NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F030425

Metagenome Family F030425

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F030425
Family Type Metagenome
Number of Sequences 185
Average Sequence Length 41 residues
Representative Sequence MATTTNYGWTTPDDTDLVKDGAAAIRTLGSSVDTTTK
Number of Associated Samples 134
Number of Associated Scaffolds 185

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 95.68 %
% of genes from short scaffolds (< 2000 bps) 87.57 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (63.784 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(21.622 % of family members)
Environment Ontology (ENVO) Unclassified
(58.919 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(54.054 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.31%    β-sheet: 12.31%    Coil/Unstructured: 55.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 185 Family Scaffolds
PF05065Phage_capsid 1.08
PF01050MannoseP_isomer 0.54
PF04860Phage_portal 0.54

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 185 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 1.08


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.49 %
UnclassifiedrootN/A33.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_109214038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300002408|B570J29032_109904228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2268Open in IMG/M
3300002835|B570J40625_101066969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300003394|JGI25907J50239_1003448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3866Open in IMG/M
3300003491|JGI25924J51412_1045741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300003497|JGI25925J51416_10143650All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300004054|Ga0063232_10277864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300005581|Ga0049081_10127441Not Available939Open in IMG/M
3300005581|Ga0049081_10344519Not Available506Open in IMG/M
3300006484|Ga0070744_10192643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300006805|Ga0075464_10151701Not Available1361Open in IMG/M
3300006805|Ga0075464_10530653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300006805|Ga0075464_10973951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300006917|Ga0075472_10038952Not Available2233Open in IMG/M
3300006920|Ga0070748_1104790All Organisms → Viruses → Predicted Viral1075Open in IMG/M
3300007165|Ga0079302_1076482Not Available724Open in IMG/M
3300007214|Ga0103959_1109487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2044Open in IMG/M
3300007234|Ga0075460_10006970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4554Open in IMG/M
3300007538|Ga0099851_1048827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1664Open in IMG/M
3300007541|Ga0099848_1096486Not Available1138Open in IMG/M
3300007559|Ga0102828_1158850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300007974|Ga0105747_1149681All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage753Open in IMG/M
3300008012|Ga0075480_10575777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage535Open in IMG/M
3300008114|Ga0114347_1131424Not Available923Open in IMG/M
3300008117|Ga0114351_1046937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2720Open in IMG/M
3300008119|Ga0114354_1084661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1286Open in IMG/M
3300008120|Ga0114355_1226831Not Available570Open in IMG/M
3300008264|Ga0114353_1224919All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage859Open in IMG/M
3300008265|Ga0114361_1138278Not Available759Open in IMG/M
3300008265|Ga0114361_1183775All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae652Open in IMG/M
3300008265|Ga0114361_1192677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300008266|Ga0114363_1050257Not Available1662Open in IMG/M
3300008266|Ga0114363_1186263Not Available652Open in IMG/M
3300008266|Ga0114363_1215196All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300008339|Ga0114878_1164772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage779Open in IMG/M
3300008448|Ga0114876_1184882Not Available721Open in IMG/M
3300008450|Ga0114880_1081874Not Available1286Open in IMG/M
3300008450|Ga0114880_1108939Not Available1058Open in IMG/M
3300008450|Ga0114880_1236922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300009009|Ga0105105_10753904Not Available584Open in IMG/M
