NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F030865

Metagenome / Metatranscriptome Family F030865

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F030865
Family Type Metagenome / Metatranscriptome
Number of Sequences 184
Average Sequence Length 72 residues
Representative Sequence MDAEGVACHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERAHKLAPLSNERLQRSGAAA
Number of Associated Samples 150
Number of Associated Scaffolds 184

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 10.44 %
% of genes near scaffold ends (potentially truncated) 86.96 %
% of genes from short scaffolds (< 2000 bps) 79.35 %
Associated GOLD sequencing projects 138
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.478 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(14.674 % of family members)
Environment Ontology (ENVO) Unclassified
(44.022 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.652 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.39%    β-sheet: 13.73%    Coil/Unstructured: 55.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 184 Family Scaffolds
PF11737DUF3300 9.78
PF00582Usp 4.89
PF03544TonB_C 4.35
PF00072Response_reg 3.26
PF00690Cation_ATPase_N 3.26
PF11154DUF2934 2.17
PF16576HlyD_D23 1.63
PF13545HTH_Crp_2 1.63
PF01471PG_binding_1 1.63
PF08282Hydrolase_3 1.09
PF00702Hydrolase 1.09
PF01810LysE 1.09
PF11453DUF2950 1.09
PF04203Sortase 1.09
PF02954HTH_8 1.09
PF12773DZR 0.54
PF04909Amidohydro_2 0.54
PF01238PMI_typeI_C 0.54
PF01872RibD_C 0.54
PF02518HATPase_c 0.54
PF00069Pkinase 0.54
PF13502AsmA_2 0.54
PF02738MoCoBD_1 0.54
PF12840HTH_20 0.54
PF00905Transpeptidase 0.54
PF08240ADH_N 0.54
PF07690MFS_1 0.54
PF13442Cytochrome_CBB3 0.54
PF13437HlyD_3 0.54
PF01527HTH_Tnp_1 0.54
PF11999Ice_binding 0.54
PF01695IstB_IS21 0.54
PF08279HTH_11 0.54
PF00982Glyco_transf_20 0.54
PF07238PilZ 0.54
PF15780ASH 0.54
PF00027cNMP_binding 0.54
PF13646HEAT_2 0.54
PF00578AhpC-TSA 0.54
PF05598DUF772 0.54
PF03264Cytochrom_NNT 0.54
PF13482RNase_H_2 0.54
PF04055Radical_SAM 0.54
PF05239PRC 0.54
PF05193Peptidase_M16_C 0.54
PF02604PhdYeFM_antitox 0.54
PF03976PPK2 0.54

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 184 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 4.35
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 3.26
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.17
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 1.09
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 1.09
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 1.09
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 1.09
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 1.09
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 1.09
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.54
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.54
COG3005Tetraheme cytochrome c subunit NapC of nitrate or TMAO reductaseEnergy production and conversion [C] 0.54
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.54
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.54
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.54
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.54
COG1482Mannose-6-phosphate isomerase, class ICarbohydrate transport and metabolism [G] 0.54
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 0.54


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.48 %
UnclassifiedrootN/A6.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10043716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2474Open in IMG/M
3300000567|JGI12270J11330_10085443All Organisms → cellular organisms → Bacteria1461Open in IMG/M
3300001471|JGI12712J15308_10000067All Organisms → cellular organisms → Bacteria → Acidobacteria26631Open in IMG/M
3300001471|JGI12712J15308_10002885All Organisms → cellular organisms → Bacteria5062Open in IMG/M
3300002245|JGIcombinedJ26739_100029845All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4813Open in IMG/M
3300002245|JGIcombinedJ26739_100359605All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300002245|JGIcombinedJ26739_100993543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis724Open in IMG/M
3300002245|JGIcombinedJ26739_101207205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis646Open in IMG/M
3300004100|Ga0058904_1281454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7936Open in IMG/M
3300004104|Ga0058891_1023994All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter881Open in IMG/M
3300004139|Ga0058897_10042499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7551Open in IMG/M
3300004593|Ga0068946_1222519All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300004631|Ga0058899_10114218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1491Open in IMG/M
3300005541|Ga0070733_10956396All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hylemonella → Hylemonella gracilis575Open in IMG/M
3300005542|Ga0070732_10484770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7748Open in IMG/M
3300005542|Ga0070732_10498328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter737Open in IMG/M
3300005614|Ga0068856_100457032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1298Open in IMG/M
3300005921|Ga0070766_10198004All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300005944|Ga0066788_10100595All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300006052|Ga0075029_100024100All Organisms → cellular organisms → Bacteria3424Open in IMG/M
3300006052|Ga0075029_100173221All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1337Open in IMG/M
