQANLQLAASMRSC* |
Ga0137416_100304171 | 3300012927 | Vadose Zone Soil | AWTQRELAVCARYAAVQIDRRLQANLELAESLRSC* |
Ga0137416_107805821 | 3300012927 | Vadose Zone Soil | IFGKKIPAFALWSERERAICARYAAVLVDRRLQANLELATSLRSC* |
Ga0137404_120468932 | 3300012929 | Vadose Zone Soil | AGSRVPAIAAWSNRERAICARYAAVQVDRRLQANLEHAASLRSC* |
Ga0137407_101379063 | 3300012930 | Vadose Zone Soil | WGQRERAICARYAAVQIDRRLQANLALAAALRSC* |
Ga0137407_122570962 | 3300012930 | Vadose Zone Soil | PAIAAWSNRERAICARYAAVQVDRRLQANLEHAASLRSC* |
Ga0137407_123092751 | 3300012930 | Vadose Zone Soil | IAAWSNRERAICARYAAVQVDRRLQANLEHAASLRSC* |
Ga0137410_113761201 | 3300012944 | Vadose Zone Soil | LAGSHIPAIAVWSNRERGICARYAAVQVDRRLQANLELAASLRSC* |
Ga0126369_108306512 | 3300012971 | Tropical Forest Soil | SFMPSVVAWGQRERAICARYAAVQIERRLQANLELAASLRSC* |
Ga0126369_122264091 | 3300012971 | Tropical Forest Soil | ANWAERERMLCARYAAVQVDRRQQSNLALAAAIRSC* |
Ga0182024_1004266910 | 3300014501 | Permafrost | PVVAQWSEREGAICARYAAVQVDQRLQANLELAAALRSC* |
Ga0137405_10588631 | 3300015053 | Vadose Zone Soil | PLPVRAFPLLSPWSNRERGICARYAAVQVDRRLQANLELAASLRSC* |
Ga0137405_11432341 | 3300015053 | Vadose Zone Soil | VEWTERERVLCARYAAVQIDRRLQANLALAASIRSC* |
Ga0137418_106732942 | 3300015241 | Vadose Zone Soil | VWSERERIICARYAAVQVDRRLQANLDLVASLRSC* |
Ga0137412_108385811 | 3300015242 | Vadose Zone Soil | ISSLIGRSLPAVGAWSERELAVCARYAAVQIDRRLQANLELAESLRSC* |
Ga0137403_106397851 | 3300015264 | Vadose Zone Soil | EWSERERVLCARYAAVQIDRRLQANLALAASIRSC* |
Ga0134073_100829821 | 3300015356 | Grasslands Soil | AAWSEQERAICARYAAVQVGRRLQANLELAASLRSC* |
Ga0132257_1035772092 | 3300015373 | Arabidopsis Rhizosphere | AGLADWAERERVLCARYAAVQMDRRLQSNLALAAAIRSF* |
Ga0182032_110903752 | 3300016357 | Soil | MPVLADWSERERAICARYAAVEVGRRLQLNLELAASLRSC |
Ga0187818_103434842 | 3300017823 | Freshwater Sediment | LPSLAAWSDRERVICTRYAAVLVERRLQANLELAASLRSC |
Ga0187819_102978062 | 3300017943 | Freshwater Sediment | LAAWSDRERVICTRYAAVLVERRLQANLELAASLRSC |
Ga0187817_106523141 | 3300017955 | Freshwater Sediment | KLPSLAAWSDRERVICTRYAAVLVERRLQANLELAASLRSC |
Ga0187778_111647531 | 3300017961 | Tropical Peatland | RMPAMAAWCEHERLICARYAAVQIDRRLQANLELAAALRSC |
Ga0210407_102366051 | 3300020579 | Soil | LDALVGSRIPAVAAWSIRERVICARYAAVQVDRRLQANLQLAASLRSC |
Ga0210407_105363392 | 3300020579 | Soil | VVEGLDSFVGSRMPAIAAWSERERLVCARYAAVQIDRRLETNLALAASLRSC |
Ga0210403_100553233 | 3300020580 | Soil | LVRVYYALVEGMASLVGRSMPAVAAWSERELAVCARYAAVQIDRRLQANLELAASLRSC |
Ga0210403_101526842 | 3300020580 | Soil | RIPAVAAWSIRERVICARYAAVQVDRRLQANLQLAASLRSC |