3300009082|Ga0105099_10212094Not Available1112Open in IMG/M
3300009085|Ga0105103_10579258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300009160|Ga0114981_10256431All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae953Open in IMG/M
3300009168|Ga0105104_10128141Not Available1369Open in IMG/M
3300009169|Ga0105097_10204057Not Available1088Open in IMG/M
3300009169|Ga0105097_10551173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300009180|Ga0114979_10281945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage990Open in IMG/M
3300009183|Ga0114974_10591636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage613Open in IMG/M
3300010316|Ga0136655_1125860All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage768Open in IMG/M
3300010370|Ga0129336_10036488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2965Open in IMG/M
3300010370|Ga0129336_10315406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage866Open in IMG/M
3300012012|Ga0153799_1025628All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1158Open in IMG/M
3300012013|Ga0153805_1041974All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300012017|Ga0153801_1028729Not Available983Open in IMG/M
3300012017|Ga0153801_1042382All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300012665|Ga0157210_1022825Not Available1004Open in IMG/M
3300013005|Ga0164292_10877209Not Available564Open in IMG/M
3300013372|Ga0177922_10099779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300013372|Ga0177922_11060652Not Available2302Open in IMG/M
3300014811|Ga0119960_1101533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300017701|Ga0181364_1024674All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage983Open in IMG/M
3300017722|Ga0181347_1062489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1108Open in IMG/M
3300017722|Ga0181347_1071189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300017722|Ga0181347_1096231Not Available849Open in IMG/M
3300017723|Ga0181362_1038657All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1008Open in IMG/M
3300017754|Ga0181344_1117122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage769Open in IMG/M
3300017754|Ga0181344_1195176All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300017761|Ga0181356_1111084All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae883Open in IMG/M
3300017761|Ga0181356_1235303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300017774|Ga0181358_1139114Not Available838Open in IMG/M
3300017777|Ga0181357_1242537All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300017778|Ga0181349_1267459Not Available565Open in IMG/M
3300017778|Ga0181349_1282677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300017780|Ga0181346_1178944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300017780|Ga0181346_1228780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300017784|Ga0181348_1102495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1116Open in IMG/M
3300018065|Ga0180430_11010855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300018416|Ga0181553_10496271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300019784|Ga0181359_1139462Not Available845Open in IMG/M
3300019784|Ga0181359_1194603Not Available658Open in IMG/M
3300019784|Ga0181359_1239980All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300020162|Ga0211735_10097049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300020172|Ga0211729_10690239Not Available767Open in IMG/M
3300020493|Ga0208591_1021945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
3300020506|Ga0208091_1001397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3825Open in IMG/M
3300020506|Ga0208091_1028875All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300020529|Ga0208233_1006683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1798Open in IMG/M
3300020530|Ga0208235_1000772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6613Open in IMG/M
3300020553|Ga0208855_1037277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300020557|Ga0208231_1010865All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1657Open in IMG/M
3300020571|Ga0208723_1033349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage752Open in IMG/M
3300021961|Ga0222714_10550048Not Available584Open in IMG/M
3300022190|Ga0181354_1026630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1871Open in IMG/M