3300006059|Ga0075017_101568233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7519Open in IMG/M
3300006086|Ga0075019_10064840All Organisms → cellular organisms → Bacteria2070Open in IMG/M
3300006102|Ga0075015_100973474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300006172|Ga0075018_10112657All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300006176|Ga0070765_100426302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1241Open in IMG/M
3300006893|Ga0073928_10736500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7685Open in IMG/M
3300009518|Ga0116128_1000287All Organisms → cellular organisms → Bacteria30455Open in IMG/M
3300009518|Ga0116128_1009570All Organisms → cellular organisms → Bacteria → Acidobacteria3498Open in IMG/M
3300009519|Ga0116108_1089606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7938Open in IMG/M
3300009547|Ga0116136_1099342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7758Open in IMG/M
3300009549|Ga0116137_1012338All Organisms → cellular organisms → Bacteria → Acidobacteria3455Open in IMG/M
3300009549|Ga0116137_1048506All Organisms → cellular organisms → Bacteria → Acidobacteria1389Open in IMG/M
3300009616|Ga0116111_1063896All Organisms → cellular organisms → Bacteria → Acidobacteria1014Open in IMG/M
3300009617|Ga0116123_1027499All Organisms → cellular organisms → Bacteria → Acidobacteria1751Open in IMG/M
3300009617|Ga0116123_1086418Not Available847Open in IMG/M
3300009636|Ga0116112_1109293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7777Open in IMG/M
3300009640|Ga0116126_1284831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7511Open in IMG/M
3300009665|Ga0116135_1004272Not Available5866Open in IMG/M
3300009672|Ga0116215_1456506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7553Open in IMG/M
3300009760|Ga0116131_1106547All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7835Open in IMG/M
3300009764|Ga0116134_1146190All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300009839|Ga0116223_10458205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7745Open in IMG/M
3300010379|Ga0136449_100925466All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1416Open in IMG/M
3300011076|Ga0138574_1106601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7548Open in IMG/M
3300011108|Ga0138601_127725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M
3300011120|Ga0150983_11342123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300011120|Ga0150983_11519979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7523Open in IMG/M
3300011120|Ga0150983_12881839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7692Open in IMG/M
3300011120|Ga0150983_14218033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7648Open in IMG/M
3300012019|Ga0120139_1012653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1936Open in IMG/M
3300012201|Ga0137365_10584503All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7819Open in IMG/M
3300012683|Ga0137398_10912232All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7612Open in IMG/M
3300014153|Ga0181527_1113779Not Available1245Open in IMG/M
3300014155|Ga0181524_10178152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71065Open in IMG/M
3300014158|Ga0181521_10472055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7605Open in IMG/M
3300014169|Ga0181531_11042605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7514Open in IMG/M
3300014199|Ga0181535_10579358All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300014200|Ga0181526_10370988All Organisms → cellular organisms → Bacteria → Acidobacteria909Open in IMG/M
3300014490|Ga0182010_10650443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7591Open in IMG/M
3300014491|Ga0182014_10140226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71380Open in IMG/M
3300014492|Ga0182013_10613615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7553Open in IMG/M
3300014838|Ga0182030_10627664All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300014838|Ga0182030_11297001All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7614Open in IMG/M
3300014839|Ga0182027_12159606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7529Open in IMG/M
3300017929|Ga0187849_1014915All Organisms → cellular organisms → Bacteria4747Open in IMG/M
3300017929|Ga0187849_1033111All Organisms → cellular organisms → Bacteria → Acidobacteria2620Open in IMG/M
3300017931|Ga0187877_1144334All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium960Open in IMG/M
3300017935|Ga0187848_10037853Not Available2389Open in IMG/M
3300017940|Ga0187853_10058822Not Available1954Open in IMG/M
3300017940|Ga0187853_10134653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1193Open in IMG/M
3300017995|Ga0187816_10474664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7561Open in IMG/M
3300017998|Ga0187870_1201331All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7700Open in IMG/M
3300018002|Ga0187868_1010564All Organisms → cellular organisms → Bacteria4841Open in IMG/M
3300018002|Ga0187868_1047966All Organisms → cellular organisms → Bacteria → Acidobacteria1842Open in IMG/M
3300018004|Ga0187865_1275815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7558Open in IMG/M
3300018005|Ga0187878_1099946Not Available1187Open in IMG/M
3300018009|Ga0187884_10042592All Organisms → cellular organisms → Bacteria2168Open in IMG/M
3300018014|Ga0187860_1266721All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7674Open in IMG/M