Ga0210403_101749231 | 3300020580 | Soil | SFAVWSERERVICTRYAAVQVDRRLQANLDLAASLRSC |
Ga0210403_108167491 | 3300020580 | Soil | SGRVAALANWAESECILCARYAAVQIDRRLQANLELAASMRSC |
Ga0210399_101472431 | 3300020581 | Soil | MPAVAEWCERERVICARYAAVQIDRRLQANLALVAALRSC |
Ga0210399_113792071 | 3300020581 | Soil | VGARIPAVAAWSIRERVICARYAAVQVDRRLQANLQLAASLRSC |
Ga0215015_100518182 | 3300021046 | Soil | MPAIAAWSEREAAVCARYAAVQIDRRLQANLELAASLRSC |
Ga0179596_104256532 | 3300021086 | Vadose Zone Soil | AVAAWCEQELAVCARYAAVQIECRLRSNLELAAAMRSC |
Ga0210406_101654322 | 3300021168 | Soil | YALVDGIGSLVGRSMPAVAAWSERELTICARYAAVQIDQRLQANLELAASLRSC |
Ga0210406_109490132 | 3300021168 | Soil | IAGWAESERILCARYAAVQVDRRLQANLALAASIRSC |
Ga0210408_106046682 | 3300021178 | Soil | MPAVAAWSERELAICAHYAAIHINRRCQANLEQAASARSY |
Ga0210408_110152521 | 3300021178 | Soil | AWSEQELAVCARYAAVQIDRRLQANLELAAALRSC |
Ga0210393_112328051 | 3300021401 | Soil | IASRVGRSMPAVAAWSQRELTVCARYAAVQIDRRLQANLELAASLRSC |
Ga0210386_101257573 | 3300021406 | Soil | DAIASLVGRSLPAVRAWSERELAVCARYAAVQIDRRLQANLELAASLRSC |
Ga0210383_1000038832 | 3300021407 | Soil | PNLAQWGAQEQALCARYAAVQIDRRMQANLELAASMRSC |
Ga0210384_104032511 | 3300021432 | Soil | PALAEWCERESVICARYAAVQIDRRLQVNLALMAALRSC |
Ga0210391_103736533 | 3300021433 | Soil | TLAGNRMPALAAWCEQELTVCARYAAVQIECRLRSNLELAASMRAC |
Ga0210402_108064521 | 3300021478 | Soil | LAAWCDQERAICARYAAVQIDVRLQMNYELAASLRSC |
Ga0210402_112987922 | 3300021478 | Soil | MPAVAAWCDQELAVCARYAAVQVDLRLQANLELAASLRSC |
Ga0210409_107439251 | 3300021559 | Soil | AVAAWSEQELAVCARYAAVQIDRRLQANLELAAALRSC |
Ga0210409_111735612 | 3300021559 | Soil | IGTVAGRRMPTLAAWTERELAICARYAAVQIDRRLKSNFALAASARSW |
Ga0210409_114419631 | 3300021559 | Soil | VAAWSNRERGICARYAAVQVDRRLQANLELAASLRSC |
Ga0212123_100612881 | 3300022557 | Iron-Sulfur Acid Spring | SPGMASWSERERTICARYAAVQVDRRLEANLAFSASLRSC |
Ga0224549_10626891 | 3300022840 | Soil | IAAWAESELATCARYAAVQIERRLQANLEQAAAIRSC |
Ga0247687_10206683 | 3300024286 | Soil | EWSEREKVLCARYAAVQIDKRLQANLALAASIRSC |
Ga0247668_10305181 | 3300024331 | Soil | LYYHAIRALGAVAGKFSTSIAEWSEREKVLCARYAAVQIDKRLQANLALAASIRSC |
Ga0209839_102148311 | 3300026294 | Soil | SMAAVAGQRMPAVAAWCDLELAVCARYAAVQIECRLRSNLELAAAMRSC |
Ga0209471_12536791 | 3300026318 | Soil | GLLPMLTAWSERERVICARYAAVQVDRRLQANLELAASLRSC |
Ga0209131_13412712 | 3300026320 | Grasslands Soil | VDAVASLVGSSMPAVGAWSQRELAVCARYAAVQIDRRLEANLELAESLRSC |
Ga0209472_12747851 | 3300026323 | Soil | MLTAWSERERVVCARYAAVQVDRRLQANLELAASLRSC |
Ga0209266_11615732 | 3300026327 | Soil | ALAAWSEQERAICARYAAVQVGRRLQANLELAASLRSC |