3300022190|Ga0181354_1066716Not Available1194Open in IMG/M
3300022190|Ga0181354_1184767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300022198|Ga0196905_1046453Not Available1249Open in IMG/M
3300022198|Ga0196905_1132097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300022200|Ga0196901_1039905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1794Open in IMG/M
3300025635|Ga0208147_1122928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300025645|Ga0208643_1171687Not Available533Open in IMG/M
3300025647|Ga0208160_1120813Not Available661Open in IMG/M
3300025655|Ga0208795_1122430Not Available675Open in IMG/M
3300027123|Ga0255090_1061629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300027131|Ga0255066_1033438Not Available723Open in IMG/M
3300027151|Ga0255063_1016915All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1551Open in IMG/M
3300027156|Ga0255078_1055048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage795Open in IMG/M
3300027586|Ga0208966_1154448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300027679|Ga0209769_1247428All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300027688|Ga0209553_1068273Not Available1346Open in IMG/M
3300027697|Ga0209033_1086311Not Available1050Open in IMG/M
3300027756|Ga0209444_10170916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage813Open in IMG/M
3300027759|Ga0209296_1226456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300027764|Ga0209134_10055679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1319Open in IMG/M
3300027764|Ga0209134_10189655All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300027764|Ga0209134_10244981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300027782|Ga0209500_10248610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300027785|Ga0209246_10169921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300027792|Ga0209287_10229063Not Available710Open in IMG/M
3300027798|Ga0209353_10309730All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300027808|Ga0209354_10275649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage672Open in IMG/M
3300027892|Ga0209550_10048977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3434Open in IMG/M
3300027892|Ga0209550_10843051Not Available509Open in IMG/M
3300027973|Ga0209298_10191874All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300028025|Ga0247723_1054542All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1128Open in IMG/M
3300028269|Ga0255193_1016397Not Available1075Open in IMG/M
3300028394|Ga0304730_1037364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2456Open in IMG/M
3300028394|Ga0304730_1338388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300028394|Ga0304730_1338500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
(restricted) 3300028553|Ga0247839_1072480All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1779Open in IMG/M
3300031566|Ga0307378_11186385Not Available606Open in IMG/M
3300031673|Ga0307377_10295154Not Available1230Open in IMG/M
3300031758|Ga0315907_10210479Not Available1626Open in IMG/M
3300031758|Ga0315907_10382197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1139Open in IMG/M
3300031857|Ga0315909_10010843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9680Open in IMG/M
3300031857|Ga0315909_10454313Not Available899Open in IMG/M
3300031857|Ga0315909_10750549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300031951|Ga0315904_10221143Not Available1840Open in IMG/M
3300031951|Ga0315904_10495129All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1079Open in IMG/M
3300031951|Ga0315904_11266702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300031963|Ga0315901_10591770Not Available844Open in IMG/M
3300031963|Ga0315901_11039186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300032046|Ga0315289_11253415All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300032046|Ga0315289_11253905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300032116|Ga0315903_10763061All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300032118|Ga0315277_10751373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage929Open in IMG/M
3300032173|Ga0315268_12324727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300033521|Ga0316616_102937815Not Available642Open in IMG/M