3300018016|Ga0187880_1112656All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1324Open in IMG/M
3300018020|Ga0187861_10434576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7547Open in IMG/M
3300018023|Ga0187889_10089708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71538Open in IMG/M
3300018024|Ga0187881_10047483All Organisms → cellular organisms → Bacteria2107Open in IMG/M
3300018030|Ga0187869_10463637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7602Open in IMG/M
3300018030|Ga0187869_10575338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7534Open in IMG/M
3300018035|Ga0187875_10478000All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7662Open in IMG/M
3300018040|Ga0187862_10169106Not Available1459Open in IMG/M
3300018042|Ga0187871_10532087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7651Open in IMG/M
3300018043|Ga0187887_10290413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7966Open in IMG/M
3300018047|Ga0187859_10061902All Organisms → cellular organisms → Bacteria → Acidobacteria1973Open in IMG/M
3300018047|Ga0187859_10608694All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7616Open in IMG/M
3300018057|Ga0187858_10092270All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300018057|Ga0187858_10927208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7512Open in IMG/M
3300019786|Ga0182025_1005604All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300019786|Ga0182025_1350800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1966Open in IMG/M
3300019787|Ga0182031_1173579All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71448Open in IMG/M
3300020021|Ga0193726_1039593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72294Open in IMG/M
3300020579|Ga0210407_11275605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7550Open in IMG/M
3300020581|Ga0210399_10095425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum2428Open in IMG/M
3300020581|Ga0210399_11211141All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300021170|Ga0210400_10028204All Organisms → cellular organisms → Bacteria → Acidobacteria4358Open in IMG/M
3300021401|Ga0210393_11283896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium587Open in IMG/M
3300021405|Ga0210387_11199604All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300021407|Ga0210383_11432043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300021407|Ga0210383_11608153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7534Open in IMG/M
3300021559|Ga0210409_10787954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium823Open in IMG/M
3300022522|Ga0242659_1079401All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7622Open in IMG/M
3300022557|Ga0212123_10071171All Organisms → cellular organisms → Bacteria2998Open in IMG/M
3300022724|Ga0242665_10288296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7571Open in IMG/M
3300023075|Ga0224520_1055609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium906Open in IMG/M
3300023090|Ga0224558_1065537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1396Open in IMG/M
3300023090|Ga0224558_1077735All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium1228Open in IMG/M
3300023552|Ga0247551_101511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7796Open in IMG/M
3300024227|Ga0228598_1010156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1876Open in IMG/M
3300025439|Ga0208323_1069244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300025442|Ga0208034_1006503All Organisms → cellular organisms → Bacteria4565Open in IMG/M
3300025442|Ga0208034_1070043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7660Open in IMG/M
3300025448|Ga0208037_1076570Not Available594Open in IMG/M
3300025459|Ga0208689_1050468All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium861Open in IMG/M
3300025460|Ga0208562_1000608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae17553Open in IMG/M
3300025460|Ga0208562_1012893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2090Open in IMG/M
3300025496|Ga0208191_1020347All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium1619Open in IMG/M
3300025498|Ga0208819_1000575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae25276Open in IMG/M
3300025501|Ga0208563_1058186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7809Open in IMG/M
3300025506|Ga0208937_1085173All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7710Open in IMG/M
3300025612|Ga0208691_1020301Not Available1579Open in IMG/M
3300027073|Ga0208366_1027054All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola637Open in IMG/M
3300027110|Ga0208488_1077758All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7541Open in IMG/M
3300027521|Ga0209524_1037978All Organisms → cellular organisms → Bacteria → Acidobacteria1011Open in IMG/M
3300027559|Ga0209222_1041302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium888Open in IMG/M
3300027604|Ga0208324_1155037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300027629|Ga0209422_1152003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7519Open in IMG/M
3300027745|Ga0209908_10046232All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium947Open in IMG/M
3300027842|Ga0209580_10232219All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300027842|Ga0209580_10333502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7755Open in IMG/M
3300027889|Ga0209380_10018783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3914Open in IMG/M
