Metagenome Family F030964

Basic Information
Family ID	F030964
Family Type	Metagenome
Number of Sequences	183
Average Sequence Length	41 residues
Representative Sequence	VLFRKVLVDGGSALNLLFAGALKELGLGITDLTPSDSSF
Number of Associated Samples	73
Number of Associated Scaffolds	183

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	12.78 %
% of genes near scaffold ends (potentially truncated)	37.70 %
% of genes from short scaffolds (< 2000 bps)	98.36 %
Associated GOLD sequencing projects	73
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Unclassified (73.770 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.814 % of family members)
Environment Ontology (ENVO)	Unclassified (97.814 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (97.814 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18%
Feature Viewer

Powered by Feature Viewer

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
All Organisms	root	All Organisms	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
cellular organisms	root	All Organisms → cellular organisms	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	26.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	25.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	25.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	21.31 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	2.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	21.31 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	2.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	21.31 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	21.31 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	21.31 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.77 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	21.31 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.55 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005718\|Ga0068866_11366393	Not Available	517	Open in IMG/M
3300009098\|Ga0105245_13066928	Not Available	518	Open in IMG/M
3300014745\|Ga0157377_11220473	Not Available	583	Open in IMG/M
3300015267\|Ga0182122_1009574	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	868	Open in IMG/M
3300015267\|Ga0182122_1034828	Not Available	617	Open in IMG/M
3300015268\|Ga0182154_1025193	Not Available	676	Open in IMG/M
3300015268\|Ga0182154_1054874	Not Available	548	Open in IMG/M
3300015269\|Ga0182113_1012058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	919	Open in IMG/M
3300015269\|Ga0182113_1037005	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	673	Open in IMG/M
3300015269\|Ga0182113_1038718	Not Available	664	Open in IMG/M
3300015269\|Ga0182113_1094779	Not Available	506	Open in IMG/M
3300015274\|Ga0182188_1028599	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	617	Open in IMG/M
3300015274\|Ga0182188_1047752	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	541	Open in IMG/M
3300015275\|Ga0182172_1014118	Not Available	803	Open in IMG/M
3300015275\|Ga0182172_1018261	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	749	Open in IMG/M
3300015275\|Ga0182172_1075649	Not Available	504	Open in IMG/M
3300015276\|Ga0182170_1017007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	769	Open in IMG/M
3300015276\|Ga0182170_1048533	Not Available	577	Open in IMG/M
3300015277\|Ga0182128_1045953	Not Available	590	Open in IMG/M
3300015277\|Ga0182128_1070499	Not Available	521	Open in IMG/M
3300015279\|Ga0182174_1010996	Not Available	893	Open in IMG/M
3300015279\|Ga0182174_1086324	Not Available	500	Open in IMG/M
3300015281\|Ga0182160_1083765	Not Available	503	Open in IMG/M
3300015282\|Ga0182124_1053759	Not Available	571	Open in IMG/M
3300015282\|Ga0182124_1076166	Not Available	515	Open in IMG/M
3300015283\|Ga0182156_1025391	Not Available	720	Open in IMG/M
3300015283\|Ga0182156_1036378	Not Available	651	Open in IMG/M
3300015283\|Ga0182156_1057215	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	573	Open in IMG/M
3300015283\|Ga0182156_1070713	Not Available	537	Open in IMG/M
3300015283\|Ga0182156_1078289	Not Available	521	Open in IMG/M
3300015283\|Ga0182156_1079867	Not Available	518	Open in IMG/M
3300015283\|Ga0182156_1081867	Not Available	514	Open in IMG/M