3300033521|Ga0316616_104148484All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300033816|Ga0334980_0303511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300033981|Ga0334982_0269455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
3300033996|Ga0334979_0155771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1378Open in IMG/M
3300034012|Ga0334986_0521045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300034021|Ga0335004_0344562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage864Open in IMG/M
3300034022|Ga0335005_0243268Not Available1095Open in IMG/M
3300034023|Ga0335021_0296532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage869Open in IMG/M
3300034061|Ga0334987_0351697All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage953Open in IMG/M
3300034062|Ga0334995_0040647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3893Open in IMG/M
3300034062|Ga0334995_0240484All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1227Open in IMG/M
3300034062|Ga0334995_0684672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300034062|Ga0334995_0743882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300034071|Ga0335028_0531158Not Available645Open in IMG/M
3300034073|Ga0310130_0234499Not Available576Open in IMG/M
3300034092|Ga0335010_0322261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage877Open in IMG/M
3300034104|Ga0335031_0102451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2017Open in IMG/M
3300034104|Ga0335031_0156828Not Available1570Open in IMG/M
3300034104|Ga0335031_0736986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300034105|Ga0335035_0239044Not Available1099Open in IMG/M
3300034105|Ga0335035_0457903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300034106|Ga0335036_0554773All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage706Open in IMG/M
3300034112|Ga0335066_0181496All Organisms → Viruses → Predicted Viral1261Open in IMG/M
3300034118|Ga0335053_0106080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1938Open in IMG/M
3300034118|Ga0335053_0170283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1454Open in IMG/M
3300034119|Ga0335054_0145551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1448Open in IMG/M
3300034166|Ga0335016_0549948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300034200|Ga0335065_0565525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300034283|Ga0335007_0696808Not Available569Open in IMG/M
3300034418|Ga0348337_058112Not Available1496Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake21.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater16.22%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.73%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton6.49%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.95%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.78%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.24%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.24%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.16%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.16%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.62%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.08%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.54%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.54%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.54%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.54%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.54%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.54%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.54%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.54%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.54%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.54%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.54%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.54%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003491Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003497Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DNEnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007165Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16EnvironmentalOpen in IMG/M