3300027898|Ga0209067_10022127All Organisms → cellular organisms → Bacteria3263Open in IMG/M
3300028746|Ga0302233_10323036All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7584Open in IMG/M
3300028766|Ga0302269_1095170All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300028785|Ga0302201_10128633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1109Open in IMG/M
3300028798|Ga0302222_10136682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium968Open in IMG/M
3300029889|Ga0246001_1001240All Organisms → cellular organisms → Bacteria13641Open in IMG/M
3300029889|Ga0246001_1006200All Organisms → cellular organisms → Bacteria → Acidobacteria4745Open in IMG/M
3300029889|Ga0246001_1095057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7518Open in IMG/M
3300029907|Ga0311329_10168370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1714Open in IMG/M
3300029914|Ga0311359_10381369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1122Open in IMG/M
3300029922|Ga0311363_11651188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7502Open in IMG/M
3300029939|Ga0311328_10406791All Organisms → cellular organisms → Bacteria → Acidobacteria977Open in IMG/M
3300029943|Ga0311340_11055823All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46663Open in IMG/M
3300029951|Ga0311371_10244654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales2598Open in IMG/M
3300029955|Ga0311342_10181250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella pectinivorans2066Open in IMG/M
3300029990|Ga0311336_12016768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7512Open in IMG/M
3300029993|Ga0302304_10352643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7535Open in IMG/M
3300030011|Ga0302270_10419931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae710Open in IMG/M
3300030044|Ga0302281_10155010All Organisms → cellular organisms → Bacteria → Acidobacteria998Open in IMG/M
3300030114|Ga0311333_11049235Not Available692Open in IMG/M
3300030399|Ga0311353_10021283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7139Open in IMG/M
3300030503|Ga0311370_10749405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1136Open in IMG/M
3300030524|Ga0311357_11437086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7586Open in IMG/M
3300030524|Ga0311357_11762420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7516Open in IMG/M
3300030659|Ga0316363_10426049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7513Open in IMG/M
3300030688|Ga0311345_10272188All Organisms → cellular organisms → Bacteria → Proteobacteria1630Open in IMG/M
3300030815|Ga0265746_1051409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300030941|Ga0265737_103656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300031234|Ga0302325_10592929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L461635Open in IMG/M
3300031236|Ga0302324_101848369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7765Open in IMG/M
3300031259|Ga0302187_10412129All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300031708|Ga0310686_109341573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7859Open in IMG/M
3300031708|Ga0310686_112420244All Organisms → cellular organisms → Bacteria3914Open in IMG/M
3300031715|Ga0307476_10825338All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300031753|Ga0307477_10181252All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300031753|Ga0307477_10496055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7830Open in IMG/M
3300031962|Ga0307479_10367152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1423Open in IMG/M
3300031962|Ga0307479_10447365All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300032160|Ga0311301_10327485All Organisms → cellular organisms → Bacteria2422Open in IMG/M
3300032756|Ga0315742_10279317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1189Open in IMG/M
3300033402|Ga0326728_10132599All Organisms → cellular organisms → Bacteria2795Open in IMG/M
3300033402|Ga0326728_10150443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum2526Open in IMG/M
3300033547|Ga0316212_1072387All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300033755|Ga0371489_0227142All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium947Open in IMG/M
3300033798|Ga0334821_074338All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium674Open in IMG/M
3300033888|Ga0334792_045184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1394Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland14.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland14.13%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil10.33%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.98%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.98%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.80%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.26%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.26%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.72%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.72%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.63%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat1.63%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.63%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.09%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.09%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.09%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.09%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.54%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