3300015285\|Ga0182186_1019970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	758	Open in IMG/M
3300015285\|Ga0182186_1052153	Not Available	578	Open in IMG/M
3300015285\|Ga0182186_1072398	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	524	Open in IMG/M
3300015286\|Ga0182176_1018045	Not Available	820	Open in IMG/M
3300015286\|Ga0182176_1032257	Not Available	683	Open in IMG/M
3300015286\|Ga0182176_1032397	Not Available	682	Open in IMG/M
3300015286\|Ga0182176_1044241	Not Available	620	Open in IMG/M
3300015287\|Ga0182171_1011197	Not Available	895	Open in IMG/M
3300015287\|Ga0182171_1064384	Not Available	554	Open in IMG/M
3300015287\|Ga0182171_1067182	Not Available	547	Open in IMG/M
3300015288\|Ga0182173_1023875	Not Available	725	Open in IMG/M
3300015289\|Ga0182138_1037752	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	647	Open in IMG/M
3300015289\|Ga0182138_1066518	Not Available	549	Open in IMG/M
3300015291\|Ga0182125_1014449	Not Available	858	Open in IMG/M
3300015291\|Ga0182125_1066517	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	560	Open in IMG/M
3300015292\|Ga0182141_1025426	Not Available	735	Open in IMG/M
3300015294\|Ga0182126_1040401	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	650	Open in IMG/M
3300015295\|Ga0182175_1020007	Not Available	798	Open in IMG/M
3300015295\|Ga0182175_1036623	Not Available	674	Open in IMG/M
3300015295\|Ga0182175_1040431	Not Available	656	Open in IMG/M
3300015296\|Ga0182157_1086824	Not Available	531	Open in IMG/M
3300015296\|Ga0182157_1096137	Not Available	514	Open in IMG/M
3300015298\|Ga0182106_1041180	Not Available	663	Open in IMG/M
3300015298\|Ga0182106_1048101	Not Available	634	Open in IMG/M
3300015298\|Ga0182106_1072211	Not Available	561	Open in IMG/M
3300015298\|Ga0182106_1094165	Not Available	517	Open in IMG/M
3300015298\|Ga0182106_1102158	Not Available	503	Open in IMG/M
3300015299\|Ga0182107_1040698	Not Available	668	Open in IMG/M
3300015299\|Ga0182107_1063980	Not Available	586	Open in IMG/M
3300015299\|Ga0182107_1097904	Not Available	513	Open in IMG/M
3300015299\|Ga0182107_1105063	Not Available	501	Open in IMG/M
3300015300\|Ga0182108_1082064	Not Available	546	Open in IMG/M
3300015302\|Ga0182143_1003164	Not Available	1336	Open in IMG/M
3300015302\|Ga0182143_1087978	Not Available	530	Open in IMG/M
3300015302\|Ga0182143_1101182	Not Available	507	Open in IMG/M
3300015303\|Ga0182123_1029011	Not Available	713	Open in IMG/M
3300015303\|Ga0182123_1053012	Not Available	604	Open in IMG/M
3300015304\|Ga0182112_1062076	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	592	Open in IMG/M
3300015304\|Ga0182112_1063625	Not Available	588	Open in IMG/M
3300015305\|Ga0182158_1055826	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	608	Open in IMG/M
3300015305\|Ga0182158_1062771	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	588	Open in IMG/M
3300015305\|Ga0182158_1102945	Not Available	505	Open in IMG/M
3300015307\|Ga0182144_1035484	Not Available	702	Open in IMG/M
3300015308\|Ga0182142_1017455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	877	Open in IMG/M
3300015308\|Ga0182142_1065439	Not Available	600	Open in IMG/M
3300015308\|Ga0182142_1111455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	508	Open in IMG/M
3300015314\|Ga0182140_1025229	Not Available	791	Open in IMG/M
3300015314\|Ga0182140_1039722	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	696	Open in IMG/M
3300015314\|Ga0182140_1047608	Not Available	661	Open in IMG/M
3300015321\|Ga0182127_1028724	Not Available	787	Open in IMG/M
3300015322\|Ga0182110_1052036	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	659	Open in IMG/M
3300015322\|Ga0182110_1056281	Not Available	644	Open in IMG/M
3300015322\|Ga0182110_1074908	Not Available	591	Open in IMG/M
3300015322\|Ga0182110_1120571	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	507	Open in IMG/M
3300015323\|Ga0182129_1067760	Not Available	592	Open in IMG/M
3300015323\|Ga0182129_1079489	Not Available	565	Open in IMG/M
3300015323\|Ga0182129_1103243	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	521	Open in IMG/M
3300015323\|Ga0182129_1110979	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	509	Open in IMG/M
3300015341\|Ga0182187_1026459	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1005	Open in IMG/M