3300007214Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008265Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300018065Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaGEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020493Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020529Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020557Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027123Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027136Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027151Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300027156Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028269Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034023Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10921403823300002408FreshwaterMATTTNYGWTTPDDTDLVKDGAAAIRTLGSSVDTTTKNLNPSTT
B570J29032_10990422833300002408FreshwaterMATTTNYGWTTPDDTSLVKDGAAAIRTLGSSVDTTTKNLNPETTLGDIAYR
B570J40625_10106696913300002835FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNPETTLGDIAYRS
JGI25907J50239_100344813300003394Freshwater LakeMATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLN
JGI25924J51412_104574123300003491Freshwater LakeMATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPE
JGI25925J51416_1014365023300003497Freshwater LakeMATTTNYGWTTPDDTALVKDGAAAIRTLGSSIDTTTKALNPS
Ga0063232_1027786423300004054Freshwater LakeMATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKALNPET
Ga0049081_1012744123300005581Freshwater LenticMATTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNPETTL
Ga0049081_1034451923300005581Freshwater LenticMANTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNPETTL
Ga0070744_1019264313300006484EstuarineMATTTNYGWTTPDDTALVKDGAAAIRTLGTSVDTTTKN
Ga0075464_1015170123300006805AqueousMATTTNFNWSTPDDTSLVKDGAAAIRTLGSSIDTSFVDLKGG
Ga0075464_1053065313300006805AqueousMPSTTNFGWTTPADTDYVKDGASAIRTLANGIDTSMA
Ga0075464_1097395123300006805AqueousMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPETTLG
Ga0075472_1003895213300006917AqueousMASTTNYGWSTPDDTSLVKDGASAIRTLGSSIDTTTKALNPE
Ga0070748_110479023300006920AqueousMATTTNYGWTTPDDTDLVKDGAAAIRTLGSSVDTTTK
Ga0079302_107648223300007165Deep SubsurfaceMATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDLEYRSA
Ga0103959_110948713300007214Freshwater LakeMPTTTNYGWTTPADTDLVKDGASAIRTLGTSIDTTTKNL
Ga0075460_1000697073300007234AqueousMATTTNYSWTTPDDTDLVKDGAAAIRTLGSSADTT
Ga0099851_104882733300007538AqueousMATTTNYNWATPDDTDLVKDGASAIRTLGSSADTTVKNLNPGTTAG
Ga0099848_109648623300007541AqueousMANTTNFGWTTPDDTDLVKDGAAAIRTLGSAIDTSLVDL
Ga0102828_115885023300007559EstuarineMATTTNYGWTTPDDTALVKDGADAIRTLGTSVDTTT
Ga0105747_114968113300007974Estuary WaterMATTTNYGWTTPDNTALVKDGAAAIRTLGSSVDTTTKALNPS
Ga0075480_1057577713300008012AqueousMANTTNFNWETPDDTDLVKDGAAAIRTLGNSIDTSFVDLKG
Ga0114347_113142413300008114Freshwater, PlanktonMATTTNYNWSTPDDTALVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIEY
Ga0114351_104693743300008117Freshwater, PlanktonMATTTNYSWSTPDDTALVKDGAAAIRSLGTAIDSTVFTNAG
Ga0114354_108466123300008119Freshwater, PlanktonMATTTNYGWVTPDDTALVKDGASAIRTLGSSVDTT
Ga0114355_122683113300008120Freshwater, PlanktonMPTTSNFGWTTPADTDLVKDGAAAIRTLGNGIDTSFL
Ga0114353_122491923300008264Freshwater, PlanktonMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTPTKNLNPQTTTGALAYRS
Ga0114361_113827823300008265Freshwater, PlanktonMATTTNYSWTTPDDTALVKDGASAIRSLGTAIDTTT
Ga0114361_118377523300008265Freshwater, PlanktonMATTTNYGWTTPDDTSLVKDGASAIRTLGSAIDTSLVD
Ga0114361_119267713300008265Freshwater, PlanktonMANTTNYNWETPDDTDLVKDGAAAIRTLGNSIDTTTKALNPQTTLGDIAY
Ga0114363_105025713300008266Freshwater, PlanktonMATTTNFGWETPDDTDLVKDGAAAMRTLGSAIDTSLV
Ga0114363_118626323300008266Freshwater, PlanktonMATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTKALNP
Ga0114363_120463423300008266Freshwater, PlanktonMPTTTNYSWTTPADTDLVKDGAAAIRTLGTAIDTTVFN
Ga0114363_121519613300008266Freshwater, PlanktonMATTTNYGWETPDDTDLVKDGAAAIRTLGSSVDTTTKALNPSTTLGD
Ga0114878_116477213300008339Freshwater LakeMANTTNFNWETPDDTDLVKDGAAAIRTLGNSIDTS
Ga0114876_118488213300008448Freshwater LakeMATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIE
Ga0114880_108187413300008450Freshwater LakeMANTTNFGWETPDDTDLVKDGAAAMRTLGNSIDSSF
Ga0114880_110893923300008450Freshwater LakeMATTTNYSWSTPDDTALVKDGAAAIRTLGSSIDTTTK
Ga0114880_123692213300008450Freshwater LakeMANTTNYNWETPDDSDLVKDGAAAIRTLGNSIDTTTKNLNPETTTGDIAYRS
Ga0105105_1075390423300009009Freshwater SedimentMASTTNYSWTTPDDTALVKDGAAAIRSLGSAIDTTTKALNPSTTLGDIEYRS
Ga0105099_1021209423300009082Freshwater SedimentMATTTNYGWETPDDTDLVKDGAAAIRTLGNSIDTTMA