.54%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.54%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.54%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.54%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.54%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.54%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004100Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004593Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011076Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011108Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023552Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030941Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033547Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1Host-AssociatedOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033798Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-SEnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1004371643300000567Peatlands SoilVAAVLLEYKLEGMDAEAVACHIKQRFPKLPIILVSAHSEMPERILWLVDEYVMKSEMPERLVPIIERATHPYGLALISNEQRQRRGAAA*
JGI12270J11330_1008544333300000567Peatlands SoilHIKQRFPNLPIILLSAYAEMPERILWLVDEYVMKSEQPERIVPIIERAHKRAPRSNERCRRSQAAA*
JGI12712J15308_10000067173300001471Forest SoilLDAEAVTCHVKRRFPPNLPIILLSVYSKIPERILWWEDEYVMKSQLPERLVPVIQRACRLGLHSDKGLQPKEATA*
JGI12712J15308_1000288513300001471Forest SoilHEGMDAEAVACHIKQRFPNLPIILLSAYSDMPERILWLVDEYVMKSELSERLLPIIQQAAERSTRSGRIKPHSSERCEPSSAVA*
JGIcombinedJ26739_10002984553300002245Forest SoilLEYRHEGMDAEAVACHIKQRFPNLPIILLSAYSDMPERILWLVDEYVMKSELSERLLPIIQQAAERSTRSGRIKPHSSERCEPSSAVA*
JGIcombinedJ26739_10035960513300002245Forest SoilVASHIKQRFPNLPIILLSAYSEMPERILWLVDDYVMKSELPERLVPIIERAHKRASCATERPQRRGVAA*
JGIcombinedJ26739_10099354313300002245Forest SoilQEGMDAEAVACHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELSERLLPSIERATRRRHRLAPRSSERYERGGAAA*
JGIcombinedJ26739_10120720513300002245Forest SoilQEGMDAEAVACHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELSERLLPSIERATRPHRLAPRSSERYKRGDAAA*
Ga0058904_128145413300004100Forest SoilFPNLPIILLSAYCEIPERILWLVDEYVMKSELPEGLVRIIERATHPYRHAPHYSGERYLRGGAAA*
Ga0058891_102399413300004104Forest SoilEAIAWQIKQRFPSLPIILLSAYAELPERILWLVDEYVMKSELPEQLAPIIERAHKRAPRSNGRCDRHGAAA*
Ga0058897_1004249923300004139Forest SoilSVTAVLLEYKQEGMDAEAIACHIKQRFPNLPIILLSAYSEMPERILWLVDDYIMKSELSDQLVPTIERAHRLAPRSTGRFQRKEAAA*
Ga0068946_122251913300004593Peatlands SoilTPVAAVLLEYKLEGMDAEAVACHIKQRFPKLPIILVSAHSEMPERILWLVDEYVMKSEMPERLVPIIERATHPYGLALISNEQRQRRGAAA*
Ga0058899_1011421833300004631Forest SoilIKQRFPNLPIILLSSYSDMPERILWLVDEFVMKSELPERLVPIIERAHRLAPGSSEVSPRRQGAAR*
Ga0070733_1095639613300005541Surface SoilMLEDTPVSAVLLEYKLEGMDAEAVAHYIKQRFPSLPIILFSAFSEMPERILWLVDEYVMKSELQERLVPIIERARLPRPLPSRSKQKCQGSSAAA*
Ga0070732_1048477023300005542Surface SoilGMDAEALACLIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERACRRAPRSEEGQQRSGAAA*
Ga0070732_1049832813300005542Surface SoilGMDAEALACLIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPVIERACRRAQRSEEGRQCNGAAA*
Ga0068856_10045703213300005614Corn RhizosphereDSEAIACHIKQQFPDVPVILLSAYFEMPERVLWLVDEYVMKSELQERLVPIIERAHKLSLSWRTVPAQGAEA*
Ga0070766_1019800413300005921SoilRFPNLPIILLSAYSDMPERILWLVDEYVMKSELSERLLPIIQQVAERSTRSGRIKPHSSERYEHRNAVA*
Ga0066788_1010059513300005944SoilILLSAYSEMPERILWLVDEYVMKSELHERLIPTIERAHNRAPRSNGPCQPSGAAA*
Ga0075029_10002410013300006052WatershedsMDAEAVACHIKQRFPKLPIILLSAYAEMPERILWLVDEYVMKSELPERLVPTIERVTRPTSAHKAYKLAPRSNERYRRNPAA*
Ga0075029_10017322113300006052WatershedsEAIACHIRQRFPNLPIILLSAYSEIPERVLWLVDEYVMKSELTDRLVPIIERAHRLPRLSNEQSRPSKAAA*
Ga0075017_10156823323300006059WatershedsDAEAIACHIKQRFPDLPIILFSAYSQLPERILWLVDDCIMKSELPERLIPIIERVKIARPSNERFQRGKVAA*
Ga0075019_1006484033300006086WatershedsMDAEAVACHIKQRFPKLPIILLSAYAEMPERILWLVDEYVMKSELPERLVPIIERVYTAALRPNERCRQGREAA*
Ga0075015_10097347423300006102WatershedsPIILLSAYSEMPERILWLVDEYVMKSELPGGLVRIIEQAMHRHRLASGSNQRSQRSGAAA
Ga0075018_1011265733300006172WatershedsAVLLEYKLEGIDAEAVAGHIKQRFPELPIILLSGHSEMPERILWLVDAYVMRSELSEQLIGIIERATHPRALAVRSEGRPRGGAAA*
Ga0070765_10042630243300006176SoilDTEAVACHIKERFPNLPIILLSAYSEMPERILWLVDEYLMKSDLPERLVPTIERAHRLAPRSNVQFSVGPTA*
Ga0073928_1073650023300006893Iron-Sulfur Acid SpringCLIKQRFPNLPIILLSAYSEMPERILWLVDEHVMKSELPERLVPVIERACRRAPRSEQGRAA*
Ga0116128_100028783300009518PeatlandMDAEAVACHIKQRFPNLPIIVLSAYSEMLERILWLVHEYVMKSELPERLAPIVEPAYRLAPRSNEQYQRSGAAA*
Ga0116128_100957033300009518PeatlandDAEAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMRSELPEGLVRIIERVTQSHRLALRSNEPGQRSRAAA*
Ga0116108_108960623300009519PeatlandMDAEAVACHIKQRFPNLPIILLSAYSEMLERILWLVREYVIMKSELPERLAPIVEPAYRLAPRSNEQYQRSGAAA*
Ga0116136_109934213300009547PeatlandCHIKQRFPNLPIILLSAYSELPERILWLVDEYVMKSELPEGLVRIIERVTQSQRLALRSNELCQRSGAAA*
Ga0116137_101233833300009549PeatlandCHIKQRFPNLPIILLSAYSELPERILWLVDEYVMRSELPEGLVRIIERVTQSHRLALRSNEPGQRSRAAA*
Ga0116137_104850613300009549PeatlandVACHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMRSELPERLVPTIERAHKLALRPNERSQRAA*
Ga0116111_106389623300009616PeatlandFPNLPIILLSAYSEMPERILWWVDEYVMKSELPERLVPIIERTHRLGPHSDKRLQRKEAAA*
Ga0116123_102749953300009617PeatlandVACHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERTHRLGPHSDKRLQRKEAAA*
Ga0116123_108641813300009617PeatlandKKEGIDAEAVACHIKQRFPSLPIILLSAYCEMPERILWLVDEYMMKSEPPEGLVRVIERVTQSYRLVPPSSERCQRAVKAA*
Ga0116112_110929313300009636PeatlandQFPKLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERAYRLAPSSDGQCQRSGAAA*
Ga0116126_128483113300009640PeatlandMDAEAVACHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERTHRLGPHSDKRLQRKEAAA*