3300015341\|Ga0182187_1081849	Not Available	692	Open in IMG/M
3300015341\|Ga0182187_1088754	Not Available	673	Open in IMG/M
3300015341\|Ga0182187_1107721	Not Available	629	Open in IMG/M
3300015342\|Ga0182109_1123657	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	630	Open in IMG/M
3300015342\|Ga0182109_1158749	Not Available	573	Open in IMG/M
3300015342\|Ga0182109_1190772	Not Available	534	Open in IMG/M
3300015342\|Ga0182109_1191265	Not Available	533	Open in IMG/M
3300015342\|Ga0182109_1200837	Not Available	523	Open in IMG/M
3300015342\|Ga0182109_1222818	Not Available	502	Open in IMG/M
3300015343\|Ga0182155_1061401	Not Available	800	Open in IMG/M
3300015343\|Ga0182155_1104886	Not Available	665	Open in IMG/M
3300015344\|Ga0182189_1061671	Not Available	813	Open in IMG/M
3300015344\|Ga0182189_1084858	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	727	Open in IMG/M
3300015345\|Ga0182111_1094645	Not Available	723	Open in IMG/M
3300015345\|Ga0182111_1118290	Not Available	666	Open in IMG/M
3300015345\|Ga0182111_1172884	Not Available	576	Open in IMG/M
3300015345\|Ga0182111_1238796	Not Available	507	Open in IMG/M
3300015346\|Ga0182139_1065471	Not Available	827	Open in IMG/M
3300015346\|Ga0182139_1133243	Not Available	637	Open in IMG/M
3300015346\|Ga0182139_1153559	Not Available	604	Open in IMG/M
3300015346\|Ga0182139_1211333	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	533	Open in IMG/M
3300015346\|Ga0182139_1239747	Not Available	507	Open in IMG/M
3300015347\|Ga0182177_1022361	Not Available	1211	Open in IMG/M
3300015347\|Ga0182177_1144453	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	620	Open in IMG/M
3300015347\|Ga0182177_1231781	Not Available	517	Open in IMG/M
3300015351\|Ga0182161_1088544	Not Available	776	Open in IMG/M
3300015351\|Ga0182161_1134563	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	661	Open in IMG/M
3300015351\|Ga0182161_1160123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	618	Open in IMG/M
3300015351\|Ga0182161_1250810	Not Available	515	Open in IMG/M
3300015355\|Ga0182159_1041544	Not Available	1203	Open in IMG/M
3300015355\|Ga0182159_1115800	Not Available	808	Open in IMG/M
3300015355\|Ga0182159_1119707	Not Available	797	Open in IMG/M
3300015355\|Ga0182159_1138556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	750	Open in IMG/M
3300015355\|Ga0182159_1157511	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	711	Open in IMG/M
3300015355\|Ga0182159_1205244	Not Available	636	Open in IMG/M
3300015355\|Ga0182159_1206549	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	634	Open in IMG/M
3300015361\|Ga0182145_1092165	Not Available	646	Open in IMG/M
3300017404\|Ga0182203_1067512	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	671	Open in IMG/M
3300017404\|Ga0182203_1099020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	594	Open in IMG/M
3300017407\|Ga0182220_1096543	Not Available	520	Open in IMG/M
3300017409\|Ga0182204_1102687	Not Available	527	Open in IMG/M
3300017409\|Ga0182204_1117168	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	505	Open in IMG/M
3300017409\|Ga0182204_1117656	Not Available	505	Open in IMG/M
3300017410\|Ga0182207_1053058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	748	Open in IMG/M
3300017410\|Ga0182207_1149107	Not Available	533	Open in IMG/M
3300017411\|Ga0182208_1051364	Not Available	669	Open in IMG/M
3300017411\|Ga0182208_1065964	Not Available	621	Open in IMG/M
3300017411\|Ga0182208_1086676	Not Available	571	Open in IMG/M
3300017411\|Ga0182208_1129472	Not Available	502	Open in IMG/M
3300017415\|Ga0182202_1037105	Not Available	761	Open in IMG/M
3300017415\|Ga0182202_1122997	Not Available	523	Open in IMG/M
3300017415\|Ga0182202_1129271	Not Available	515	Open in IMG/M
3300017415\|Ga0182202_1132358	Not Available	511	Open in IMG/M
3300017417\|Ga0182230_1067598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	637	Open in IMG/M
3300017417\|Ga0182230_1090625	Not Available	559	Open in IMG/M
3300017420\|Ga0182228_1062781	Not Available	655	Open in IMG/M
3300017424\|Ga0182219_1055006	Not Available	672	Open in IMG/M
3300017425\|Ga0182224_1080467	Not Available	634	Open in IMG/M
3300017427\|Ga0182190_1125571	Not Available	553	Open in IMG/M