Ga0105103_1057925813300009085Freshwater SedimentMATTTNFGWTTPDNTGYVKDGALAIRTLGSAIDSTL
Ga0114981_1025643123300009160Freshwater LakeMATTTNYSWTTPDDTALVKDGASAIRALGTAIDTSM
Ga0105104_1012814113300009168Freshwater SedimentMATTTNYGWTTPNDTDLVKDGAAAIRTLGSSVDTTTKAL
Ga0105097_1020405723300009169Freshwater SedimentMATTTNYSWTTPDDTSLVKDGAAAIRSLGTSIDTTTKA
Ga0105097_1055117323300009169Freshwater SedimentMANTTYFGWETPDDTDLVKDGAAAIRTLGQAIDTSM
Ga0114979_1028194523300009180Freshwater LakeMATTTNYGWTTPDDTALVKDGAAAIRTLGTSVDTTTKNLNPET
Ga0114974_1059163623300009183Freshwater LakeMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTT
Ga0136655_112586013300010316Freshwater To Marine Saline GradientMATTTNFGWDTPDDTDLVKDGALAIRTLGSSIDTSFVD
Ga0129336_1003648833300010370Freshwater To Marine Saline GradientMPTTSNFGWTTPADTDLVKDGAAAIRTLGNGIDTSF
Ga0129336_1031540613300010370Freshwater To Marine Saline GradientMANTTNFGWETPDDTDLVKDGAAAMRTLGNSIDTS
Ga0153799_102562823300012012FreshwaterMATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPET
Ga0153805_104197423300012013Surface IceMATTTNYGWTTPNDTDLVKDGAAAIRTLGSSVDTTTKALNPS
Ga0153801_102872913300012017FreshwaterMATTTNYSWETPDDTDLVKDGAAAIRTLGSSIDTTTKALN
Ga0153801_104238213300012017FreshwaterMANTTNFNWETPDDTDLVKDGAAAIRTLAGAIDTS
Ga0157210_102282513300012665FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTTGALAYR
Ga0164292_1087720923300013005FreshwaterMATTTNYGWTTPDDTALVKDGASAIRTLGSSIDSTLKTQIDA
Ga0177922_1009977923300013372FreshwaterMANTANFGWETPDDTDLVKDGAASIRTLGSAIDTSM
Ga0177922_1106065233300013372FreshwaterMATTTNYGWTTPDDTALVKDGASAIRSLGSSVDTTVKNLN
Ga0119960_110153323300014811AquaticMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTPKDRDWE
Ga0181364_102467413300017701Freshwater LakeMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKN
Ga0181347_106248923300017722Freshwater LakeMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNLN
Ga0181347_107118923300017722Freshwater LakeMANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTTKALNPSTTLGDIE
Ga0181347_109623113300017722Freshwater LakeMATTTNYSWETPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTTGAI
Ga0181362_103865723300017723Freshwater LakeMATTTNYGWTTPHDTALVKDGAAAIRTLGSSVDTNTKNLNPE
Ga0181344_111712223300017754Freshwater LakeMATTTNYGWTTPDDTALVKDGASAIRTLGSSIDTTTK
Ga0181344_119517623300017754Freshwater LakeMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNL
Ga0181356_111108423300017761Freshwater LakeMATTTNNGWTTPDNTALVKDGASAIRTLGQAIDTTLGV
Ga0181356_123530323300017761Freshwater LakeMANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNPS
Ga0181358_103696733300017774Freshwater LakeMPTTTNNGWTTPADTDLVKNGASAIRTLGNAIDSTLGVYVAST
Ga0181358_113911423300017774Freshwater LakeMATTTNYGWSTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPQTTTGALAYR
Ga0181357_124253713300017777Freshwater LakeMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKN
Ga0181349_126745923300017778Freshwater LakeMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNLNPQTTTGALAYRSA
Ga0181349_128267723300017778Freshwater LakeMANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTT
Ga0181346_117894423300017780Freshwater LakeMATTTNYGWTTPDDTSLVKDGASAIRTLGTAIDTTTFNNASA
Ga0181346_122878013300017780Freshwater LakeMATTTNFGWETPDDTDLVKDGALAMRTLGNAIDTSLV
Ga0181348_110249523300017784Freshwater LakeMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNLNPQT
Ga0180430_1101085523300018065Hypersaline Lake SedimentMATTANYSWPTPDDTDLVRDGAAAIRALGSAAAAT
Ga0181553_1049627123300018416Salt MarshMPSTTNFSWTTPADTDYVKDGASAIRTLANGIDTSMAQL
Ga0181359_113946223300019784Freshwater LakeMATTTNYGWSTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPQT
Ga0181359_119460313300019784Freshwater LakeMANTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNPETTLGDIAY
Ga0181359_123998023300019784Freshwater LakeMPTTTNNGWTTPADTALVKDGASAIRTLGNNIDST
Ga0211735_1009704923300020162FreshwaterMATTTNYGWTTPDDTSLVKDGASAIRTLGTSVDTTTKNLNPS
Ga0211729_1069023923300020172FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGNSIDTTTKNLNPETTTGD
Ga0208591_102194523300020493FreshwaterMATTTNNGWETPDDTDLVKDGALAMRTLGQAIDTSVGTG
Ga0208091_100139763300020506FreshwaterMANTTNFGWETPDDTDLVKDGAAAIRTLGSAIDTSLADLEGG
Ga0208091_102887513300020506FreshwaterMATTTNYSWSTPDDTALVKDGAAAIRTLGSSADTTVKALNPGTTAG
Ga0208233_100668313300020529FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKN
Ga0208235_1000772103300020530FreshwaterMATTTNYSWTTPDDTALVKDGALAIRTLGSSVDTTVKN
Ga0208855_103727713300020553FreshwaterMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTK
Ga0208231_101086513300020557FreshwaterMANTTNFGWETPDDTDLVKDGAAAIRTLGSAIDTS
Ga0208723_103334913300020571FreshwaterMATTTNYSWTTPDDTDLVKDGAAAIRTLGSSVDTTTKA
Ga0222714_1055004813300021961Estuarine WaterMASTTNYSWTTPDDTSLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIE
Ga0181354_102663033300022190Freshwater LakeMATTTNYGWTTPDDTALVKDGASAIRTLGTSVDTTTKNLNPET
Ga0181354_106671623300022190Freshwater LakeMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNLNPQTT
Ga0181354_118476723300022190Freshwater LakeMANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTTK
Ga0196905_104645323300022198AqueousMASTTNYSWTTPDDTDLVKDGAAAIRTLGSSADTTV
Ga0196905_113209723300022198AqueousMATTTNYSWTTPDDTDLVKDGASAIRTLGSSADTTLKALNPGT
Ga0196901_103990533300022200AqueousMATTTNYNWATPDDSDLLKDGASAIRTLGSSADTTVKNLNPGTT
Ga0208147_112292823300025635AqueousMATTTNYGWTTPNDTDLVKDGAAAIRTLGSSVDTTTKALNPETTL
Ga0208643_117168713300025645AqueousMATTTNYSWSTPDDTSLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIEYR
Ga0208160_112081313300025647AqueousMATTTNYAWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNPS
Ga0208795_112243013300025655AqueousMATTTNFGWTTPDDTDLVKDGAAAIRTLGSAIDTSLVDLKGG
Ga0208783_1005774433300025872AqueousMPTTTNNGWTTPADTDIVRNGAQAMRTLGNNIDASIGKL
Ga0255090_106162923300027123FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTT
Ga0255066_103343823300027131FreshwaterMATTTNYSWETPDDTDLVKDGAAAIRTLGSSIDTTTK
Ga0255107_100082713300027136FreshwaterMATTTNYGWSTPDNTAYVKDGASAIRTLGSAIDTTA
Ga0255063_101691533300027151FreshwaterMATTTNYGWTTPDDTALVKDGASAIRTLGTSVDTTTKNL
Ga0255078_105504813300027156FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTT
Ga0208966_115444813300027586Freshwater LenticMATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPETT
Ga0209769_124742823300027679Freshwater LakeMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPETT
Ga0209553_106827313300027688Freshwater LakeMATTTNYGWETPDDTDLVKDGAAAIRTLGNSVDTTTKAL
Ga0209033_108631123300027697Freshwater LakeMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSIDTT
Ga0209444_1017091613300027756Freshwater LakeMANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTK
Ga0209296_122645613300027759Freshwater LakeMATTTNYGWATPDDTALVKDGAAAIRTLGTSVDTTTKNLNPSTTLGDIEYR
Ga0209134_1005567913300027764Freshwater LakeMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPE
Ga0209134_1018965513300027764Freshwater LakeMATTTNYSWTTPDDTALVKDGAAAIRSLGTAIDTTVF
Ga0209134_1024498113300027764Freshwater LakeMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKALNPST
Ga0209500_1024861013300027782Freshwater LakeMATTTNYGWTTPNDTDYVYQGAAAIRTTANSIDTTVYSLPQ
Ga0209246_1016992123300027785Freshwater LakeMATTTNYGWSTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPQTTTGALAYRS
Ga0209287_1022906313300027792Freshwater SedimentMATTTNYAWETPDDTDLVKDGAAAIRTLGSSIDTTT
Ga0209353_1030973013300027798Freshwater LakeMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTT
Ga0209354_1001330213300027808Freshwater LakeMATTTNYGWTTPDDTSLVKDGASAIRTLGTAIDTTTFNNAS
Ga0209354_1027564923300027808Freshwater LakeMATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKALNP
Ga0209550_1004897753300027892Freshwater LakeMANTTNFNWETPDDTDLVKDGAAAIRTLAGAIDTSL
Ga0209550_1084305123300027892Freshwater LakeMATTTNYGWETPDDTGLVKDGAAAIRTLGSSVDTT
Ga0209400_110309033300027963Freshwater LakeMATTTNFGWSTPDDSANVKDGAAAIRSLGTAVDTTVATMVPKT
Ga0209298_1019187413300027973Freshwater LakeMATTTNFLWATPDDTALVKNGASAIRTLGSSADSTVQ
Ga0247723_105454213300028025Deep Subsurface SedimentMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKALN
Ga0255193_101639723300028269FreshwaterMATTTNYSWTTPDDTDLVKDGAAAIRTLGSSADTTVKN
Ga0304730_103736413300028394Freshwater LakeMATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPETTLGDISYR
Ga0304730_109568823300028394Freshwater LakeMATTTNNGWTTPNDTDLVRNGASAIRSLGSAIDSSLGKASY
Ga0304730_133838823300028394Freshwater LakeMATTTNYGWTTPDDTGLVKDGASAIRTLGTSVDTTTKNL
Ga0304730_133850013300028394Freshwater LakeMATTTNYSWTTPDDTALVKDGASAIRTLGTSIDTTTKNLNPS
(restricted) Ga0247839_107248033300028553FreshwaterMATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPETTLG
Ga0307378_1118638513300031566SoilMATTTNYSWTTPDDTDLVKDGAAAIRTLGSSADTTVKA