Ga0116135_100427213300009665PeatlandIKQRFPNLPIILLSAYSELPERILWLVDEYVMKSELPEGLVRIIERVTQSQRLALRSNELCQRSGAAA*
Ga0116215_145650623300009672Peatlands SoilCHIKQRFPNLPIILLSGYSEMPERILWLVDEYMMKSELPERLGRIIERAYRLAPRSDERRQRRGAAA*
Ga0116131_110654723300009760PeatlandIKEQFPKLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERAYRFAPRSDGQCQRSGAAA*
Ga0116134_114619023300009764PeatlandEGMDAEAVACHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERAHKLAPHSNERSQRAA*
Ga0116223_1045820513300009839Peatlands SoilVLLECKQEGMDAEGIAYHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERAHKLAPLSNERLQRSGAAA*
Ga0136449_10092546623300010379Peatlands SoilEETPVAAILLEYKLEGMDAEAVACHIKQRFPNLPIILLSGYSEMPERILWLVDEYMMKSELPERLGRIIERAYRLAPRSDERRQRRGAAA*
Ga0138574_110660123300011076Peatlands SoilMDAEAVACHIKQRFPNLPIILLSAYSGMPERVLWLVDEYVMKSELPERLVPIIERAHKLAVHSNEWSQRRVTAA*
Ga0138601_12772513300011108Peatlands SoilLEYKLEGMDAEAVAWHIKQRFPHLQIILLSAYSEMPERILWLVDEYVMKSEPPERLVRIIERAYRLAPRSDERYQRRGAAA*
Ga0150983_1134212313300011120Forest SoilEGMDAEAVACHIKQRFPDLPIILLSAYSDMPERILWLGDEYVMKSELSERLLPIIQQVAERSTRSGRIKPHSSERYEHRNAVA*
Ga0150983_1151997913300011120Forest SoilHIKQRFPNLPIILLSAYSEMPERILWLVDDYIMKSELSDQLVPTIERAHRLAPRSTGRFQRKEAAA*
Ga0150983_1288183913300011120Forest SoilSLPIILLSAYCEMPERILWLVDDYVMKSELPERLLTIIERVHKPLDERCQRSGAAAQSPSTHSFVQSGTVPIK*
Ga0150983_1421803313300011120Forest SoilQRFPDLPIILLSAYSEMPERILWLVDDYVMKSELPERLVATIERAHRVAPCGTGRLQRKDAAA*
Ga0120139_101265323300012019PermafrostGMDAEALACHIKQRFPNLPIIMLSACAEIPERILWLVDEYVMRSELTEQLVPIIERAHGLALRSKEGFQQAGHSETSCP*
Ga0137365_1058450323300012201Vadose Zone SoilMDSEAIACHIKQQFPNLPIILLSAFFEMPERILWLVDEYVMKSELPEQLVPIIERAHKPALRPNERFQLGAMEA*
Ga0137398_1091223213300012683Vadose Zone SoilVVLLDYKQEGVDAEATACHIKQRFPNLPIILLSTYSEMPERILWLVDDYVMKSELPERLVPIIERAHKLSLRSNERFQRGGSVA*
Ga0181527_111377923300014153BogMDAEAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMRSELPEGLVRIIERVTQSHRLALRSNEPGQRSRAAA*
Ga0181524_1017815213300014155BogCHIKEQFPKLPIILLSAYSEMPERILWLVDEYVMKSELPQRLVPIIERAYRFAPRSDGQCQRSGAAA*
Ga0181521_1047205513300014158BogHLPIILLSAYHEMPERILWLVDEYVMKSEAPERLVPIIERAYKLAPRSSEQYQRSGAA*
Ga0181531_1104260513300014169BogCHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELSERLLPSIERATRPHRLAPRSSERYERGGAAA*
Ga0181535_1057935823300014199BogGMDAEAVAYQIKQRFPKLPIILLSAYSEMPERILWLVDEYVLKSELPEGLVRIIERETLRYRLSPRSVERAKSRAAVA*
Ga0181526_1037098823300014200BogAIACHIKQRFPNLPIILFSAYSEIPERILWLVDEYVMKSELAERLIPAIERAHRFAQSSKQRFSRSKAAA*
Ga0182010_1065044313300014490FenFPKLPIILLSAYSQMPQRILWLVDEYVMKSELPDRLLPIIKRVTHPAKFTPSSDERYRRSASIA*
Ga0182014_1014022613300014491BogMDAEAVACHIKQRFPNLPIILLSAYCEMPERILWLVDEYVMKSELPERLEPIIERAYRLRLQSDKRCQRSGAAA*
Ga0182013_1061361513300014492BogYKQEGMDAEAIALHIKQRFPNLPIVLLSAYSEIPERILWLVDEYVMKSELPEGLVPIIERAHSRVSHGDERCQSGRR*
Ga0182030_1062766433300014838BogEGMDAEAIACHIKRRFPSLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIDRVTHPQRSDQPCQRSGAGA*
Ga0182030_1129700113300014838BogEGMDAEAIACHIKRRFPSLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIDRVTHPQRSDQQCQRSGAAA*
Ga0182027_1215960613300014839FenEAMAYHIKQKFPNLPIILLSAYSEMPQRILWLVDEYVMKSELPERLLPIVARVTHATKIAPGPSERYRRSASIA*
Ga0187849_101491523300017929PeatlandMDAEAVACHIKQRFPNLPIIVLSAYSEMLERILWLVHEYVMKSELPERLAPIVEPAYRLAPRSNEQYQRSGAAA
Ga0187849_103311133300017929PeatlandVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMKSELPEGLVRIIERVTQSQRLALRSNELCQRSGAAA
Ga0187877_114433423300017931PeatlandDAEAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMKSELPEGLVRIIERVTQSQRLALRSNELCQRSGAAA
Ga0187848_1003785313300017935PeatlandDAEAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMRSELPEGLVRIIERVTQSHRLALRSNEPGQRSRAAA
Ga0187853_1005882223300017940PeatlandEGIDAEAVACHIKQRFPSLPIILLSAYCEMPERILWLVDEYMMKSEPPEGLVRVIERVTQSYRLVPPSSERCQRAVKAA
Ga0187853_1013465313300017940PeatlandKVVNCEQTGILWSLRVCDLGGMDAEAVACHIKQRFPNLPIIVLSAYSEMLERILWLVHEYVMKSELPERLAPIVEPAYRLAPRSNEQYQRSGAAA
Ga0187816_1047466423300017995Freshwater SedimentMDAETIACQVKQRFPYLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERACRLTPRSDERCKSSSGAAA
Ga0187870_120133123300017998PeatlandVVNCEQTGILWSLRVCDLGGMDAEAVACHIKQRFPNLPIIVLSAYSEMLERILWLVHEYVMKSELPERLAPIVEPAYRLAPRSNEQYQRSGAAA
Ga0187868_101056413300018002PeatlandAVAYQIKQRFPKLPIILLSAYSEIPERILWLVDEYVLKSELPEGLVRIIERATLRYRLPPRSVERAKCRAAVA
Ga0187868_104796613300018002PeatlandAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMKSELPEGLVRIIERVTQSQRLALRSNELCQRSGAAA
Ga0187865_127581523300018004PeatlandMDAEAVACHIKQRFPNLPIILLSAYSEMLERILWLVREYVIMKSELPERLAPIVEPAYRLAPRSNEQY
Ga0187878_109994623300018005PeatlandPNLPIILLSAYSELPERILWLVDEYVMRSELPEGLVRIIERVTQSHRLALRSNEPGQRSRAAA
Ga0187884_1004259233300018009PeatlandEAVAYQIKQRFPKLPIILLSAYSEIPERILWLVDEYVLKSELPEGLVRIIERETLRYMLPPRSVERAKCRAAVA
Ga0187860_126672113300018014PeatlandMDSEAVACHIKQRFPILPIILLSAHCEMPERILWLVDEYVMKSELPERLVPIIERAYRLAPSSD
Ga0187880_111265623300018016PeatlandKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSEAPERLVPIIERAYKLAPRSSEQYQRSGAA
Ga0187861_1043457623300018020PeatlandLPIILLSAYCEMPERILWLVDDYVMKSELPERLLTIIERLHKRLDDRCQRSGAAA
Ga0187889_1008970833300018023PeatlandPSLPIILLSAYCEMPERILWLVDDYVMKSELPERLLTIIERLHKRLDDRCQRSGAAA
Ga0187881_1004748313300018024PeatlandKTEGMDAEAVAYQIKQRFPKLPIILLSAYSEIPERILWLVDEYVLKSELPEGLVRIIERETLRYMLPPRSVERAKCRAAVA
Ga0187787_1004963533300018029Tropical PeatlandMDAEAVAFQIKKRFPNQPVILLSAYSCMPERVLWLVDEYVVKNESIEGLVQAIERAIR
Ga0187869_1046363723300018030PeatlandMDAEAVAYQIKQRFPKLPIILLSAYAEVPERILWLVDEYVPKSELPEGLVRTIERETLRRKLPPLSVEGIKRRGAVA