3300017430\|Ga0182192_1166166	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	510	Open in IMG/M
3300017433\|Ga0182206_1084402	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	616	Open in IMG/M
3300017433\|Ga0182206_1090770	Not Available	602	Open in IMG/M
3300017433\|Ga0182206_1100399	Not Available	583	Open in IMG/M
3300017433\|Ga0182206_1123692	Not Available	546	Open in IMG/M
3300017433\|Ga0182206_1143041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	520	Open in IMG/M
3300017436\|Ga0182209_1020667	Not Available	972	Open in IMG/M
3300017436\|Ga0182209_1077324	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	653	Open in IMG/M
3300017436\|Ga0182209_1153849	Not Available	523	Open in IMG/M
3300017438\|Ga0182191_1089673	Not Available	639	Open in IMG/M
3300017438\|Ga0182191_1122484	Not Available	577	Open in IMG/M
3300017442\|Ga0182221_1130657	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	547	Open in IMG/M
3300017443\|Ga0182193_1135238	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	574	Open in IMG/M
3300017443\|Ga0182193_1188441	Not Available	510	Open in IMG/M
3300017680\|Ga0182233_1085165	Not Available	576	Open in IMG/M
3300017681\|Ga0182226_1070823	Not Available	641	Open in IMG/M
3300017683\|Ga0182218_1111810	Not Available	556	Open in IMG/M
3300017684\|Ga0182225_1093916	Not Available	575	Open in IMG/M
3300017684\|Ga0182225_1095733	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	572	Open in IMG/M
3300017684\|Ga0182225_1139663	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	508	Open in IMG/M
3300017685\|Ga0182227_1043616	Not Available	788	Open in IMG/M
3300017685\|Ga0182227_1105859	Not Available	552	Open in IMG/M
3300017685\|Ga0182227_1108415	Not Available	547	Open in IMG/M
3300017685\|Ga0182227_1109566	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	545	Open in IMG/M
3300017685\|Ga0182227_1122785	Not Available	522	Open in IMG/M
3300017686\|Ga0182205_1152505	Not Available	523	Open in IMG/M
3300017689\|Ga0182231_1104647	Not Available	548	Open in IMG/M
3300017690\|Ga0182223_1047088	Not Available	658	Open in IMG/M
3300017690\|Ga0182223_1047740	Not Available	655	Open in IMG/M
3300026089\|Ga0207648_11738078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	585	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.81%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.09%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.09%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.81%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.09%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.09%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	97.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.09%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.55%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068866_113663931	3300005718	Miscanthus Rhizosphere	VLFRKVLIDRGSALNLLFVGALKELGLGIGDLTPFDSSF*
Ga0105245_130669282	3300009098	Miscanthus Rhizosphere	VLDATIKKVLFRKVLIESGSALNLLFAGALKELGLGVEDLTPSNSSF*
Ga0157377_112204732	3300014745	Miscanthus Rhizosphere	VLFRKVLVDGGSALKLLFAGALKELGLGITDLTPSDSSF*
Ga0182122_10095742	3300015267	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALRELGLGTTDLTPSDSF*
Ga0182122_10348282	3300015267	Miscanthus Phyllosphere	MLFRKVLIDGESALNLPFVEALKELGLGIGDLAPSDSSF*
Ga0182154_10251931	3300015268	Miscanthus Phyllosphere	QKVLFRKVLIDGGSALNLLFAGALKELGLEITDLAPLDSSF*
Ga0182154_10548742	3300015268	Miscanthus Phyllosphere	ATIQKVLFRKVLIDDGSALNLLFAGALKELELEIGDLTLSDSF*
Ga0182113_10120581	3300015269	Miscanthus Phyllosphere	VLVDNRSALNLLFAGALKELGLGIGDLTPTDSSF*
Ga0182113_10370052	3300015269	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFARALRELGLAISDLTPSNSSF*
Ga0182113_10387182	3300015269	Miscanthus Phyllosphere	VLFKKVLIDGGSALNLLFAGALKELGLGIIDLTPSDSSF*
Ga0182113_10947792	3300015269	Miscanthus Phyllosphere	VLFKKVLIDGGSALNLLFARALKELGLGIGDLTPSYSSFWGVLPGV
Ga0182188_10285991	3300015274	Miscanthus Phyllosphere	DTTVQKVLFRKVLVDGGSALNLLFAGALRELGLGPIYLTPSDSSF*
Ga0182188_10477522	3300015274	Miscanthus Phyllosphere	QKVLFRKVLVDGGSALNLLFAGALRELGLMISDLTPSDSSF*
Ga0182172_10141182	3300015275	Miscanthus Phyllosphere	VLFRKVLVDDGSALNLLFAGALKELGLGITDLTPSDSSF*