Ga0209057_11098421 | 3300026342 | Soil | LGVLLGKHMPALAAWSEQERAICARYAAVQVGRRLQANLELAASLRSC |
Ga0257150_10643882 | 3300026356 | Soil | RIAALANWAESERVLCARYTAVQVGRRLQANLQLAASMRSC |
Ga0209156_100259961 | 3300026547 | Soil | AWSEQERAICARYAAVQVGRRLQANLELAASLRSC |
Ga0209577_108739602 | 3300026552 | Soil | AWSERERVICARYAAVQVGRRLQANLDLAASLRSC |
Ga0179587_102466021 | 3300026557 | Vadose Zone Soil | FSAWSERELIICARYAAVQVDRRLQANLDLVASLRSC |
Ga0179587_106359681 | 3300026557 | Vadose Zone Soil | LGAVAGKFSPSIAEWSERERVLCARYAAVQIDRRLQANLALAASIRSC |
Ga0208092_1018102 | 3300027074 | Forest Soil | SWIEQERTICARYAAVQIDRRLQANMALAASLRSC |
Ga0209622_10308912 | 3300027502 | Forest Soil | KLASGRVAALANWAESERILCARYAAVQIDRRLQANLELAASMRSC |
Ga0209523_10209712 | 3300027548 | Forest Soil | SGRVAALASWAESERILCARYAAVQIDRRLQANLELAASMRSC |
Ga0209219_10967611 | 3300027565 | Forest Soil | PSVAEWCERERVICARYAAVQIDRRLQVNLALAAALRSC |
Ga0209331_10237241 | 3300027603 | Forest Soil | PAVAAWSERELAVCARYAAVQIDRRLQANLELAASLRSC |
Ga0209329_10656391 | 3300027605 | Forest Soil | VPVVAQWIEREGSICARYAAVQIDQRLQANMELAAALRSC |
Ga0209625_11107661 | 3300027635 | Forest Soil | GLGLVRAYYALVGGIGSLVGRSMPAVAAWSERELTICARYAAVQIDQRLQANLELAASLRSC |
Ga0209217_10265541 | 3300027651 | Forest Soil | NSLGPVRLYYALVDGIASLVGRSMPAVAAWSERELAVCARYAAVQIDLRLQANLELAASLRSC |
Ga0209799_11528962 | 3300027654 | Tropical Forest Soil | EALETLFGSFMPSVVAWGQRERAICARYAAVQIERRLQANLELAASLRSC |
Ga0209011_10244841 | 3300027678 | Forest Soil | AAWTEQELAVCARYAAVQVDRRLHANLELAASMRSC |
Ga0209011_10324253 | 3300027678 | Forest Soil | GLSWFKKRELSRVPAIAQWTEREGAICARYAAVQVDQRLQGNLQLAAVLRSC |
Ga0209139_100065501 | 3300027795 | Bog Forest Soil | GRMPGVAAWCERERVICARFAAVQIDRRLQGNLALAAALRSC |
Ga0209180_107329651 | 3300027846 | Vadose Zone Soil | SSMPVVGAWTQRELTVCARYAAVQIDRRLQANLELAESLRSC |
Ga0209701_101610141 | 3300027862 | Vadose Zone Soil | RMPAIAAWSEREAAVCARYAAVQIDRRLQANLELAASLRSC |
Ga0209283_100952831 | 3300027875 | Vadose Zone Soil | GAWTQRELTVCARYAAVQIDRRLQANLELAESLRSC |
Ga0209283_105701482 | 3300027875 | Vadose Zone Soil | AVWSERERAICARYAAVLVDRRLQANLDLAASLRSC |
Ga0209590_103272051 | 3300027882 | Vadose Zone Soil | AAWSEREAAVCARYAAVQIDRRLQANLELAASLRSC |
Ga0209590_103439221 | 3300027882 | Vadose Zone Soil | GRIPIFSSWSERERIICTRYAAVQVDRRLRANLDLVASLHSC |
Ga0209275_104882311 | 3300027884 | Soil | PLVAEWCERERVICARYAAVQIDRRLQVNLALAAALRSC |
Ga0209488_109890621 | 3300027903 | Vadose Zone Soil | LSLVRIYYRLVDAVASLAGSSMPGVGAWTQRELAVCARYAAVQIDRRLQANLELAESLRS |
Ga0209488_112048711 | 3300027903 | Vadose Zone Soil | VGSSMPGVGAWTQRELAVCARYAAVQIDRRLQANLELAESLRSC |