Ga0187869_1057533813300018030PeatlandFPNLPIILLSAYYEMPERILWLVDEYVMKSELPERLVPIIERAHKLAPHSNERSQRAA
Ga0187875_1047800013300018035PeatlandMDAEAVAYQIKQRVPKLPIILLSAYSQMPERILWLVDEHVMKSELPDGLVRIVEQATLRHKFPQRSVERCKGRMGVA
Ga0187862_1016910623300018040PeatlandVAHHIKQRFPNQSIILLSGYSEMRESILWLVDEYVMRSESIEGLARVIERVIGRSQKLALYPAGMARAHRRTA
Ga0187871_1053208713300018042PeatlandYKQEGIDAEAVAWHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPDRLVPIIERAHRRASRSHDTRSDETCRGSRAAA
Ga0187887_1029041313300018043PeatlandMKAWCVEAVAFHIKQRLPSLPIILLSAYCEMPERILWLVDEYVMKSELPERLVPIIERVYTRRPQSDERRQRSGAAA
Ga0187859_1006190213300018047PeatlandKPEGMDAEAVACHIKQRFPDLPIILLSAYAELPERILWLVDEFVMKSELPQRLVPIIEKAHKAHAKFPQTALPNTVM
Ga0187859_1060869413300018047PeatlandPIILLSAYCEMPERILWLVDDYVMKSEMPQRLLTIIERVHKRLDERSQRSAAAA
Ga0187858_1009227033300018057PeatlandEGMDAEAVAYQIKQRFPKLPIILLSAYAEVPERILWLVDEYVPKSELPEGLVRTIERETLRRKLPPLSVEGIKRRGAVA
Ga0187858_1092720813300018057PeatlandIACHIKQRFPNLPIILLSAYCEMPERILWLVDEYVMKSELPKRLVPIIERAHRLARPSNERFQRSKAAA
Ga0182025_100560423300019786PermafrostQRFPNLPIILLSAYSEIPERILRLVDEHVMKSELPEGLVRIIERATHSNRFAPRPNERSQRSMAA
Ga0182025_135080013300019786PermafrostGSRSQSYQTTVSPLPIILLSAYSEMPERILWLVDDFVMKSELPERLVPIIERAHKQASRSTERFQRRGAA
Ga0182031_117357913300019787BogVSQSADPIILLSAYSEIPERILWLVDEYVMKSELPEQLLPIIQRAISSHKLPPRSDKECQHSGAAA
Ga0193726_103959323300020021SoilHIKHRFPNLPIILLSAYSEVPERILWRMDEYVMKSELAERLLPIIERMHRLGPHSADRLQRGRAVA
Ga0210407_1127560513300020579SoilHIKQRFPNLPIILLSAYSEMPDWILWLVDEYVMKSELPERLVPIIERAHSRASRPNERCQAGQGAA
Ga0210399_1009542513300020581SoilLLIILRSADSEMPEQILWLVDEYVMKSELPERLVPIIERACGRAPRSEEGRQRSGAAA
Ga0210399_1121114113300020581SoilGMDAEAIACHIKQRFPNLPIILLSAYSEMPDRILWLVDEYVLKSEMLERLMPTIERAHRLGPHSERWPQRREAAA
Ga0210400_1002820463300021170SoilMDAEAIACHIKQRFPNLPIILLSAYSEMPDRILWLVDEYVLKSEMLERLMPTIERAHRLGPHSERWPQRREAAA
Ga0210393_1128389613300021401SoilFHNLPIILLSAYSDMPERILWLVDEYVMKSELSERLLPIIQQVAERSTRSGRIKPHSSERYEHGSAVA
Ga0210387_1119960413300021405SoilRFPNLPIILLSSYSEMPERILWLVDEFVMKSELPDRLVPIIERAHRLAPGSSEVSSRRQGAAR
Ga0210383_1143204323300021407SoilRRFPNLPIILLSADSEMPEQILWLVDEYVMKSELPERLVPIIERACGRAPRSEEGRQRSGAAA
Ga0210383_1160815313300021407SoilKQRFPDLPIILLSAYSEMPERILWLVDDYVMKSELPERLLPIIEKTHEIASRSTGRARRRDAAA
Ga0210409_1078795423300021559SoilKQQFPNLPIILLSAYAELPERILWLVDDYVMRSELPEGLVRIIERATHPGRRAPLSSKRYPRGGAAA
Ga0242659_107940113300022522SoilHEGMDAEAVACHIKQRFPNLPIILLSAYSDMPERILWLVDEYVMKSELSERLLPIIQQVAERSTRSGRIKPHSSERYEHGSAVA
Ga0212123_1007117143300022557Iron-Sulfur Acid SpringEAIASHIKQRFPDLPIILLSAYSEMPERILWLVDDYVMKSELPERLVPTIERAHKVASRGTRRWQRKDAAA
Ga0242665_1028829623300022724SoilLLAAYAEMPESILWLVDEYVMKSELPERLVPIIERAYRRAARCEEWWQRGGAAA
Ga0224520_105560913300023075SoilPVAAVLLEYKLEGMDAEAIACHIKKRFPSLPIILLSAFSDMPERILWLVDEYVLKSELSERLVPIIERAAPPRRLAPRSNEPGQRSAAAA
Ga0224555_106551333300023088SoilQRFPKLPIILLSAYSQMPERILWLVDEYVLKSELAGGLVRIVERATLRHKFPQRSVERCKGRMGVA
Ga0224558_106553713300023090SoilMDAEAIACHIKKRFPSLPIILLSAFSDMPERILWLVDEYVLKSELSERLVPIIERAAPPRRLAPRSNEPGQRSAAAA
Ga0224558_107773513300023090SoilMDAEAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMKSELPEGLVRIIERVTQSQRLALRSNELCQRSGAAA
Ga0247551_10151123300023552SoilMDAEAVACHIKQRFPNLPIILLSAYSDMPERILWLVDEYVMKSELSERLLPIIQQVAERSTRSGRIKPHSSERYEHGSAVA
Ga0228598_101015613300024227RhizospherePIILLSGYCEIPERILWLVDEYVMKSDLPEGLVRIIERATHPYRHAPHYSSERNQRRGAA
Ga0208323_106924423300025439PeatlandCHIKQRFPNLPIIVLSAYSEMLERILWLVHEYVMKSELPERLAPIVEPAYRLAPRSNEQYQRSGAAA
Ga0208034_100650323300025442PeatlandMDAEAVACHIKQRFPNLPIILLSAYSEMLERILWLVHEYVMKSELPERLAPIVEPAYRLAPRSNEQYQRSGAAA
Ga0208034_107004313300025442PeatlandRFPNLPIILLSAYSEMPERILWWVDEYVMKSELPERLVPIIERTHRLGPHSDKRLQRKEAAA
Ga0208037_107657013300025448PeatlandKEGIDAEAVACHIKQRFPSLPIILLSAYCEMPERILWLVDEYMMKSEPPEGLVRVIERVTQSYRLVPPSSERCQRAVKAA
Ga0208689_105046823300025459PeatlandSLRVCDLGGMDAEAVACHIKQRFPNLPIIVLSAYSEMLERILWLVHEYVMKSELPERLAPIVEPAYRLAPRSNEQYQRSGAAA
Ga0208562_100060813300025460PeatlandAEAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMRSELPEGLVRIIERVTQSHRLALRSNEPGQRSRAAA
Ga0208562_101289333300025460PeatlandAVACHIKQRFPILPIILLSAHCEMPERILWLVDEYVMKSELPERLVPIIERAYRLAPSSDGQCQRSGAAA
Ga0208191_102034713300025496PeatlandGMDAEAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMKSELPEGLVRIIERVTQSQRLALRSNELCQRSGAAA
Ga0208819_1000575253300025498PeatlandMDAEAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMRSELPEGLVRIIERVTQSHRLALRSNEPGQRSRAAA
Ga0208563_105818623300025501PeatlandKQEGVDAEAVACHIKKRFPSLPIILLSAYCEMPERILWLVDDYVMKSELPERLLTIIERLHKRLDDRCQRSGAAA
Ga0208937_108517313300025506PeatlandEAVACHIKQRFPNLPIILLSAYSEIPGRILWLVDEYVMKSEPPEGLVRILERAMHRHGPAPRSSERYQRGGAAA
Ga0208691_102030113300025612PeatlandEAVACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMRSELPEGLVRIIERVTQSHRLALRSNEPGQRSRAAA
Ga0208366_102705423300027073Forest SoilLACLIKQRFPNLPIILLSAYSEMPERILWLVDDYLMKSELPEQLVPIIERACRRAPLSEEGRQRSGAAA
Ga0208488_107775813300027110Forest SoilCHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELSERLLPSIERATRPHRLAPRSSERYERGGAAA
Ga0209524_103797823300027521Forest SoilEAVACHIKERFPNLPIILLSAYSEMPERILWLVDEYLMKSELPERLVPTIERAHRLAPRSNVQYSAGPTA
Ga0209222_104130213300027559Forest SoilCHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELSERLLPSIERATRLHRLAPRSSERYERGGAAA
Ga0208324_115503713300027604Peatlands SoilGMDAEAVACHIKQRFPNLPIILLSGYSEMPERILWLVDEYMMKSELPERLGRIIERAYRLAPRSDERRQRRGAAA
Ga0209422_115200313300027629Forest SoilMDTEAIACDIKQRFPNLPIILLSAYSEMPERILWLVDDYIMKSELSDQLLPTIERAHRLGPHSEKRPQRRKAAA
Ga0209908_1004623213300027745Thawing PermafrostGMDAEAIAYHIKQRFPNLPIILLSAYSEMPERILWLVDEFVMKSELPERLVPIIERAHRLVPGSSEVFPRRQGAAY