Ga0182172_10182611	3300015275	Miscanthus Phyllosphere	QKVLFKKMLVDGGSDLNLLFAGALNELSLGIIDLAPSDSSF*
Ga0182172_10756491	3300015275	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLFFAGALRELGLTITDLTPLDSSFYGVVP
Ga0182170_10170071	3300015276	Miscanthus Phyllosphere	TIKKVPFRKVLIDHESVLNLLFARALKELGLGIEDITPSNSSF*
Ga0182170_10485332	3300015276	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFTEALKELGLEIIDLTPLDSSF*
Ga0182128_10459531	3300015277	Miscanthus Phyllosphere	VTIQKVLFRKVLVDGESALNLLFAGALRELGLGPTHLTPSDSSF*
Ga0182128_10704992	3300015277	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFTRALKELGLGITDLTPSDSSF*
Ga0182174_10109963	3300015279	Miscanthus Phyllosphere	MLFRKVLIDGGSALNLLFAGALKELGLGITDLTPSNSSF*
Ga0182174_10863241	3300015279	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALRELGLTIIDLAPLDSSF*
Ga0182160_10837652	3300015281	Miscanthus Phyllosphere	VLFRKVLVDGGRALNLLFAGALKELGLRITDLTPSDSSF*
Ga0182124_10537592	3300015282	Miscanthus Phyllosphere	VLFRKVLVDDGSALNLLFAEALKELGLGITDLTPSDSSF*
Ga0182124_10761662	3300015282	Miscanthus Phyllosphere	VLFRKVLVDDGSALSLLFAGALKELGLGIGDLTPSDSF*
Ga0182156_10253912	3300015283	Miscanthus Phyllosphere	VLFRKVLIDDGSALNLLFAGALKELGLGTEDLTPSDSSF*
Ga0182156_10363783	3300015283	Miscanthus Phyllosphere	VLFRKVLIDDGSALNLLFAGALKELGLSITDLTASDSSFWGKQLPR
Ga0182156_10572153	3300015283	Miscanthus Phyllosphere	LLVLDATVQKVLFKKVLVDGGSTLNLLFAGALRELGLVISDLTPSDSSF*
Ga0182156_10707131	3300015283	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLGIEDLTPSDSSF*
Ga0182156_10782892	3300015283	Miscanthus Phyllosphere	VLVDGGSAQNLLFAGALKELGLGIEDLTPSDSSF*
Ga0182156_10798673	3300015283	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAEALKELGLGIIDLMPSDSSF*
Ga0182156_10818672	3300015283	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFVGALKELGLGITYLTPYDSSF*
Ga0182186_10199702	3300015285	Miscanthus Phyllosphere	VLFRKVLIDDRSALNLLFAGALKELGLGIGDLTPSDSSF*
Ga0182186_10521532	3300015285	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFTRALKELGLGLLDLTPFDSSFW
Ga0182186_10723982	3300015285	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFIGALRELGLVISDLTPSDSFF*
Ga0182176_10180452	3300015286	Miscanthus Phyllosphere	VLFRKVLVNGGRALNLLFTGALKELGLGIIDLTPSDSSF*
Ga0182176_10322572	3300015286	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLGMTDLTPSDSFF*
Ga0182176_10323972	3300015286	Miscanthus Phyllosphere	LLFRKVLVDGGSALNLLFAGALKELGLGIEDLVPSNSSF*
Ga0182176_10442412	3300015286	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALRELGLRTTNLTPSDSSF*
Ga0182171_10111972	3300015287	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFARALKELGLGITDLTPSDSSF*
Ga0182171_10643842	3300015287	Miscanthus Phyllosphere	VLFRKVLVDGESTLNLLFAGALKELGLGMGDLTPSDSSF*
Ga0182171_10671822	3300015287	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGSLKELGLGITDLTPLDSSF*
Ga0182173_10238751	3300015288	Miscanthus Phyllosphere	VFPLVLGATVKKVLFRKVLVDGRSALNLLFAGALKELGLGIEDLTPSDSSFWGALPGR
Ga0182138_10377522	3300015289	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGALKELGLGITDLTPSDSSLERSPY*
Ga0182138_10665181	3300015289	Miscanthus Phyllosphere	VLIDGGSTLNLLFAEALNELGLGTGDLTPFDSSF*
Ga0182125_10144492	3300015291	Miscanthus Phyllosphere	VFFRKVLVDGGSALNLLFTGALKELGLGLSDHTPSDSSF
Ga0182125_10665172	3300015291	Miscanthus Phyllosphere	LDATIQKVLFRKVLVHGGSALNLLFVGALKKLGLGITGPTPSDSPF*
Ga0182125_10917541	3300015291	Miscanthus Phyllosphere	FKKVLIDGGSALNLLFTKALTELGLTKDDLVPIDSPF*
Ga0182141_10254263	3300015292	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLGITDLTPSDSSF*
Ga0182126_10404012	3300015294	Miscanthus Phyllosphere	QKVLFRKVLIDGGSALNLLFAGALRELSLGPTYLTPLDSSF*
Ga0182175_10200072	3300015295	Miscanthus Phyllosphere	VLFRKVLVDGGSTLILLFAGALKELGLGITDLTPSDSSF*
Ga0182175_10366233	3300015295	Miscanthus Phyllosphere	KVPFRKVLIDSGSALNLLFAGALKELGLGLADLTPSDSSF*
Ga0182175_10404312	3300015295	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAEALRELGLAISDLTPSDSSF*
Ga0182157_10868241	3300015296	Miscanthus Phyllosphere	PLVLNATIQKVLFKKVLIDGGSALNLLFIGALKELGLGVEDLTPSDSF*
Ga0182157_10961372	3300015296	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGALKELGLGITDLTPSDSSF*
Ga0182106_10411802	3300015298	Miscanthus Phyllosphere	FRKVLVEGGSALNLLFAGALKELGLRLADLTPSDSSF*