Ga0209583_100451011 | 3300027910 | Watersheds | GYYALVHGIASRVGRSMPSVAAWSQRELTVCARYAAVQIDRRLQANLELAASLRSC |
Ga0247682_10443803 | 3300028146 | Soil | LLGFVAGKFSASLAQWSEREKVLCARYAAVQIDKRLQANLALAASIRSC |
Ga0302218_102593242 | 3300028863 | Palsa | FPGVAAWSERERTICARYAAVQIDRRLQANLALCASLRSC |
Ga0302179_100054309 | 3300030058 | Palsa | AGLLGKYFPGVAAWSERERTICARYAAVQIDRRLQANLALCASLRSC |
Ga0075379_113614301 | 3300030946 | Soil | GRVAALATWAESERILCARYAAVQIDRRLQANLELAASMRSC |
Ga0170834_1107243211 | 3300031057 | Forest Soil | SGRITGLANWAESERVLCARYAAVQVDRRLQANLQLAASMRSC |
Ga0307497_103127722 | 3300031226 | Soil | RIAAIADWAERERILCARFAAVQVDKRLQANLALAAAIRSC |
Ga0318538_101093903 | 3300031546 | Soil | SPAVLNWGARERVLCARYAAVQIGHRLQANLAQAASMRSC |
Ga0318538_101159393 | 3300031546 | Soil | GRVGAVANWAERERIVCARYAAVQVDRRLQSNLALAAAIRSC |
Ga0310915_104113811 | 3300031573 | Soil | AVANWAERERIVCARYAAVQVDRRLQSNLALAAAIRSC |
Ga0318561_100416461 | 3300031679 | Soil | ANWAESERMLCVRYAAVQVDRRLKSNLALAASIRSC |
Ga0307476_103526762 | 3300031715 | Hardwood Forest Soil | SDWAESERVLCARYAAVQIDRRLQANLALAASMRSC |
Ga0307469_101779081 | 3300031720 | Hardwood Forest Soil | LVAGKFSASVAQWSEREKVLCARYAAVQIDKRLQANLALAASIRSC |
Ga0307475_101595123 | 3300031754 | Hardwood Forest Soil | YRFVDAIHSLAGRTMPAIAAWSQRELTVCARYAAVQIDRRWQANLDLAASLRSC |
Ga0307475_104097091 | 3300031754 | Hardwood Forest Soil | LVDGIASLLGHSMPAIAAWSERELAVCSRYAAVQIDRRLQVNLELAASMRSC |
Ga0307475_108014682 | 3300031754 | Hardwood Forest Soil | ALAVWSEQERILCARYAAVQIDRRLQANLALAASLRSC |
Ga0307475_108153192 | 3300031754 | Hardwood Forest Soil | YSLVEGIESLAGSSMPAVGAWSQRELAVCARYAAVQIDRRLQANLELAESLRSC |
Ga0307475_111816662 | 3300031754 | Hardwood Forest Soil | YALVDGLGSLVGRSMPSVAAWSQRELAVCARYAAVQIDRRLQANLELAASLRSC |
Ga0318568_104801311 | 3300031819 | Soil | LGVLSGKHLPVLAAWSEQERVICARYAAVEIGRRLQANLELATSLRSS |
Ga0307479_102803471 | 3300031962 | Hardwood Forest Soil | VAQWIEQEGAICARYVAVQIDQRLQANMELAAALRSC |
Ga0307479_109000521 | 3300031962 | Hardwood Forest Soil | AMAEWCEHERVICARYAAVQIDRRLQVNLALVAALRSC |
Ga0318559_101021703 | 3300032039 | Soil | AWSEQERVLCARYTAVQVERRLEANLAQAASLRSC |
Ga0318549_101050033 | 3300032041 | Soil | PVLAAWSEQERVICARYAAVEIGRRLQANLELATSLRSS |
Ga0307471_1036510741 | 3300032180 | Hardwood Forest Soil | GLANWAERERVLCVRYAAVQVDRRLQSNLALAAAIRSC |
Ga0335079_100017421 | 3300032783 | Soil | SAWAEREGMLCARYAAVQIDRRLQANLALAASIRSC |
Ga0335078_100161568 | 3300032805 | Soil | SPAVAIWSEQERVLCARYTAVQVDRRLAGNLAQAASIRSC |
Ga0335076_102539201 | 3300032955 | Soil | VPALADWCERERVICAKFAAVQIDRRLQANLAMAAALRSC |
⦗Top⦘ |