Ga0307377_1029515423300031673SoilMATTTNYSWTTPDDTDLVKDGASAIRTLGSAIDTTVF
Ga0315907_1021047933300031758FreshwaterMATTTNYAWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIEY
Ga0315907_1038219723300031758FreshwaterMATTTNYSWTTPDDTALVKDGAAAIRSLGTAIDTTVFTNAG
Ga0315909_10010843113300031857FreshwaterMATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTK
Ga0315909_1045431313300031857FreshwaterMATTTNYGWTTPDDTSLVKDGASAIRSLGTAIDTTTK
Ga0315909_1075054923300031857FreshwaterMANTTNFNWETPDDTDLVKDGAAAIRTLGSAIDTSLVDLK
Ga0315904_1022114313300031951FreshwaterMATTTNYGWTTPNDTDLVKDGASAIRTLGSSIDTTVF
Ga0315904_1049512923300031951FreshwaterMPSTTNFGWTTPADTDLVKDGAAAIRTLGNGIDTSFL
Ga0315904_1126670223300031951FreshwaterMATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTKALNPST
Ga0315901_1059177013300031963FreshwaterMATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTT
Ga0315901_1103918613300031963FreshwaterMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKA
Ga0315289_1125341513300032046SedimentMATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPETTLGD
Ga0315289_1125390513300032046SedimentMASTTNYSWVTPDDTSLVKDGASAIRTLGSSVDTTTKNLNP
Ga0315903_1076306123300032116FreshwaterMATTTNYGWTTPDDTALVKDGASAIRSLGTAIDTTTKNLNPSTTLGDIEYRSA
Ga0315277_1075137323300032118SedimentMATTTNYSWTTPDDTALVKDGASAIRSLGTAIDTTTYN
Ga0315268_1232472723300032173SedimentMATTTNYGWTTPDDTALVKDGASAIRTLGTSVDTTTK
Ga0316616_10293781523300033521SoilMANTTNFNWETPDDTDLVKDGAAAIRTLGNSIDTSFV
Ga0316616_10414848413300033521SoilMASTTNYNWTTPDDTDLVKNGASAIRSLGSSVDTALWSAGYQAG
Ga0334980_0303511_497_6193300033816FreshwaterMATTTNYSWTTPDDTALVKDGAAAIRSLGTAIDSTVFTNAG
Ga0334982_0269455_2_1093300033981FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTT
Ga0334979_0155771_2_1513300033996FreshwaterMATTTNFGWTTPDNTGYVKDGALAIRTLGSAIDSTLYDLDRVGQVVQTTG
Ga0334986_0521045_430_5793300034012FreshwaterMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPETTLGDIAY
Ga0335004_0344562_732_8633300034021FreshwaterMATTTNYSWSTPDDTALVKDGAAAIRTLGSSADTTVKALNPGTT
Ga0335005_0243268_2_1153300034022FreshwaterMATTTNYGWTTPDDTDLVKDGASAIRTLGSSIDTSVKS
Ga0335021_0296532_747_8693300034023FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNP
Ga0334987_0351697_2_1153300034061FreshwaterMATTTNYGWTTPDDTDLVKNGADAIRVLGASIDTSMNT
Ga0334995_0040647_3774_38933300034062FreshwaterMATTTNYSWSTPDDTALVKDGAAAIRSLGTAIDSTVFTNA
Ga0334995_0240484_3_1253300034062FreshwaterMATTTNYSWSTPDDTALVKDGAAAIRSLGTAIDTTVFTNAG
Ga0334995_0476232_652_7563300034062FreshwaterMATTTNFGWSTPDDSANVKDGAAAIRSLGTAIDTS
Ga0334995_0684672_1_1053300034062FreshwaterMATTPTYGWETPDDTDYVNQGALAMRTLGNSIDST
Ga0334995_0743882_3_1223300034062FreshwaterMATTTNYSWTTPDDTALVKDGAAAIRSLGTAIDSTVFTNA
Ga0335028_0531158_1_1353300034071FreshwaterMATTTNYSWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNPSTTL
Ga0310130_0234499_417_5753300034073Fracking WaterMATTTNYSWTTPDDTDLVKDGASAIRTLGSSADTTVKNLNPGTTAGDIDYYTS
Ga0335010_0322261_773_8773300034092FreshwaterMATTTNYSWSTPDDTALVKDGAAAIRSLGTAIDST
Ga0335031_0102451_3_1103300034104FreshwaterMANTTNFNWETPDDTDLVKDGAAAIRTLGSAIDTSL
Ga0335031_0156828_2_1423300034104FreshwaterMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTTGA
Ga0335031_0736986_426_5603300034104FreshwaterMATTTNYGWTTPDDTALVKDGAAAIRTLGSSIDTTTKALNPSTTL
Ga0335035_0239044_990_10973300034105FreshwaterMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSIDTTT
Ga0335035_0457903_586_7083300034105FreshwaterMATTTNYGWDTPDDTDLVKDGAAAIRTLGSSIDTTTKNLNP
Ga0335036_0554773_1_1443300034106FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTTKALNPSTTLGDI
Ga0335066_0181496_1_1233300034112FreshwaterMATTTNYAWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNP
Ga0335053_0106080_3_1073300034118FreshwaterMATTTNYGWTTPDNTDLVKDGALAIRTLGSSVDTT
Ga0335053_0170283_3_1583300034118FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTTGALAYRS
Ga0335054_0145551_2_1633300034119FreshwaterMATTTNYSWSTPDDTALVKDGALAIRTLGSSVDTTVKNLNPETTTGAISYRGAT
Ga0335016_0549948_525_6383300034166FreshwaterMANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTTKA
Ga0335065_0565525_1_1263300034200FreshwaterMATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKALNPS
Ga0335007_0696808_464_5683300034283FreshwaterMATTTNFGWETPDDTDLVKDGAAAMRTLGNSIDTS
Ga0348337_058112_1_1653300034418AqueousMATTTNYSWTTPDDTDLVKDGASAIRTLGSSVDTTVKDLNPGTTAGDIDYYTSST


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.