Ga0182106_10481011	3300015298	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLGIEDLTPSDSF*
Ga0182106_10722111	3300015298	Miscanthus Phyllosphere	KKVLFRKVLADGGSALDLLFIRALKELGLRIEDLTPSNSSF*
Ga0182106_10941652	3300015298	Miscanthus Phyllosphere	VLFRKVLIDDGSALNLLFVGALKELGLGIGEITLLV*
Ga0182106_11021582	3300015298	Miscanthus Phyllosphere	VLFWKVLVDDRSALNLLFAGALKELGLAIKDLTPSD
Ga0182107_10406981	3300015299	Miscanthus Phyllosphere	VLFRKVLVDGGRALNLLFTGALKELGLGMGDLTPFDSSF*
Ga0182107_10639802	3300015299	Miscanthus Phyllosphere	VLFRKVLVDGRSALNLLFAGALKELGLGIGDLTPFDSSF*
Ga0182107_10979042	3300015299	Miscanthus Phyllosphere	VLFRKVLINGGSALNLLFTGALKELGLGIGDLTPSDSSF*
Ga0182107_11050632	3300015299	Miscanthus Phyllosphere	VLFRKVLVDGGSTLNLLFVGALKELGLGLVDLTPSDSSFW
Ga0182108_10820642	3300015300	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFTGALKELGLGTGDLTPSDSSF*
Ga0182143_10031643	3300015302	Miscanthus Phyllosphere	LDATVQKVLFRKVLVDGGSALNLLFARALKELGLGMIDLTPSDSSF*
Ga0182143_10879782	3300015302	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFVEALKELGLGIGYLAPFDSSF*
Ga0182143_11011822	3300015302	Miscanthus Phyllosphere	VHSPLILDATVKKVLFRKVLVDGRSALNLLFAGALKELGLGVEDLTPSDSSF*
Ga0182123_10290113	3300015303	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFARALKELGLRIGDLTLSDSF*
Ga0182123_10530123	3300015303	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAEALKELGLGIGDLTPSDSSF*
Ga0182112_10620761	3300015304	Miscanthus Phyllosphere	QKVLFRKVLVDGGSALNLLFAGALKELGLGITNLTPSDSSF*
Ga0182112_10636251	3300015304	Miscanthus Phyllosphere	FRKVLVDGGSALNLLFIRALKELGLRIEDLTPSNSSF*
Ga0182158_10558261	3300015305	Miscanthus Phyllosphere	VNIPYTGHFPLILNATIKKVFFRKVLVDSESALNLLFARALKELGLGIEDLTPSDSSF*
Ga0182158_10627711	3300015305	Miscanthus Phyllosphere	FRKVLTDGGSALNLLFAGALKELGLGIEDLSPSDSSF*
Ga0182158_11029452	3300015305	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFARALKELGLGIGDLTPFDSSF*
Ga0182144_10354842	3300015307	Miscanthus Phyllosphere	VLFRKVLIDGGSAQNLLFAEALKELGLGIEDLTPSDSSF*
Ga0182142_10174553	3300015308	Miscanthus Phyllosphere	HFPLVLDATVQKVLFRKVLVDGGSTLNLLFAGALWELGLGTTDLTPSDSSF*
Ga0182142_10654391	3300015308	Miscanthus Phyllosphere	VLFRKVLINSGSALNLLFAGALKELGLEIIDLTPSDSS
Ga0182142_11114552	3300015308	Miscanthus Phyllosphere	DATIQKVIFRKVLVDGGSALNLLFARALKELSLGIGDFTP*
Ga0182140_10252292	3300015314	Miscanthus Phyllosphere	VLFRKVLIDGRSALNLLFTGALKELGLGIGDLTPSDSSF*
Ga0182140_10397222	3300015314	Miscanthus Phyllosphere	VLFRKVLVDSGSALNLLFTRDIKELGLGIGDLTPSDSSF*
Ga0182140_10476081	3300015314	Miscanthus Phyllosphere	VLFRKVLVNGRSALNLLFIGALKEPGLGIGDLTPSDSSF*
Ga0182127_10287242	3300015321	Miscanthus Phyllosphere	VLFRKLLVDGRSALNLLFVGALKELGLRIGDLTPSDSSF*
Ga0182110_10520361	3300015322	Miscanthus Phyllosphere	RKVLVDGGSTLNLLFAGALKELGPRIGDLTPSDSSF*
Ga0182110_10562812	3300015322	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFTGALKELGLRIGDLTPSNSSF*
Ga0182110_10749081	3300015322	Miscanthus Phyllosphere	VLFRKVFIDGGSTLNLLFVGALKELGLGRTDLTPSDSSF*
Ga0182110_11205712	3300015322	Miscanthus Phyllosphere	LLVLDSTIKKVLFRKVLVDDGSVLNLLFTGALKELGLGTGDLTPSDSSF*
Ga0182129_10677601	3300015323	Miscanthus Phyllosphere	MGCFPVVLDATVKKVLVDGGSALNLLFAEALMELGLGIEDLTPSNSSF*
Ga0182129_10794892	3300015323	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLRLSDLTPSNSS
Ga0182129_11032431	3300015323	Miscanthus Phyllosphere	KVLVDGGSALNLLFAGDLKELGLGITDLTPSDSSF*
Ga0182129_11109793	3300015323	Miscanthus Phyllosphere	FRKVLVDGGSALNILFIGALRELGLRTIDLTPSDSSF*
Ga0182187_10264592	3300015341	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFVGALKELGLRIADLTPSDSSF*
Ga0182187_10818493	3300015341	Miscanthus Phyllosphere	PLVLDATIQKVFFRKVLVDGGSVLNLLFAGALKELGLGIIDLTPLDSSF*
Ga0182187_10887541	3300015341	Miscanthus Phyllosphere	MQPSGKCFFRKVLIDGGSALNLLFAGALKELGLGIGDLTPS
Ga0182187_11077211	3300015341	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGALKELGLGITDLTPSDSSFWGV
Ga0182109_11236572	3300015342	Miscanthus Phyllosphere	KVLVDGGSALNLLFLGALKELGLGVEDLTPSDSSF*
Ga0182109_11587493	3300015342	Miscanthus Phyllosphere	VLFRKVLIDGGSTLNLLSARALKELVLGITDLTPSDSSFWGVIPSK
Ga0182109_11907721	3300015342	Miscanthus Phyllosphere	VLFRKVLVDGESALNLLFAGALKELGLVIGDLAPSDSF*
Ga0182109_11912651	3300015342	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGALKELGLGIGYLTPSDSSFWGVV