Ga0209580_1023221913300027842Surface SoilPNLPIILLSAYSEMPERILWLVDEYVMKSELPEQLVPIIERAQRRAPHSENERPRSGAACNGFIPQLGTHPR
Ga0209580_1033350223300027842Surface SoilQEGMDAEALACLIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERACRRAPRSEEGQQRSGAAA
Ga0209380_1001878353300027889SoilTAVLLEYRHEGMDAEAVACHIKQRFPNLPIILLSAYSDMPERILWLVDEYVMKSELSERLLPIIQRVAERSTRSGRIKPHSSERYEHRNAVA
Ga0209067_1002212723300027898WatershedsMDAEAVACHIKQRFPKLPIILLSAYAEMPERILWLVDEYVMKSELPERLVPIIERVYTAALRPNERCRQGREAA
Ga0302233_1032303613300028746PalsaYHIKQRFPNLPIILLSAYSEIPERILWLVDEYVMKSEMPERLLLIIERAQRLAPRSRERFQHRGAAA
Ga0302269_109517013300028766BogLPIILLSAYSEIPERILWLVDEYVMRSELPEGLVRIIERAIHPCRLAPRSSERYLRGEAV
Ga0302201_1012863323300028785BogGLDAEAVAWYIKQRFPDLPIILLSAYSEMPERILWLVDEYVMKSELPDRLVPIIERAHSHASRPKERCQAGQVA
Ga0302222_1013668223300028798PalsaNLPIILLSAYSDMPERILWLVDEYVMKSEMSERLLPIIQQAAERTTRPARIEPRSSERYERRSAVA
Ga0246001_100124013300029889PeatACHIKQRFPNLPIILLSAYSELPERILWLVDEYVMRSELPEGLVRIIERVTQSHRLALRSNEPGQRSRAAA
Ga0246001_100620013300029889PeatILLSAHCEMPERILWLVDEYVMKSELPERLVPIIERAYRLAPSSDGQCQRSGAAA
Ga0246001_109505713300029889PeatQPIILLSAYSEVPQRILWLVDEYVMKSEVPERLVPIIERAHRLARPSNERFQRSKAAA
Ga0311329_1016837023300029907BogQEGLDAEAVAWYIKQRFPDLPIILLSAYSEMPERILWLVDEYVMKSELPDRLVPIIERAHSHASRPKERCQAGQVA
Ga0311359_1038136913300029914BogQEGIDAEAVAIHIKQRFPNLPIILLSAYSEVPGRMLWLVDEYIMKSELPGRLAPVIEKTARRLASQNEEQVKRRGTAA
Ga0311363_1165118813300029922FenDAEAVAAHIKQRFPSLPIVLLSAYAEMPERVLWLVDEYVMKSELSERLVPIIERVTRPRKLAPGSVEGRQRSGAAA
Ga0311328_1040679113300029939BogRFPSLPIILLSAYSEIPERILWLVDEYVMRSELPEGLVRIIERAIHPCRLAPRSSERYLRGEAVA
Ga0311340_1105582313300029943PalsaHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLAPIIDRARSRALLSNERCQNGQTAV
Ga0311371_1024465423300029951PalsaMDAEAVACHIKQRFPNLPIILLSAYSDMPERILWLVDEYVMKSEMSERLLPIIQQAAERTTRPARIEPRSSERYERRSAVA
Ga0311342_1018125033300029955BogLDAEAVAWYIKQRFPDLPIILLSAYSEMPERILWLVDEYVMKSELPDRLVPIIERAHSHASRPKERCQAGQVA
Ga0311336_1201676823300029990FenLEYKLDGMDAEAVACHIKQRFPTLPIVLLSAYSEMPERILWLVDEYVMKSELPERLVPIIERATHPHRLPPRSSKQCERRGAVA
Ga0302304_1035264313300029993PalsaVACHIKQRFPSLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERVNAHAQQSNQRRHHGGEAA
Ga0302270_1041993123300030011BogKQEGLDAEAVAWYIKQRFPDLPIILLSAYSEMPERILWLVDEYVMKSELPDRLVPIIERAHSHASRPKERCQAGQVA
Ga0302281_1015501013300030044FenACHIKQRFPSLPIILLSAYSEIPERILWLVDEYVMRSELPEGLVRIIERAIHPCRLAPRSSERYLRGEAVA
Ga0311333_1104923513300030114FenGMDAEAVACHIKQRFPTLPIVLLSAYSEMPERILWLVDEYVMKSELPERLVPIIERATHPHRLPPRSSKQCERRGAVA
Ga0311353_1002128383300030399PalsaQRFPNLPIILLSAYSDMPERILWLVDEYVMKSEMSERLLPIIQQAAERTTRPARIEPRSSERYERRSAVA
Ga0311370_1074940523300030503PalsaGNSLFKHRFPHLPIILLSAYSDMPERILWLVDEYVMKSELPERLAPILERAHRLAPRPDQRCPRGGAAA
Ga0311357_1143708613300030524PalsaCHIKQRFPNLPIILLSAYSEIPGRILWLVDEYVMKSEMPERLLLIIERAQRLAPRSRERFQHRGAAA
Ga0311357_1176242023300030524PalsaLEYKQEGMDAEAIAWHIKQRFPNLPIILLSAYTEMPERILWLVDEYVMKSELPERLAPIIDRARSRALLSNERCQNGQTAV
Ga0316363_1042604923300030659Peatlands SoilMDAEGVACHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERAHKLAPLSNERLQRSGAAA
Ga0311345_1027218833300030688BogKQRLPSLPIILLSAYCEMPERILWLVDEYVMKSELPERLVPIIEQAYKRRPDSGERSKRGGVAA
Ga0265746_105140923300030815SoilPNLPIILLSAYSEMPERILWLVDEYVMKSELSERLLPSIERATRRRHRLAPRSSERYERGGAAA
Ga0265737_10365613300030941SoilAEAVACHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELSERLLPSIERVTRPPRLAPHSSEGYERSGAAA
Ga0302325_1059292913300031234PalsaNLPIILLSAYTEMPERILWLVDEYVMKSELPERLAPIIDRARSRALLSNERCQNGQTAV
Ga0302324_10184836923300031236PalsaLPIILLSAYSEMPERILGLVDEYVMKSELPERLVPIIERAHSRASRSKERCQAGRAAA
Ga0302187_1041212923300031259BogQRFPSLPIILLSAYAEMPERVLWLVDEYVMKSELSERLVPIIERVTHPRKLASGSVEGRQRSGAAA
Ga0310686_10934157323300031708SoilMDAEAVAWHIKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELAEGLVPIVERANRRAPRSNEPRSEAAA
Ga0310686_11242024493300031708SoilVKRLWPAVLLEYKQEGMDAEAVACHTKQRFPNLPIILLSAYSEMHERILWSVDECLMKSKPPERLVPILERAQRLAPRST
Ga0307476_1082533813300031715Hardwood Forest SoilVACDIKERFPNLPIILLSAYSEMPERILWLVDEYLMKSELPERLVPTIERAHRLAPRSNVQYSAGPTA
Ga0307477_1018125213300031753Hardwood Forest SoilDAEALACLVKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIEQACRRAACSEEWRQSGGAAA
Ga0307477_1049605513300031753Hardwood Forest SoilKQRFPNLPIILLSAYSEMPERILWLVDEYVMKSEFPERLVPIIERACRRAPRSEDGRQRSGAAA
Ga0307479_1036715213300031962Hardwood Forest SoilVPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERACRRAPRSEEGRQRSGAAA
Ga0307479_1044736513300031962Hardwood Forest SoilLACLVKQRFPNPPIILLSAYSEMPERILWLVDEYVMKSELPERLVPIIERAYRRAACSEEWRQRGGAAA
Ga0311301_1032748513300032160Peatlands SoilAEAVACHIKQKFPDLPIILLSAYCEMPERILWLVDEYVMKSELPERLAPIIERVYRCRPRSDCQRSGAAA
Ga0315742_1027931713300032756Forest SoilNLPIILLSAYSDMPERILWLVDEYVMKSELSERLLPIIQQAAERSTRSGRIKPHSSERCEPSSAVA
Ga0326728_1013259913300033402Peat SoilEGLDAEAVALHIKQRFPSLPIILLSAYHEMPERILWLVDEYVMKGELPEGLVRIIEQATHPSRRAPRSVEPRKVRRAVA
Ga0326728_1015044313300033402Peat SoilACHIKQRFPNLPIVLLSAFCDMPERILWLVDEYVMKSELPERLVPIIGRVTHSRKLAARSNERRQHSAVA
Ga0316212_107238713300033547RootsSAYSEMPERILWLVDEYVMKSELSERLLPSIERVTRPPRLAPHSSEGYERSGAAA
Ga0371489_0227142_648_9323300033755Peat SoilMLEETPVAAVLLEYKREGMDAEAVACHIKQRFPNLPIVLLSAFCDMPERILWLVDEYVMKSELPERLVPIIGRVTHSRKLAARSNERRQHSAVA
Ga0334821_074338_3_1943300033798SoilPSLPIILLSAFSDMLERILWLVDEYVLKSELSERLVPIIERAAPPRRLAPRSNEPCQRSAAAA
Ga0334792_045184_1150_13923300033888SoilTGRHAEAVACHIKQRFPKLPIILLSAYYEIPERILWLVDEYVMKSELPEGLMRIIERATHPYWPAPHYSSERYLRGGAAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.