Ga0182109_12008372	3300015342	Miscanthus Phyllosphere	VLFRKVLVDSGSALNLLFARALKELGLGIGDLTPFDSSF*
Ga0182109_12228182	3300015342	Miscanthus Phyllosphere	VLFRKVLVDGGSALTHLFARALKELGLGIGDLTPSDSSF*
Ga0182155_10614011	3300015343	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFTGALKELGLGITDLTPSDSSFWGVVPGR
Ga0182155_11048861	3300015343	Miscanthus Phyllosphere	VLVDGKSALNFLFVGALKELGLGIGDLTPCDSFWGVVPGR
Ga0182189_10616711	3300015344	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFTGALKELGLGLADLTPSDDSFWGVVP
Ga0182189_10848581	3300015344	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFTGALKELGLRIEELTPSDSSF*
Ga0182111_10946452	3300015345	Miscanthus Phyllosphere	VLFKKVLVDGGSALNLLFVGALKDLGLEIADLTPSDSSF*
Ga0182111_11182902	3300015345	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGTLKELGLGIGDLTPFDSSF*
Ga0182111_11728841	3300015345	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFTGALRELGLAITDLTPLDSSF*
Ga0182111_12387962	3300015345	Miscanthus Phyllosphere	VLFKKVLIDGGSALNLLFAEALKELDLRITDLTPIDSSF*
Ga0182139_10654712	3300015346	Miscanthus Phyllosphere	VLFRKVVVDGRRALNLLFAEALKELGLGIGDLAPSDSSL*
Ga0182139_11332432	3300015346	Miscanthus Phyllosphere	VLFRKVLAEGGSALNLLFVGALKELGLGITDLTPSDSF*
Ga0182139_11535592	3300015346	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFIGALKELGLEITYLTPLDSSF*
Ga0182139_12113332	3300015346	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAEALRELGLGPTDLTPSNSSF*
Ga0182139_12397472	3300015346	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFTGALKELGLGKGDLTTSDSSF*
Ga0182177_10223613	3300015347	Miscanthus Phyllosphere	VLFRKVLVDGESALNLLFARALKELGLGIGDLTPSDSSF*
Ga0182177_11444532	3300015347	Miscanthus Phyllosphere	VLFRKVLVDGGSSLNLLFAGALKELGLGIGDLTPSDSSF*
Ga0182177_12317811	3300015347	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGALKELGLAIGDLTPSDSSF*
Ga0182161_10885442	3300015351	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFVGALKKLGLGITGPTPSDSPF*
Ga0182161_11345632	3300015351	Miscanthus Phyllosphere	VLDATIKKVLVDGGSALNVLFTEALKELGLIVEDLTPSESSF*
Ga0182161_11601231	3300015351	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAEALKELGLEIIDLTPSDSSF*
Ga0182161_12508102	3300015351	Miscanthus Phyllosphere	VLFRKVLVVGGSALNILFTAALKELGLGMTDLTPSN
Ga0182159_10415443	3300015355	Miscanthus Phyllosphere	VLFRKVLVDNRSALNLLFVGALKELGLGIGDLAPFDSSF*
Ga0182159_11158002	3300015355	Miscanthus Phyllosphere	KKVLFRKVLIDDGSALNLLFIGALKELGLGIEDLTPSDSF*
Ga0182159_11197073	3300015355	Miscanthus Phyllosphere	VLFRKVLVDGGNALNLLFTRALKELGLGITDLTPSDSSFWGVVPGRAS
Ga0182159_11385561	3300015355	Miscanthus Phyllosphere	KVLFRKVLIDGGSALNLLFAGALKELGLGIGDLTPFNSSF*
Ga0182159_11575111	3300015355	Miscanthus Phyllosphere	LPLVLDATIQKVLFRKVLVDGGSALNLLFAGALKELGLGIGDLTPSDFSF*
Ga0182159_12052441	3300015355	Miscanthus Phyllosphere	VLFRKVLVVGGSALNLLFAGALKELGLGLSYLTPSDSSF
Ga0182159_12065492	3300015355	Miscanthus Phyllosphere	VLDATVKKVFFRKVLIDGRSALNLLFIGAHKELGLEIEDLTPSNSSF*
Ga0182145_10921653	3300015361	Miscanthus Phyllosphere	RFPLVLDATIQKVLFRKVLVDGGSTLNLLFAGALKELGFGIIDLTPSDSSF*
Ga0182203_10675121	3300017404	Miscanthus Phyllosphere	IQKVLFRKVLVHGGSTLNLLFARALKELGLGIIDLTPSYSSF
Ga0182203_10990202	3300017404	Miscanthus Phyllosphere	LFRKVLVDGGSALNLLFAKALKELGLRIGDLSPADFSF
Ga0182220_10965432	3300017407	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFGGALKELSLGITDLTSSDSSF
Ga0182204_11026871	3300017409	Miscanthus Phyllosphere	VLFRKVLIDGRSALNLLFAGALKELGLGIEDLTPSDSSF
Ga0182204_11171682	3300017409	Miscanthus Phyllosphere	FPLILDATIQKVLFKKVLVDGGSALNLLFVGALKELGLGTTDLTPSDSF
Ga0182204_11176561	3300017409	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFARALRELGLRIIDLTPSESSF
Ga0182207_10530582	3300017410	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFARALRELGLGITDLTPSESSF
Ga0182207_11491072	3300017410	Miscanthus Phyllosphere	VLFRKVLVDGGSTLNLLFAEALKELGLEITDLTPSDSSF
Ga0182208_10513642	3300017411	Miscanthus Phyllosphere	VLFRKVLVNSGSALNLLFAGALKELGLRITDLTPSDSSF
Ga0182208_10659642	3300017411	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFTGALKELGLGIIDLTPLDASF
Ga0182208_10866761	3300017411	Miscanthus Phyllosphere	VLFRKVLVNGGSALNLLFTKALKELGLGIGDLTPSDSSF
Ga0182208_11294721	3300017411	Miscanthus Phyllosphere	VLFRKLLVDGGSALNLLFARALKELGLRIGDLTPSYSSF
Ga0182202_10371051	3300017415	Miscanthus Phyllosphere	VFFRKVLVDGGSVLNLLFAGALKELGLGIIDLTPLDSSF
Ga0182202_11229972	3300017415	Miscanthus Phyllosphere	VLFKKVLVDGGSALNLLFTGALKELGLGIGDLKPFDSF
Ga0182202_11292712	3300017415	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLEITDLTPSDSSF
Ga0182202_11323582	3300017415	Miscanthus Phyllosphere	ATVKKVLFMKVLVNGESALNLLFAGALKELGLRIADLTPSDSSF
Ga0182230_10675982	3300017417	Miscanthus Phyllosphere	VLFKKVLIDGGSALNLLFAGALKELGLRITDLTPSDSSF
Ga0182230_10906251	3300017417	Miscanthus Phyllosphere	VFFRKVLVNGGSALNLLFTRALKELGLGIGDLTPSDSSF
Ga0182228_10627812	3300017420	Miscanthus Phyllosphere	VLFRNVLIDGGSALNLLFAGTLKELGLGITDLTPSDSSF
Ga0182219_10550062	3300017424	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLGITYLTPSDSSF
Ga0182224_10804671	3300017425	Miscanthus Phyllosphere	RKVLVDGGSALNLLFVGALKELGLGITDLTPSDFSF
Ga0182190_11255712	3300017427	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFVGALKELGLGITDLTPFDSSF
Ga0182192_11661662	3300017430	Miscanthus Phyllosphere	FRKVLIDGGSALNLLFAGALRELGLRTTDLMPTDSSF
Ga0182206_10844021	3300017433	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGALKVLGLGIIELIPFDSSF
Ga0182206_10907702	3300017433	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFVGALKELGLRIGDLTPSDSSF
Ga0182206_11003992	3300017433	Miscanthus Phyllosphere	VVFKKVLVDGGSALNLLFAGALKELGLWIIDLTPSDSSF
Ga0182206_11236921	3300017433	Miscanthus Phyllosphere	VLFRKVLDDGGSALNLLFVGALKELGLGIGDLAPSNSSF
Ga0182206_11430412	3300017433	Miscanthus Phyllosphere	FRKVLIDGRNSMNLLFAGGLKELGLGVEDLTPSNSSF
Ga0182209_10206673	3300017436	Miscanthus Phyllosphere	VLFKKVLVDGESALNLLFAGALKELGLGITDLTPS
Ga0182209_10773242	3300017436	Miscanthus Phyllosphere	LFRKVLVDGGSALNLLFADALKELGLGLSDLTPSDSSF
Ga0182209_11538491	3300017436	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLGMGDLTPSDSSL
Ga0182191_10896732	3300017438	Miscanthus Phyllosphere	VLFRKVLIDGGSALNFLFARSLKELGLGIVDLTPLDSSF
Ga0182191_11224841	3300017438	Miscanthus Phyllosphere	VLDATVKKVLFRKVLVDGGSALNLLFIRALKELGLRIEDLTPSNSSF
Ga0182221_11306571	3300017442	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGALKELGLGTKDLTPSDSSF
Ga0182193_11352381	3300017443	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKEFGFGMTDLTPSDSSF
Ga0182193_11884412	3300017443	Miscanthus Phyllosphere	VLFRKVLVYGGSSLNLLFAEALKELGLGLGDLTPFDSSF
Ga0182233_10851651	3300017680	Miscanthus Phyllosphere	TVQKVLFRKILVDGGSALNLLFAGALKELSLGTTDLTPSDSSF
Ga0182226_10708232	3300017681	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFARALKELGLRITDLTPSDSSF
Ga0182218_11118102	3300017683	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLRMTDLTPSDSSF
Ga0182225_10939162	3300017684	Miscanthus Phyllosphere	MWVQKVLFRKVLVDGGSALNLLFARALKELGLGITDLSPSDSSF
Ga0182225_10957332	3300017684	Miscanthus Phyllosphere	FRKVLVDGGSALNLLFAGALRELGLAISDLTPSDSSF
Ga0182225_11271781	3300017684	Miscanthus Phyllosphere	VGIPYTGCFPLVLNATVKKVLFKKVLVDGRSALNILFAGALKELGLGIEDLTPSDSSF
Ga0182225_11396632	3300017684	Miscanthus Phyllosphere	VLFRKLLVDGRSALNLLFVGALKELGLRIGDLTPSDSSF
Ga0182227_10436162	3300017685	Miscanthus Phyllosphere	MLFRKVLVDGGSALNLLFTGALKELGLGIGDLAPFDSSF
Ga0182227_11058591	3300017685	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGALKELGLRIADLTPSDSSF
Ga0182227_11084151	3300017685	Miscanthus Phyllosphere	VLFRKVLVDGGSALNLLFAGALKELGLRITDLTPSDSSF
Ga0182227_11095662	3300017685	Miscanthus Phyllosphere	VLFRKVFVDGGSALNLLFAEALRELGLRTTDLTPSDSSF
Ga0182227_11227853	3300017685	Miscanthus Phyllosphere	VLVDGGSALNLLFVGAIKELGLGLSDLTLFDSSFCGV
Ga0182205_11525051	3300017686	Miscanthus Phyllosphere	VLFRKVLIDGGSALNLLFAGALKELGLRITDLTPSDSSF
Ga0182205_11650912	3300017686	Miscanthus Phyllosphere	PYTGRFPLVLDATVKKVLFRKVLVDGGSVLKLHFAGALKELGLGITDLTPSDSF
Ga0182231_11046472	3300017689	Miscanthus Phyllosphere	VLFRKVLVDSGSALNLLFAEALKELGLGITDLTPSDSSF
Ga0182223_10470881	3300017690	Miscanthus Phyllosphere	VLFRKVFIDGGSALNLLFTGALKELGLGIGDLTPSDSSF
Ga0182223_10477402	3300017690	Miscanthus Phyllosphere	VFFRKVLVDGGSTLNLLFAGALKELGPRIGDLTPSDSSF
Ga0207648_117380782	3300026089	Miscanthus Rhizosphere	ATVQKVFFRKVLIDGGSALNLLFAGALKELGLGIGDLTPSDSSF

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F030964

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign